Psyllid ID: psy7532

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MMGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKNNYVYVSNNYIYVSINYIYVSNNYIYSLNAGDASDCADSNSDLVCMSHVNAQNIRNYRIPTEPNGTSLNAPYTQFNAFLLYKLEFCPVIRDSHIYQVTNKKKWQSISYF
ccccccEEEEccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccEEEEEEEcccccccccccccccccccEEEEccccccccccccccccccccccccccEEEEcccccccccccEEEEEEEEEEEcccEEEEEEEcccEEEEEEEccEEEEEccccEEEEEEEEEcccccccccccccccEEEEEcccccccccccccEEEEccccccEEcccc
cccccEcEEEEcccccccHHHcccEcccEccEccccEEEEEEEccccEEEEEEEccccHHHHccEEEEEEEccccccccccccccccccEEEEEHHHccccHHHHHHHHcccccccccccEEEcccccccccccccccccccEEEEEcccEEEEEEEEcEEcccEEEcEEEEEEccccccccEEEEEcccccccccccccEEEEEEEcccccccccccccccccccccEcccccc
mmgktvtlhWHGLyqrytpfmdgvqfvtqcpilhntkfrykfpavpdgtffyHSHIALQkmdgiegsfiireprsidktaplwdydlpshvIIITDWlhdmtdekypgflrtntgnfpetylingknnyvyVSNNYIYVSINYIYVSNNyiyslnagdasdcadsnsdlVCMSHVnaqnirnyriptepngtslnapytqFNAFLLYKLefcpvirdshiyqvtnkkkWQSISYF
mmgktvtlHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKNNYVYVSNNYIYVSINYIYVSNNYIYSLNAGDASDCADSNSDLVCMSHVNAQNIRNYRIPTEPNGTSLNAPYTQFNAFLLYKLEFCPVIRDshiyqvtnkkkwqsisyf
MMGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKnnyvyvsnnyiyvsinyiyvsnnyiysLNAGDASDCADSNSDLVCMSHVNAQNIRNYRIPTEPNGTSLNAPYTQFNAFLLYKLEFCPVIRDSHIYQVTNKKKWQSISYF
****TVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKNNYVYVSNNYIYVSINYIYVSNNYIYSLNAGDASDCADSNSDLVCMSHVNAQNIRNYRIPTEPNGTSLNAPYTQFNAFLLYKLEFCPVIRDSHIYQVTNKKKW******
**GKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKNNYVYVSNNYIYVSINYIYVSNNYIYSLNAGDASDCADSNSDLVCMSHVNAQNIRNYRIPTEPNGTSLNAPYTQFNAFLLYKLEFCPVIRDSHIYQVTNKKKWQ****F
MMGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKNNYVYVSNNYIYVSINYIYVSNNYIYSLNAGDASDCADSNSDLVCMSHVNAQNIRNYRIPTEPNGTSLNAPYTQFNAFLLYKLEFCPVIRDSHIYQVTNKKKWQSISYF
**GKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKNNYVYVSNNYIYVSINYIYVSNNYIYSLNAGDASDCADSNSDLVCMSHVNAQNIRNYRIPTEPNGTSLNAPYTQFNAFLLYKLEFCPVIRDSHIYQVTNKKKWQSI*YF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKNNYVYVSNNYIYVSINYIYVSNNYIYSLNAGDASDCADSNSDLVCMSHVNAQNIRNYRIPTEPNGTSLNAPYTQFNAFLLYKLEFCPVIRDSHIYQVTNKKKWQSISYF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query235 2.2.26 [Sep-21-2011]
Q12541 520 Laccase-1 OS=Agaricus bis N/A N/A 0.536 0.242 0.395 2e-19
Q12717 527 Laccase-5 OS=Trametes ver N/A N/A 0.506 0.225 0.4 1e-18
Q99056 527 Laccase-5 OS=Trametes vil N/A N/A 0.506 0.225 0.4 2e-18
Q12739 533 Laccase-2 OS=Pleurotus os N/A N/A 0.506 0.223 0.396 3e-18
Q02081 531 Laccase-4 OS=Thanatephoru N/A N/A 0.540 0.239 0.380 3e-18
Q12542 520 Laccase-2 OS=Agaricus bis N/A N/A 0.536 0.242 0.364 4e-18
O59896 518 Laccase OS=Pycnoporus cin N/A N/A 0.404 0.183 0.47 6e-18
Q99049 473 Laccase-3 OS=Trametes vil N/A N/A 0.404 0.200 0.48 2e-17
Q99044 520 Laccase-1 OS=Trametes vil N/A N/A 0.497 0.225 0.398 2e-17
Q12718 519 Laccase-2 OS=Trametes ver N/A N/A 0.404 0.183 0.46 4e-17
>sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 Back     alignment and function desciption
 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/129 (39%), Positives = 73/129 (56%), Gaps = 3/129 (2%)

Query: 2   MGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFP-AVPDGTFFYHSHIALQK 60
           M ++V++HWHG +Q  T   DG  FV QCP   NT F Y+F  A   GTF+YHSH++ Q 
Sbjct: 75  MRRSVSIHWHGFFQARTSGQDGPSFVNQCPQPPNTTFTYEFSVAEQSGTFWYHSHLSTQY 134

Query: 61  MDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPET 120
            DG+ G+FI+ +PR  D    L+D D  S VI + +W H +  +    F  +      ++
Sbjct: 135 CDGLRGAFIVYDPR--DPLRHLYDVDDESTVITLAEWYHILAPDATNEFFSSGIIPVQDS 192

Query: 121 YLINGKNNY 129
            LINGK  +
Sbjct: 193 GLINGKGRF 201
Lignin degradation and detoxification of lignin-derived products.
Agaricus bisporus (taxid: 5341)
EC: 1EC: .EC: 1EC: 0EC: .EC: 3EC: .EC: 2
>sp|Q12717|LAC5_TRAVE Laccase-5 OS=Trametes versicolor GN=LCC5 PE=2 SV=1 Back     alignment and function description
>sp|Q99056|LAC5_TRAVI Laccase-5 OS=Trametes villosa GN=LCC5 PE=3 SV=2 Back     alignment and function description
>sp|Q12739|LAC2_PLEOS Laccase-2 OS=Pleurotus ostreatus GN=POX2 PE=1 SV=1 Back     alignment and function description
>sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 Back     alignment and function description
>sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 Back     alignment and function description
>sp|O59896|LAC1_PYCCI Laccase OS=Pycnoporus cinnabarinus GN=LCC3-1 PE=1 SV=1 Back     alignment and function description
>sp|Q99049|LAC3_TRAVI Laccase-3 OS=Trametes villosa GN=LCC3 PE=3 SV=1 Back     alignment and function description
>sp|Q99044|LAC1_TRAVI Laccase-1 OS=Trametes villosa GN=LCC1 PE=3 SV=1 Back     alignment and function description
>sp|Q12718|LAC2_TRAVE Laccase-2 OS=Trametes versicolor GN=LCC2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
110761651 746 PREDICTED: laccase-4 [Apis mellifera] 0.548 0.172 0.511 3e-34
380029116 728 PREDICTED: laccase-4-like [Apis florea] 0.548 0.177 0.511 3e-34
285803814 573 laccase 2 [Apis mellifera] 0.548 0.225 0.511 3e-34
307203552 662 Laccase-4 [Harpegnathos saltator] 0.548 0.194 0.527 4e-34
332020016 718 Laccase-4 [Acromyrmex echinatior] 0.548 0.179 0.488 8e-34
156481746 741 laccase 2 [Monochamus alternatus] 0.548 0.174 0.511 1e-33
26190491 760 laccase 2 [Manduca sexta] 0.544 0.168 0.519 2e-33
340722160 741 PREDICTED: l-ascorbate oxidase-like [Bom 0.548 0.174 0.496 3e-33
350416517 741 PREDICTED: L-ascorbate oxidase-like [Bom 0.548 0.174 0.496 3e-33
325302576 729 laccase 2 [Megacopta punctatissima] 0.578 0.186 0.5 3e-33
>gi|110761651|ref|XP_393845.3| PREDICTED: laccase-4 [Apis mellifera] Back     alignment and taxonomy information
 Score =  151 bits (381), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 92/129 (71%)

Query: 1   MMGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQK 60
           + G  VT+HWHG++QR + + DGV FVTQCPI   + FRY++ A  +GT F+H+H  LQK
Sbjct: 217 IEGMEVTIHWHGVWQRGSQYYDGVPFVTQCPIQEGSTFRYQWTAGNEGTHFWHAHTGLQK 276

Query: 61  MDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPET 120
           MDG+ GS +IR+P S D  + L+DYDL +HV++I+DW H+   E++PG L  NTG  PE+
Sbjct: 277 MDGLYGSIVIRQPPSKDPNSNLYDYDLTTHVVLISDWFHENAAERFPGRLAVNTGQAPES 336

Query: 121 YLINGKNNY 129
            LINGK  +
Sbjct: 337 VLINGKGQF 345

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380029116|ref|XP_003698228.1| PREDICTED: laccase-4-like [Apis florea] Back     alignment and taxonomy information
>gi|285803814|gb|ACK57559.2| laccase 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|307203552|gb|EFN82585.1| Laccase-4 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332020016|gb|EGI60467.1| Laccase-4 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156481746|gb|ABU68466.1| laccase 2 [Monochamus alternatus] Back     alignment and taxonomy information
>gi|26190491|gb|AAN17507.1| laccase 2 [Manduca sexta] Back     alignment and taxonomy information
>gi|340722160|ref|XP_003399477.1| PREDICTED: l-ascorbate oxidase-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350416517|ref|XP_003490974.1| PREDICTED: L-ascorbate oxidase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|325302576|dbj|BAJ83488.1| laccase 2 [Megacopta punctatissima] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
FB|FBgn0259247 784 laccase2 "laccase 2" [Drosophi 0.531 0.159 0.507 1.7e-32
FB|FBgn0032116 959 Mco1 "Multicopper oxidase-1" [ 0.536 0.131 0.428 8.7e-28
FB|FBgn0052557 645 CG32557 [Drosophila melanogast 0.485 0.176 0.421 8.6e-22
UNIPROTKB|D0VWU3 499 D0VWU3 "Laccase" [Trametes max 0.489 0.230 0.414 2.2e-17
ASPGD|ASPL0000035520 570 lccB [Emericella nidulans (tax 0.463 0.191 0.408 3.5e-17
TAIR|locus:2135242 582 AT4G39830 [Arabidopsis thalian 0.506 0.204 0.364 4.7e-16
TAIR|locus:2178973 573 AT5G21100 [Arabidopsis thalian 0.480 0.197 0.346 7.3e-16
FB|FBgn0039387 677 MCO3 "multicopper oxidase 3" [ 0.421 0.146 0.343 1.3e-15
UNIPROTKB|G4ND85 597 MGG_11608 "Laccase-2" [Magnapo 0.502 0.197 0.368 1.6e-14
CGD|CAL0000094 626 FET99 [Candida albicans (taxid 0.468 0.175 0.419 2.2e-14
FB|FBgn0259247 laccase2 "laccase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 364 (133.2 bits), Expect = 1.7e-32, P = 1.7e-32
 Identities = 64/126 (50%), Positives = 89/126 (70%)

Query:     1 MMGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQK 60
             M G  VT+HWHG++QR + + DGV FVTQCPI     FRY++     GT F+H+H  LQK
Sbjct:   264 MEGMEVTIHWHGIWQRGSQYYDGVPFVTQCPIQQGNTFRYQWTGNA-GTHFWHAHTGLQK 322

Query:    61 MDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPET 120
             +DG+ GS ++R+P S D  + L+D+DL +H+++I+DWLH+   E+YPG L  NTG  PE+
Sbjct:   323 LDGLYGSVVVRQPPSRDPNSHLYDFDLTTHIMLISDWLHEDAAERYPGRLAVNTGQDPES 382

Query:   121 YLINGK 126
              LINGK
Sbjct:   383 MLINGK 388
GO:0052716 "hydroquinone:oxygen oxidoreductase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005507 "copper ion binding" evidence=IEA
GO:0040003 "chitin-based cuticle development" evidence=IMP
FB|FBgn0032116 Mco1 "Multicopper oxidase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0052557 CG32557 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|D0VWU3 D0VWU3 "Laccase" [Trametes maxima (taxid:259368)] Back     alignment and assigned GO terms
ASPGD|ASPL0000035520 lccB [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2135242 AT4G39830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178973 AT5G21100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0039387 MCO3 "multicopper oxidase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G4ND85 MGG_11608 "Laccase-2" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
CGD|CAL0000094 FET99 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
PLN02604 566 PLN02604, PLN02604, oxidoreductase 6e-22
pfam07732119 pfam07732, Cu-oxidase_3, Multicopper oxidase 7e-22
TIGR03388 541 TIGR03388, ascorbase, L-ascorbate oxidase, plant t 2e-19
COG2132 451 COG2132, SufI, Putative multicopper oxidases [Seco 1e-15
PLN02191 574 PLN02191, PLN02191, L-ascorbate oxidase 1e-14
TIGR03389 539 TIGR03389, laccase, laccase, plant 2e-12
TIGR03390 538 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu 9e-12
TIGR01480 587 TIGR01480, copper_res_A, copper-resistance protein 1e-10
PLN02354 552 PLN02354, PLN02354, copper ion binding / oxidoredu 4e-07
PLN02168 545 PLN02168, PLN02168, copper ion binding / pectinest 2e-06
PLN02835 539 PLN02835, PLN02835, oxidoreductase 8e-06
PLN02792 536 PLN02792, PLN02792, oxidoreductase 7e-05
PLN00044 596 PLN00044, PLN00044, multi-copper oxidase-related p 0.002
>gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase Back     alignment and domain information 
 Score = 93.4 bits (232), Expect = 6e-22
 Identities = 52/133 (39%), Positives = 75/133 (56%), Gaps = 10/133 (7%)

Query: 1   MMGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQK 60
           ++ + V +HWHG+ Q  TP+ DG + VTQCPIL    F Y+F     GT+ YH+H  +Q+
Sbjct: 73  LLTENVAIHWHGIRQIGTPWFDGTEGVTQCPILPGETFTYEFVVDRPGTYLYHAHYGMQR 132

Query: 61  MDGIEGSFIIREPRSIDKTAPL-WDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNF-- 117
             G+ GS  +  PR   K+ P  +DYD     II+TDW H  T E+  G L +   ++  
Sbjct: 133 EAGLYGSIRVSLPRG--KSEPFSYDYD---RSIILTDWYHKSTYEQALG-LSSIPFDWVG 186

Query: 118 -PETYLINGKNNY 129
            P++ LI GK  Y
Sbjct: 187 EPQSLLIQGKGRY 199

Length = 566
>gnl|CDD|219542 pfam07732, Cu-oxidase_3, Multicopper oxidase Back     alignment and domain information
>gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type Back     alignment and domain information
>gnl|CDD|225043 COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|177843 PLN02191, PLN02191, L-ascorbate oxidase Back     alignment and domain information
>gnl|CDD|234194 TIGR03389, laccase, laccase, plant Back     alignment and domain information
>gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type Back     alignment and domain information
>gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family Back     alignment and domain information
>gnl|CDD|177987 PLN02354, PLN02354, copper ion binding / oxidoreductase Back     alignment and domain information
>gnl|CDD|215113 PLN02168, PLN02168, copper ion binding / pectinesterase Back     alignment and domain information
>gnl|CDD|178429 PLN02835, PLN02835, oxidoreductase Back     alignment and domain information
>gnl|CDD|178389 PLN02792, PLN02792, oxidoreductase Back     alignment and domain information
>gnl|CDD|165622 PLN00044, PLN00044, multi-copper oxidase-related protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 235
PLN00044 596 multi-copper oxidase-related protein; Provisional 100.0
PLN02991 543 oxidoreductase 100.0
PLN02354 552 copper ion binding / oxidoreductase 100.0
PLN02792 536 oxidoreductase 100.0
PLN02835 539 oxidoreductase 100.0
KOG1263|consensus 563 100.0
PLN02168 545 copper ion binding / pectinesterase 100.0
PLN02191 574 L-ascorbate oxidase 100.0
TIGR03389 539 laccase laccase, plant. Members of this protein fa 100.0
TIGR03390 538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 100.0
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 100.0
PLN02604 566 oxidoreductase 100.0
TIGR01480 587 copper_res_A copper-resistance protein, CopA famil 100.0
PRK10965 523 multicopper oxidase; Provisional 99.97
PRK10883 471 FtsI repressor; Provisional 99.96
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 99.96
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 99.94
COG2132 451 SufI Putative multicopper oxidases [Secondary meta 99.89
PF00394159 Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 99.74
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 99.61
TIGR01480587 copper_res_A copper-resistance protein, CopA famil 99.16
PF07731138 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 98.38
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 97.77
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 97.67
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 96.97
PRK02710119 plastocyanin; Provisional 96.77
PLN02835539 oxidoreductase 96.66
TIGR03389539 laccase laccase, plant. Members of this protein fa 96.61
PRK02888635 nitrous-oxide reductase; Validated 96.01
PRK10965523 multicopper oxidase; Provisional 95.86
COG2132451 SufI Putative multicopper oxidases [Secondary meta 95.83
TIGR03388541 ascorbase L-ascorbate oxidase, plant type. Members 95.83
PLN02604566 oxidoreductase 95.79
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 95.77
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 95.71
TIGR03390538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 95.67
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 95.6
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 95.39
PLN02191574 L-ascorbate oxidase 95.19
TIGR0265783 amicyanin amicyanin. Members of this family are am 95.15
PRK10883471 FtsI repressor; Provisional 95.12
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 95.05
PLN00044596 multi-copper oxidase-related protein; Provisional 94.21
COG3794128 PetE Plastocyanin [Energy production and conversio 94.17
KOG1263|consensus563 94.11
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 93.59
PLN02168545 copper ion binding / pectinesterase 92.92
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 92.74
PLN02792536 oxidoreductase 92.17
PLN02354552 copper ion binding / oxidoreductase 91.28
PLN02991543 oxidoreductase 90.23
COG4454158 Uncharacterized copper-binding protein [Inorganic 88.49
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 82.18
COG1622247 CyoA Heme/copper-type cytochrome/quinol oxidases, 81.96
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 80.12
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.4e-48  Score=363.17  Aligned_cols=204  Identities=23%  Similarity=0.300  Sum_probs=159.4

Q ss_pred             CCCeEEEeCCcccCCCCCCCCCCCcccCccCCCCeeEEEEeC-CCCeeeeeecccchhhhcCceeEEEEeccCCCCCCCC
Q psy7532           3 GKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPA-VPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAP   81 (235)
Q Consensus         3 ~~~tsiHwHG~~~~~~~~~DGv~~vtq~~I~PG~~~tY~f~~-~~~GT~wYHsH~~~q~~~Gl~G~iIV~~~~~~~p~~~   81 (235)
                      +++|||||||++|++++|+|||++ |||||+||++|+|+|++ +|+||||||||++.|+++||+|+|||++++...   .
T Consensus        79 ~~~ttIHWHGl~q~~t~w~DGv~~-TQcPI~PG~sftY~F~~~dq~GT~WYHsH~~~Q~~~Gl~GalII~~~~~~~---~  154 (596)
T PLN00044         79 DEPLLLTWHGVQQRKSAWQDGVGG-TNCAIPAGWNWTYQFQVKDQVGSFFYAPSTALHRAAGGYGAITINNRDVIP---I  154 (596)
T ss_pred             CCCccEEECCccCCCCccccCCCC-CcCCcCCCCcEEEEEEeCCCCceeEeeccchhhhhCcCeeEEEEcCccccc---c
Confidence            689999999999999999999987 99999999999999999 599999999999999999999999999875432   2


Q ss_pred             CCCC-CCCCceEEeeeccccCCCcccccccc-CCCCCCCCEEEEeceecCC--CccCcceeeceeEEEEeCCcEEEE---
Q psy7532          82 LWDY-DLPSHVIIITDWLHDMTDEKYPGFLR-TNTGNFPETYLINGKNNYV--YVSNNYIYVSINYIYVSNNYIYSL---  154 (235)
Q Consensus        82 ~yd~-d~~e~~l~l~Dw~~~~~~~~~~~~~~-~~~~~~pd~~lING~~~~~--~~~~~~~~~~~~~i~v~~GkryRl---  154 (235)
                      +|+. |++|.+|+|+||++.+..+. ...+. +.....||++||||++.+.  |... ......+.++|++||+|||   
T Consensus       155 P~~~~~~~e~~i~l~DW~~~~~~~~-~~~l~~g~~~~~~d~~lING~g~~~~n~~~~-~~~~~~~~i~V~~Gk~yRlRiI  232 (596)
T PLN00044        155 PFGFPDGGDITLFIADWYARDHRAL-RRALDAGDLLGAPDGVLINAFGPYQYNDSLV-PPGITYERINVDPGKTYRFRVH  232 (596)
T ss_pred             cccCCcccceEEEecccccCCHHHH-HHHHhcCCCCCCCCceEEcccCccccCCccc-cCCCccceEEECCCCEEEEEEE
Confidence            3443 22589999999999875542 22222 2334678999999998753  3210 0123446899999999999   


Q ss_pred             eccC--CCceeeecCCcEE-----------------------EEe-ec-cCccc-CeEEeccCCCCCC-CCCCcceEEEE
Q psy7532         155 NAGD--ASDCADSNSDLVC-----------------------MSH-VN-AQNIR-NYRIPTEPNGTSL-NAPYTQFNAFL  205 (235)
Q Consensus       155 Nag~--~~~f~i~~h~~~~-----------------------~~~-~~-~q~~~-~Y~i~~~~~~~~~-~~~~~~~~Ail  205 (235)
                      |++.  ..+|.|+.|.|++                       ||+ ++ +|+.+ +||||+.+..+.. .+.+..+.|||
T Consensus       233 Naa~~~~~~fsIdgH~mtVIa~DG~~v~P~~vd~i~I~~GQRydVLV~a~q~~~~~Y~i~a~~~~~~~~~~~~~~~~AIl  312 (596)
T PLN00044        233 NVGVATSLNFRIQGHNLLLVEAEGSYTSQQNYTNLDIHVGQSYSFLLTMDQNASTDYYVVASARFVDAAVVDKLTGVAIL  312 (596)
T ss_pred             EccCCceEEEEECCCEEEEEEeCCcccCceeeeeEEEcCCceEEEEEECCCCCCCceEEEEecccccCccccCcceeEEE
Confidence            9987  5678888888888                       577 55 78764 8999998753221 24555668999


Q ss_pred             ecCCCCc
Q psy7532         206 LYKLEFC  212 (235)
Q Consensus       206 ~Y~g~~~  212 (235)
                      +|+|+..
T Consensus       313 ~Y~~~~~  319 (596)
T PLN00044        313 HYSNSQG  319 (596)
T ss_pred             EECCCCC
Confidence            9999765

>PLN02991 oxidoreductase Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>COG1622 CyoA Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion] Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
1v10_A 521 Structure Of Rigidoporus Lignosus Laccase From Hemi 5e-19
3kw7_A 502 Crystal Structure Of Lacb From Trametes Sp. Ah28-2 5e-19
2hzh_A 499 Crystal Structure Of Laccase From Coriolus Zonatus 1e-18
2qt6_A 498 Crystal Structure Determination Of A Blue Laccase F 2e-18
1kya_A 499 Active Laccase From Trametes Versicolor Complexed W 2e-18
1gyc_A 499 Crystal Structure Determination At Room Temperature 3e-18
2xyb_A 497 Crystal Structure Of A Fully Functional Laccase Fro 4e-18
4a2f_A 497 Coriolopsis Gallica Laccase Collected At 12.65 Kev 2e-17
4a2d_A 496 Coriolopsis Gallica Laccase T2 Copper Depleted At P 2e-17
3pxl_A 499 Type-2 Cu-Depleted Fungus Laccase From Trametes Hir 2e-17
3fpx_A 499 Native Fungus Laccase From Trametes Hirsuta Length 2e-17
2h5u_A 499 Crystal Structure Of Laccase From Cerrena Maxima At 3e-17
3t6v_A 495 Crystal Structure Of Laccase From Steccherinum Ochr 3e-17
2hrg_A 496 Crystal Structure Of Blue Laccase From Trametes Tro 3e-17
3div_A 499 Crystal Structure Of Laccase From Cerrena Maxima At 6e-17
1a65_A 504 Type-2 Cu-depleted Laccase From Coprinus Cinereus L 9e-17
1hfu_A 503 Type-2 Cu-Depleted Laccase From Coprinus Cinereus A 9e-17
1aoz_A 552 Refined Crystal Structure Of Ascorbate Oxidase At 1 1e-14
3sqr_A 580 Crystal Structure Of Laccase From Botrytis Aclada A 9e-14
3v9e_A 580 Structure Of The L513m Mutant Of The Laccase From B 9e-14
1zpu_A 534 Crystal Structure Of Fet3p, A Multicopper Oxidase T 6e-13
1gw0_A 559 Crystal Structure Of Laccase From Melanocarpus Albo 2e-11
3dkh_A 559 L559a Mutant Of Melanocarpus Albomyces Laccase Leng 2e-11
2q9o_A 559 Near-Atomic Resolution Structure Of A Melanocarpus 4e-11
3g5w_A318 Crystal Structure Of Blue Copper Oxidase From Nitro 1e-10
3pps_A 604 Crystal Structure Of An Ascomycete Fungal Laccase F 5e-10
>pdb|1V10|A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals Length = 521 Back     alignment and structure 
Iteration: 1

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 62/103 (60%), Gaps = 5/103 (4%)
Query: 2   MGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPD--GTFFYHSHIALQ 59
           M +  ++HWHG +Q  T  MDG  FV QCPI+ N  F Y F  VP   GT++YHSH++ Q
Sbjct: 78  MRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDF-VVPGQAGTYWYHSHLSTQ 136
Query: 60  KMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMT 102
             DG+ G+F++ +P   D    L+D D  S VI I DW H ++
Sbjct: 137 YCDGLRGAFVVYDPN--DPHLSLYDVDDASTVITIADWYHSLS 177
>pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 Back     alignment and structure
>pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 Back     alignment and structure
>pdb|2QT6|A Chain A, Crystal Structure Determination Of A Blue Laccase From Lentinus Tigrinus Length = 498 Back     alignment and structure
>pdb|1KYA|A Chain A, Active Laccase From Trametes Versicolor Complexed With 2,5-Xylidine Length = 499 Back     alignment and structure
>pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 Back     alignment and structure
>pdb|2XYB|A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus Length = 497 Back     alignment and structure
>pdb|4A2F|A Chain A, Coriolopsis Gallica Laccase Collected At 12.65 Kev Length = 497 Back     alignment and structure
>pdb|4A2D|A Chain A, Coriolopsis Gallica Laccase T2 Copper Depleted At Ph 4.5 Length = 496 Back     alignment and structure
>pdb|3PXL|A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|3FPX|A Chain A, Native Fungus Laccase From Trametes Hirsuta Length = 499 Back     alignment and structure
>pdb|2H5U|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.9a Resolution Length = 499 Back     alignment and structure
>pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 Back     alignment and structure
>pdb|2HRG|A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate Length = 496 Back     alignment and structure
>pdb|3DIV|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.76a Resolution Length = 499 Back     alignment and structure
>pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 Back     alignment and structure
>pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 Back     alignment and structure
>pdb|1AOZ|A Chain A, Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution Length = 552 Back     alignment and structure
>pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 Back     alignment and structure
>pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 Back     alignment and structure
>pdb|1ZPU|A Chain A, Crystal Structure Of Fet3p, A Multicopper Oxidase That Functions In Iron Import Length = 534 Back     alignment and structure
>pdb|1GW0|A Chain A, Crystal Structure Of Laccase From Melanocarpus Albomyces In Four Copper Form Length = 559 Back     alignment and structure
>pdb|3DKH|A Chain A, L559a Mutant Of Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|2Q9O|A Chain A, Near-Atomic Resolution Structure Of A Melanocarpus Albomyces Laccase Length = 559 Back     alignment and structure
>pdb|3G5W|A Chain A, Crystal Structure Of Blue Copper Oxidase From Nitrosomonas Europaea Length = 318 Back     alignment and structure
>pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 2e-41
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 2e-41
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 1e-40
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 2e-39
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 2e-39
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 3e-39
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 1e-38
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 7e-38
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 4e-36
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 5e-34
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 1e-23
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 1e-21
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 1e-19
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 2e-19
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 2e-18
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 8e-17
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 4e-15
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 4e-15
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 5e-14
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 3e-13
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 1e-12
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 2e-12
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 3e-11
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 5e-11
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 9e-11
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-10
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 5e-09
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-07
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 2e-10
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 1e-09
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 1e-07
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 1e-07
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 7e-06
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 1e-04
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 Back     alignment and structure
 Score =  146 bits (371), Expect = 2e-41
 Identities = 46/132 (34%), Positives = 68/132 (51%), Gaps = 10/132 (7%)

Query: 2   MGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPD--GTFFYHSHIALQ 59
           M    ++HWHG +Q+ T + DG  F+TQCPI+    F Y F  VP   GT++YHSH+  Q
Sbjct: 58  MLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSFSYNFN-VPGMAGTYWYHSHLTTQ 116

Query: 60  KMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPE 119
             DG+ G F++ +P   D  A L+D D  + +I + DW H +  E   G          +
Sbjct: 117 YCDGLRGPFVVYDPN--DPDANLYDVDDDTTIITLADWYHVLAKEMGAGGA-----ITAD 169

Query: 120 TYLINGKNNYVY 131
           + LI+G      
Sbjct: 170 STLIDGLGRTHV 181
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Length = 488 Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Length = 336 Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Length = 340 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Length = 647 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Length = 333 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 100.0
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 100.0
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 100.0
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 100.0
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 100.0
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 100.0
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 100.0
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 100.0
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 100.0
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 100.0
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 100.0
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 100.0
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 100.0
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 100.0
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 100.0
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 100.0
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 99.97
3gyr_A 612 PHS, phenoxazinone synthase; metalloprotein, lacca 99.97
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.97
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 99.97
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.97
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.97
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 99.96
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 99.96
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 99.96
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 99.96
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 99.96
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.96
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 99.96
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 99.96
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 99.95
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 99.95
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.94
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 99.94
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.93
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 99.89
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.84
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 99.75
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 99.42
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 99.14
2cal_A154 Rusticyanin; iron respiratory electron transport c 98.97
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 98.75
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 98.75
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.59
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 98.55
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.39
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 98.33
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.3
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.3
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 98.28
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 98.26
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 98.18
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.15
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.14
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.12
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.1
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.06
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.06
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.05
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 98.03
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 98.03
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.02
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.0
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 97.97
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 97.96
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 97.92
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 97.91
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 97.91
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 97.88
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 97.85
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 97.85
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 97.78
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 97.77
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.71
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 97.68
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 97.66
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.63
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 97.62
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 97.61
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 97.59
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 97.53
1aoz_A552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 97.52
3c75_A132 Amicyanin; copper proteins, electron transfer comp 97.52
3gyr_A612 PHS, phenoxazinone synthase; metalloprotein, lacca 97.51
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 97.51
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 97.44
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 97.4
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.33
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.33
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 97.25
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 97.24
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.18
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 97.16
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 97.07
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.07
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 97.05
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 96.86
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 96.66
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 96.64
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 96.64
2zoo_A442 Probable nitrite reductase; electron transfer, ele 96.55
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 96.35
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 93.52
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 92.52
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 86.26
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
Probab=100.00  E-value=2e-48  Score=365.96  Aligned_cols=202  Identities=30%  Similarity=0.368  Sum_probs=165.7

Q ss_pred             CCCCeEEEeCCcccCCCCCCCCCCCcccCccCCCCeeEEEEeCCCCeeeeeecccchhhhcCceeEEEEeccCCCCCCCC
Q psy7532           2 MGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAP   81 (235)
Q Consensus         2 ~~~~tsiHwHG~~~~~~~~~DGv~~vtq~~I~PG~~~tY~f~~~~~GT~wYHsH~~~q~~~Gl~G~iIV~~~~~~~p~~~   81 (235)
                      .+++|||||||+.|++++||||+|++|||||+||++|+|+|+++|+||||||||.+.|+++||+|+|||++++..     
T Consensus       117 ~~~~tsIHwHGl~~~~t~~~DGvp~vTq~pI~PG~sftY~f~~~q~GT~WYHsH~~~q~~~GL~G~lIV~~p~~~-----  191 (580)
T 3sqr_A          117 EHNGTSIHWHGIRQLGSLEYDGVPGVTQCPIAPGDTLTYKFQVTQYGTTWYHSHFSLQYGDGLFGPLIINGPATA-----  191 (580)
T ss_dssp             SSCCBCEEETTCCCTTCGGGSCCBTTTBCCBCTTCEEEEEEECCCCEEEEEEECSTTGGGGTCEEEEEEECCCSS-----
T ss_pred             CCCcceEEecccccCCCccccCCCccccCCCCCCCeEEEEEECCCCcceEEeecccccccCcCEEEEEeeCcccC-----
Confidence            358999999999999889999999999999999999999999999999999999999999999999999987532     


Q ss_pred             CCCCCCCCceEEeeeccccCCCccccccccCCCCCCCCEEEEeceecCCCcc----CcceeeceeEEEEeCCcEEEE---
Q psy7532          82 LWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKNNYVYVS----NNYIYVSINYIYVSNNYIYSL---  154 (235)
Q Consensus        82 ~yd~d~~e~~l~l~Dw~~~~~~~~~~~~~~~~~~~~pd~~lING~~~~~~~~----~~~~~~~~~~i~v~~GkryRl---  154 (235)
                      .||.|  ..+|+|+||++....+++..... ...+.+|++||||++.++|+.    +|......+.++|++||||||   
T Consensus       192 ~yD~d--~~~l~l~Dw~~~~~~~~~~~~~~-~~~~~~d~~liNG~~~~~c~~~~~~~~~~~~~~~~~~v~~G~~yRlRlI  268 (580)
T 3sqr_A          192 DYDED--VGVIFLQDWAHESVFEIWDTARL-GAPPALENTLMNGTNTFDCSASTDPNCVGGGKKFELTFVEGTKYRLRLI  268 (580)
T ss_dssp             CCSEE--EEEEEEEEECSSCHHHHHHHHTT-SCCCCBSEEEETTBCCCCCTTCCCTTBCCCCCCCEEECCTTCEEEEEEE
T ss_pred             CCCcc--ceEEEEEEEecCCHHHHHHHHhc-cCCCCCceEEECCcccCCCccccccccccCCCceeEEEcCCCEEEEEEE
Confidence            36554  23999999999987654333222 346789999999999998853    355566778999999999998   


Q ss_pred             eccCC--CceeeecCCcEE-----------------------EEe-ec-cCcccCeEEeccCCC-CCCCCCCcceEEEEe
Q psy7532         155 NAGDA--SDCADSNSDLVC-----------------------MSH-VN-AQNIRNYRIPTEPNG-TSLNAPYTQFNAFLL  206 (235)
Q Consensus       155 Nag~~--~~f~i~~h~~~~-----------------------~~~-~~-~q~~~~Y~i~~~~~~-~~~~~~~~~~~Ail~  206 (235)
                      |+|..  ..|.|+.|.|++                       ||+ ++ +|+.++|||++.+.. |..........|||+
T Consensus       269 Na~~~~~~~~~i~gh~~~VIa~DG~~v~P~~~~~l~i~pGqRydVlv~a~~~~g~Y~i~a~~~~~~~~~~~~~~~~aiL~  348 (580)
T 3sqr_A          269 NVGIDSHFEFAIDNHTLTVIANDLVPIVPYTTDTLLIGIGQRYDVIVEANAAADNYWIRGNWGTTCSTNNEAANATGILR  348 (580)
T ss_dssp             ECCSSCCEEEEETTCCEEEEEETTEEEEEEEESSEEECTTCEEEEEEECCSCSSEEEEECCCCTTTSCBTTGGGCEEEEE
T ss_pred             eccCCceeeEEeCCceEEEEEeCCccCCceEeeEEEEccceEEEEEEEeCCCCCeEEEEEecccccCccCCCCceEEEEE
Confidence            99973  466777777776                       577 55 788999999999975 433334446789999


Q ss_pred             cCCCC
Q psy7532         207 YKLEF  211 (235)
Q Consensus       207 Y~g~~  211 (235)
                      |.++.
T Consensus       349 Y~~~~  353 (580)
T 3sqr_A          349 YDSSS  353 (580)
T ss_dssp             SSTTC
T ss_pred             ECCCC
Confidence            98865
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 235
d1hfua1131 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprin 1e-18
d1gyca1130 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, la 4e-18
d1v10a1136 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [T 7e-17
d1aoza1129 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cuc 1e-14
d1gska1181 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Baci 2e-10
d1oe2a1159 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcalige 1e-09
d2j5wa1192 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapie 3e-09
d1kbva1151 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisser 6e-09
d2q9oa1162 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces 7e-09
d2j5wa3207 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sap 1e-08
d1sdda1180 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos t 3e-08
d1sddb2139 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B 9e-08
d1e30a_153 b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan 1e-07
d2j5wa5149 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa 1e-07
d2j5wa2145 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap 1e-07
d1kcwa2146 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap 5e-07
d2q9oa2181 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyce 8e-07
d1mzya1153 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodoba 2e-06
d1kv7a1140 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Esch 2e-06
d1v10a2168 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus 2e-06
d1sdda2116 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos 2e-05
d1gyca2170 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, 2e-05
d1hfua2172 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Copr 4e-05
d2j5wa4179 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sap 5e-05
d1sddb167 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (B 2e-04
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 131 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Laccase
species: Inky cap fungus (Coprinus cinereus) [TaxId: 5346]

 Score = 76.6 bits (188), Expect = 1e-18
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 1   MMGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAV-PDGTFFYHSHIALQ 59
            M +  ++HWHGL+QR T + DG   V QCPI     F YKF      GTF+YHSH   Q
Sbjct: 56  TMLRPTSIHWHGLFQRGTNWADGADGVNQCPISPGHAFLYKFTPAGHAGTFWYHSHFGTQ 115

Query: 60  KMDGIEGSFIIREP 73
             DG+ G  +I + 
Sbjct: 116 YCDGLRGPMVIYDD 129
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 130 Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 136 Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 129 Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 181 Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 159 Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 162 Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 180 Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 181 Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Length = 153 Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 140 Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 168 Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 170 Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 172 Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 179 Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 67 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.95
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.95
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.94
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.93
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.89
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.89
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.88
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.86
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.85
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 99.85
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.8
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.8
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.79
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.78
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.75
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 99.74
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.72
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.59
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 99.57
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.48
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.4
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.35
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.15
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 99.0
d1gska2174 Spore coat protein A, CotA {Bacillus subtilis [Tax 98.9
d1kv7a2165 multi-copper oxidase CueO {Escherichia coli [TaxId 98.86
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 98.82
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.56
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 98.33
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 98.31
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 98.28
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 98.1
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.1
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 98.08
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 98.0
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 97.99
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 97.93
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 97.88
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 97.87
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 97.84
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.8
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 97.74
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 97.63
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 97.61
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 97.55
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 97.54
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.48
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 97.46
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 97.46
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 97.36
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 97.28
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 97.22
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 97.2
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 97.18
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 97.16
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 97.12
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 97.06
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 97.01
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 97.01
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 96.8
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 96.74
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 96.59
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 96.57
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 96.44
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 96.37
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 96.09
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 96.05
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 95.99
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 94.81
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 93.28
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 90.68
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 89.94
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 89.77
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 88.57
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 88.55
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 87.14
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 86.88
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 85.17
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 84.72
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 84.02
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 82.28
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 82.24
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 81.1
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Laccase
species: Rigidoporus lignosus [TaxId: 219653]

Probab=99.95  E-value=8.8e-29  Score=190.07  Aligned_cols=72  Identities=43%  Similarity=0.933  Sum_probs=68.4

Q ss_pred             CCCeEEEeCCcccCCCCCCCCCCCcccCccCCCCeeEEEEeCC-CCeeeeeecccchhhhcCceeEEEEeccC
Q psy7532           3 GKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAV-PDGTFFYHSHIALQKMDGIEGSFIIREPR   74 (235)
Q Consensus         3 ~~~tsiHwHG~~~~~~~~~DGv~~vtq~~I~PG~~~tY~f~~~-~~GT~wYHsH~~~q~~~Gl~G~iIV~~~~   74 (235)
                      .++|||||||+++++++++||+++++||+|+||++|+|+|++. ++||||||||+..|+.+||+|+|||++++
T Consensus        58 ~~~tsiH~HGl~~~~~~~~dgv~~~t~~~I~PG~~~~Y~~~~~~~~Gt~wYH~H~~~q~~~GL~G~liV~~~~  130 (136)
T d1v10a1          58 RRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQAGTYWYHSHLSTQYCDGLRGAFVVYDPN  130 (136)
T ss_dssp             CCCBCEEEETCCCTTCGGGSCCBTTTBCCBCTTEEEEEEEECTTCCEEEEEEECSTTGGGGTCEEEEEEECTT
T ss_pred             CcceeEEecccccccccccCCCCccccceECCCCeEEEEEECCCCccceEEecCchhHHhCCCEEEEEECCCc
Confidence            4799999999999999999999999999999999999999995 69999999999999999999999999873
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure