Psyllid ID: psy754

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610

MNITSLSINVNEFDYAVKSYIEDGIFEQLEYKSSNKDQDLLLEYDFIIVGAGPGGCTVANRLSEIPHWKILLLEAGHYFNYLVDIPVLNTNLILSPLNWGYKTEKEDCRACLGLKGQRCPWPSGKGVGGTSLINTMLYTRGNKRNYDDWAKLGNYGWSYNEVLPYFKKAERIQISELQNSSYHGTQGFIGVDYTEYNTPMLDAFLQAGMEAGYPLVDYNGKTQTGFARAQATLHKRSRRSSAKDYIDPIKKRCNLTVKDSSFVKKILIDPVTKKACGVLATIKGIDHKILARKEVILSAGAFNSPKLLMLSGIGPQEHLNDLNIPVIKNLRVGENLQEHLAMAGLTFLVNQPIGLLQDRLIKEMPKLFPQWYFEGKGKLTMLGCEGLAYVNTKYNVFPDDLPDIEFIFTAVSLASDGGVSLRQEMGITDHLYNSVYSSVDRKDSWSIWPMILYPRSRGKVLLKDSHPLTPPLIHANFFNDTRDLDVIVEGIKMAIELSKTKAFQSIGSTLHKAPIPGCSQYTFGSDAYWGCSVRHITTQLHHQCGTCKMGPRWDSSAVVDPQLKVYGVDNLRVVDASIIPVIPGGHTVAVVYMIAEKASDMIKKTWLPNQ

ccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEcccHHHHHHHHHcccccccEEEEEcccccccccccccHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHccccccccccccHHHHHHccccccccccccccccccccEEcccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHcccccccccEEEcccEEEEEEEEccccEEEEEEEEEccEEEEEEEccEEEEcccccccHHHHHHcccccHHHHHHcccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccccccEEEEEEcccccccccccHHHcccccccccccccccccccccEEEEEEcccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEccccccccccccHHHHHHHHHHHHHHHHccccccc

ccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHcccEEEEEEcccHHHHHHHHHHHccccccEEEEccccccccEEccHHHHHHHcccccccEEEcccccccEEHcccccccccccccEEcccHHHHHEHHEcccHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHcccccccccccEEEcccccccHHHHHHHHHHHHccccccccccccccccccccEEEccccEccHHHHHHcHHHcccccEEEEEEEEEEEEEcccccEEEEEEEEEccEEEEEEEEEEEEEccccccHHHHHHHHcEccHHHHHHHcccccEcccccEEEEcHHHEcEEEEEEcccEEEccccccccHHHHHHHHHHcccccccccccEEEEEEEccccccccccccEEEEEEcccccccccHHHHHHccccHHHHHHHHcHccccccEEEEEccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHcccEccccEEcccEcEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHcc

mnitslsinvNEFDYAVKSYIEDGIFeqleykssnkdqdllLEYDFIivgagpggctvanrlseiphWKILLLEAGHYfnylvdipvlntnlilsplnwgyktekedcraclglkgqrcpwpsgkgvggtsLINTMLYtrgnkrnyddwaklgnygwsynevlpyfkKAERIQISelqnssyhgtqgfigvdyteyntpMLDAFLQAGMeagyplvdyngktqtgFARAQATLHKrsrrssakdyidpikkrcnltvkdssFVKKilidpvtkkaCGVLATIKGIDHKILARKEVILsagafnspkllmlsgigpqehlndlnipviknlrvGENLQEHLAMAGLTFLVNQPIGLLQDRLIKEmpklfpqwyfegkgkltmlgcEGLAYVNtkynvfpddlpdIEFIFTAVSLAsdggvslrqemgitdhlynsvyssvdrkdswsiwpmilyprsrgkvllkdshpltpplihanffndtrdLDVIVEGIKMAIELSKTKAFQSIgstlhkapipgcsqytfgsdaywgcsvrHITTQLhhqcgtckmgprwdssavvdpqlkvygvdnlrvvdasiipvipggHTVAVVYMIAEKASDMIKKTWLPNQ

mnitslsinvneFDYAVKSYIEDGIFEQLEYKSSNKDQDLLLEYDFIIVGAGPGGCTVANRLSEIPHWKILLLEAGHYFNYLVDIPVLNTNLILSPLNWGYKTEKEDCRACLGlkgqrcpwpsgkgvggtsLINTMLYTRGNKRNYDDWAKLGNYGWSYNEVLPYFKKAERIQISELQNSSYHGTQGFIGVDYTEYNTPMLDAFLQAGMEAGYPLVDYNGKTQTGFARAqatlhkrsrrssakdyidpikkrcnltvkdssfvkkilidpvtkkacGVLATIKGIDHKILARKEVILSAGAFNSPKLLMLSGIGPQEHLNDLNIPVIKNLRVGENLQEHLAMAGLTFLVNQPIGLLQDRLIKEMPKLFPQWYFEGKGKLTMLGCEGLAYVNTKYNVFPDDLPDIEFIFTAVSLASDGGVSLRQEMGITDHLYNSVYSsvdrkdswsiWPMILYPRSRGKVLLKDSHPLTpplihanffndtRDLDVIVEGIKMAIELSKTKAFQSIGSTLHKAPIPGCSQYTFGSDAYWGCSVRHITTQLHHQCGTCKMGPRWDSSAVVDPQLKVYGVDNLRVVDASiipvipggHTVAVVYMIAEKAsdmikktwlpnq

*****LSINVNEFDYAVKSYIEDGIFEQLEYKSSNKDQDLLLEYDFIIVGAGPGGCTVANRLSEIPHWKILLLEAGHYFNYLVDIPVLNTNLILSPLNWGYKTEKEDCRACLGLKGQRCPWPSGKGVGGTSLINTMLYTRGNKRNYDDWAKLGNYGWSYNEVLPYFKKAERIQISELQNSSYHGTQGFIGVDYTEYNTPMLDAFLQAGMEAGYPLVDYNGKTQTGFAR***************DYIDPIKKRCNLTVKDSSFVKKILIDPVTKKACGVLATIKGIDHKILARKEVILSAGAFNSPKLLMLSGIGPQEHLNDLNIPVIKNLRVGENLQEHLAMAGLTFLVNQPIGLLQDRLIKEMPKLFPQWYFEGKGKLTMLGCEGLAYVNTKYNVFPDDLPDIEFIFTAVSLASDGGVSLRQEMGITDHLYNSVYSSVDRKDSWSIWPMILYPRSRGKVLLKDSHPLTPPLIHANFFNDTRDLDVIVEGIKMAIELSKTKAFQSIGSTLHKAPIPGCSQYTFGSDAYWGCSVRHITTQLHHQCGTCKMGPRWDSSAVVDPQLKVYGVDNLRVVDASIIPVIPGGHTVAVVYMIAEKASDMIKKTW****

****SLSINVNEFDYAVKSYIEDGI*****************EYDFIIVGAGPGGCTVANRLSEIPHWKILLLEAGHYFNYLVDIPVLNTNLILSPLNWGYKTEKEDCRACLGLKGQRCPWPSGKGVGGTSLINTMLYTRGNKRNYDDWAKLGNYGWSYNEVLPYFKKAERIQISELQNSSYHGTQGFIGVDYTEYNTPMLDAFLQAGMEAGYPLVDYNGKTQTGFARAQATLHKRSRRSSAKDYIDPIKKRCNLTVKDSSFVKKILIDPVTKKACGVLATIKGIDHKILARKEVILSAGAFNSPKLLMLSGIGPQEHLNDLNIPVIKNLRVGENLQEHLAMAGLTFLVNQPIGLLQDRLIKEMPKLFPQWYFEGKGKLTMLGCEGLAYVNTKYNVFPDDLPDIEFIFTAVSLASDGGVSLRQEMGITDHLYNSVYSSVDRKDSWSIWPMILYPRSRGKVLLKDSHPLTPPLIHANFFNDTRDLDVIVEGIKMAIELSKTKAFQSIGSTLHKAPIPGCSQYTFGSDAYWGCSVRHITTQLHHQCGTCKMGPRWDSSAVVDPQLKVYGVDNLRVVDASIIPVIPGGHTVAVVYMIAEKASDMIKKTWL***

MNITSLSINVNEFDYAVKSYIEDGIFEQLEYKSSNKDQDLLLEYDFIIVGAGPGGCTVANRLSEIPHWKILLLEAGHYFNYLVDIPVLNTNLILSPLNWGYKTEKEDCRACLGLKGQRCPWPSGKGVGGTSLINTMLYTRGNKRNYDDWAKLGNYGWSYNEVLPYFKKAERIQISELQNSSYHGTQGFIGVDYTEYNTPMLDAFLQAGMEAGYPLVDYNGKTQTGFA****************DYIDPIKKRCNLTVKDSSFVKKILIDPVTKKACGVLATIKGIDHKILARKEVILSAGAFNSPKLLMLSGIGPQEHLNDLNIPVIKNLRVGENLQEHLAMAGLTFLVNQPIGLLQDRLIKEMPKLFPQWYFEGKGKLTMLGCEGLAYVNTKYNVFPDDLPDIEFIFTAVSLASDGGVSLRQEMGITDHLYNSVYSSVDRKDSWSIWPMILYPRSRGKVLLKDSHPLTPPLIHANFFNDTRDLDVIVEGIKMAIELSKTKAFQSIGSTLHKAPIPGCSQYTFGSDAYWGCSVRHITTQLHHQCGTCKMGPRWDSSAVVDPQLKVYGVDNLRVVDASIIPVIPGGHTVAVVYMIAEKASDMIKKTWLPNQ

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		610	2.2.26 [Sep-21-2011]
P18172		625	Glucose dehydrogenase [ac	no	N/A	0.886	0.865	0.411	1e-111
P18173		625	Glucose dehydrogenase [ac	no	N/A	0.885	0.864	0.411	1e-110
Q6UPE0		599	Choline dehydrogenase, mi	yes	N/A	0.850	0.866	0.358	5e-79
Q8NE62		594	Choline dehydrogenase, mi	yes	N/A	0.850	0.873	0.361	3e-78
Q8BJ64		596	Choline dehydrogenase, mi	yes	N/A	0.850	0.870	0.353	9e-78
Q4K4K7		567	Choline dehydrogenase OS=	yes	N/A	0.850	0.915	0.361	4e-77
Q1QXE1		560	Choline dehydrogenase OS=	yes	N/A	0.854	0.930	0.346	1e-76
C3K3D3		567	Choline dehydrogenase OS=	no	N/A	0.849	0.913	0.358	2e-76
Q1IG70		565	Choline dehydrogenase OS=	yes	N/A	0.850	0.918	0.354	3e-76
Q88CW6		565	Choline dehydrogenase OS=	yes	N/A	0.850	0.918	0.356	5e-76

>sp\|P18172\|DHGL_DROPS Glucose dehydrogenase [acceptor] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4	Back alignment and function desciption

 Score =  404 bits (1037), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 234/568 (41%), Positives = 324/568 (57%), Gaps = 27/568 (4%)

Query: 43  EYDFIIVGAGPGGCTVANRLSEIPHWKILLLEAGHYFNYLVDIPVLNTNLILSPLNWGYK 102
           EYDFI++G G  G  VA+RLSE+P WK+LL+EAG        IP +  N I S +++ Y 
Sbjct: 64  EYDFIVIGGGSAGSVVASRLSEVPQWKVLLIEAGGDEPVGAQIPSMFLNFIGSDIDYRYN 123

Query: 103 TEKEDCRACLGLKGQRCPWPSGKGVGGTSLINTMLYTRGNKRNYDDWAKLGNYGWSYNEV 162
           TE E   ACL    QRC WP GK +GGTS++N M+Y RGN+ +YDDWA  GN GWSY +V
Sbjct: 124 TEPERM-ACLSSMEQRCYWPRGKVLGGTSVMNGMMYIRGNREDYDDWAAQGNPGWSYQDV 182

Query: 163 LPYFKKAERIQISELQNSSYHGTQGFIGVDYTEYNTPMLDAFLQAGMEAGYPLVDYNGKT 222
           LP+FKK+E     +   + YH   G + V    YN P+  A L+AG E G+ + D NG+ 
Sbjct: 183 LPFFKKSEDNLELDAVGTEYHAKGGLLPVGKFPYNPPLSYALLKAGEEMGFSVQDLNGQN 242

Query: 223 QTGFARAQATLHKRSRRSSAKDYIDPIKKRCNLTVKDSSFVKKILIDPVTKKACGVLATI 282
            TGF  AQ T     R SSA+ ++ P + R NL +  ++ V K+LI P TK   GV  + 
Sbjct: 243 STGFMIAQMTARNGIRYSSARAFLRPARMRNNLHILLNTTVTKVLIHPGTKNVVGVEVSD 302

Query: 283 K-GIDHKILARKEVILSAGAFNSPKLLMLSGIGPQEHLNDLNIPVIKNLR-VGENLQEHL 340
           + G   KIL +KEVI+S GA NSP++L+LSG+GP+E L  +N+  + +L  VG+NL  H+
Sbjct: 303 QFGSMRKILVKKEVIVSGGAVNSPQILLLSGVGPKEDLQKVNVRPVHHLPGVGKNLHNHV 362

Query: 341 AMAGLTFLVNQPIGLLQDRLIKEMPKLFPQWYFEGKGKLTMLGCEGLAYVNTKYNVFPDD 400
           A     F+ +     L      E   LF      G G       +  A + T++   P +
Sbjct: 363 AYFTNFFIDDADTAPLNWATAMEY-LLFRDGLMSGTGI-----SDVTAKMATRWADRP-N 415

Query: 401 LPDIEFIFTA--VSLASDGGVSLRQEMGITDHLYNSVYSSVDRKDSWSIWPMILYPRSRG 458
           LPD++  F     S A  G V               + S+  R  +  I+P +L P+SRG
Sbjct: 416 LPDLQLYFGGYLASCARTGQV-------------GELLSNNSR--AIQIFPAVLNPKSRG 460

Query: 459 KVLLKDSHPLTPPLIHANFFNDTRDLDVIVEGIKMAIELSKTKAFQSIGSTLHKAPIPGC 518
            + L+ + PL PP I AN+  D RD+  +VEGIK AI LS+T   +  G  L K  + GC
Sbjct: 461 YITLRSADPLDPPRIFANYLTDERDVKTLVEGIKFAIRLSQTSPLKQYGMRLDKTVVKGC 520

Query: 519 SQYTFGSDAYWGCSVRHITTQLHHQCGTCKMGPRWDSSAVVDPQLKVYGVDNLRVVDASI 578
             + F SDAYW C+VR  T   +HQ G+CKMGP  D  AVV+ +L+V+GV  LRV+D SI
Sbjct: 521 ESHAFASDAYWECAVRQNTGPENHQAGSCKMGPSHDPMAVVNHELRVHGVRGLRVMDTSI 580

Query: 579 IPVIPGGHTVAVVYMIAEKASDMIKKTW 606
           +P +  G+T A   MIAEK + ++K+ W
Sbjct: 581 MPKVTAGNTHAPAVMIAEKGAYLLKRAW 608

Drosophila pseudoobscura pseudoobscura (taxid: 46245)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0

>sp\|P18173\|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3	Back alignment and function description

>sp\|Q6UPE0\|CHDH_RAT Choline dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Chdh PE=1 SV=1	Back alignment and function description

>sp\|Q8NE62\|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens GN=CHDH PE=2 SV=2	Back alignment and function description

>sp\|Q8BJ64\|CHDH_MOUSE Choline dehydrogenase, mitochondrial OS=Mus musculus GN=Chdh PE=1 SV=1	Back alignment and function description

>sp\|Q4K4K7\|BETA_PSEF5 Choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|Q1QXE1\|BETA1_CHRSD Choline dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|C3K3D3\|BETA_PSEFS Choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|Q1IG70\|BETA_PSEE4 Choline dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|Q88CW6\|BETA_PSEPK Choline dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=betA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		610
332023084		634	Glucose dehydrogenase [Acromyrmex echina	0.949	0.913	0.488	1e-166
242018476		630	glucose dehydrogenase precursor, putativ	0.952	0.922	0.496	1e-165
307172021		630	Glucose dehydrogenase [acceptor] [Campon	0.949	0.919	0.489	1e-165
242018470		624	glucose dehydrogenase precursor, putativ	0.924	0.903	0.499	1e-165
322796401		624	hypothetical protein SINV_00375 [Solenop	0.947	0.926	0.480	1e-165
156551708		624	PREDICTED: glucose dehydrogenase [accept	0.947	0.926	0.492	1e-164
307206069		618	Glucose dehydrogenase [acceptor] [Harpeg	0.949	0.936	0.486	1e-164
345482592		609	PREDICTED: glucose dehydrogenase [accept	0.908	0.909	0.506	1e-164
193620141		623	PREDICTED: glucose dehydrogenase [accept	0.975	0.955	0.487	1e-163
340720647		626	PREDICTED: glucose dehydrogenase [accept	0.949	0.924	0.494	1e-163

>gi\|332023084\|gb\|EGI63349.1\| Glucose dehydrogenase [Acromyrmex echinatior]	Back alignment and taxonomy information

 Score =  590 bits (1521), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 285/584 (48%), Positives = 407/584 (69%), Gaps = 5/584 (0%)

Query: 26  FEQLEYKSSNKDQD-LLLEYDFIIVGAGPGGCTVANRLSEIPHWKILLLEAGHYFNYLVD 84
           ++QL+ +S   D+  L  +YDFI++G+G  G  +A+RLSEIP+W +LLLEAG   N + D
Sbjct: 38  YDQLDPESRLIDRHPLYSDYDFIVIGSGSAGAVIASRLSEIPNWNVLLLEAGPDENEITD 97

Query: 85  IPVLNTNLILSPLNWGYKTEKEDCRACLGLKGQRCPWPSGKGVGGTSLINTMLYTRGNKR 144
           +P L   L LS L+W YKTE    +ACL +KG RC WP GK +GG+S+ N MLY RGNK+
Sbjct: 98  VPSLAAYLQLSTLDWKYKTEATG-KACLAMKGGRCNWPRGKVIGGSSVFNYMLYVRGNKQ 156

Query: 145 NYDDWAKLGNYGWSYNEVLPYFKKAERIQISELQNSSYHGTQGFIGVDYTEYNTPMLDAF 204
           +YD W  LGN GW Y++VL YFKK+E  +   L+ S YH T G++ V  + + TP++ AF
Sbjct: 157 DYDHWESLGNPGWGYDQVLYYFKKSEDNRNPYLRRSPYHATDGYLTVQESPWKTPLVVAF 216

Query: 205 LQAGMEAGYPLVDYNGKTQTGFARAQATLHKRSRRSSAKDYIDPIKKRCNLTVKDSSFVK 264
           +QAG+E GY   D NG+ QTGF  +Q T+ + SR S+AK ++ PI+ R N+ +  +S V 
Sbjct: 217 VQAGVELGYENRDINGEKQTGFMISQGTIRRGSRCSTAKAFLRPIRLRKNIHIAMNSHVT 276

Query: 265 KILIDPVTKKACGVLATIKGIDHKILARKEVILSAGAFNSPKLLMLSGIGPQEHLNDLNI 324
           +I+IDP+T +A GV     G    I ARKEVILSAGA NSP++LMLSGIGP+EHL  + I
Sbjct: 277 RIVIDPLTMRAIGVEFVRNGRRQIIRARKEVILSAGAINSPQILMLSGIGPKEHLQHVGI 336

Query: 325 PVIKNLRVGENLQEHLAMAGLTFLVNQPIGLLQDRLIKEMPKLFPQWYFEGKGKLTML-G 383
           PVIK+L+VGENLQ+H+ M GLTFL+++ + ++QDR  + +P +   +   G+G +T L G
Sbjct: 337 PVIKDLQVGENLQDHVGMGGLTFLIDKSVAIVQDRF-QAIPMMM-HYVINGRGPMTTLGG 394

Query: 384 CEGLAYVNTKYNVFPDDLPDIEFIFTAVSLASDGGVSLRQEMGITDHLYNSVYSSVDRKD 443
            EG A+VNTKY     D PD++F     S+ SD G+ +R+ +G+TD +YN+VY  ++ +D
Sbjct: 395 VEGYAFVNTKYANHSIDYPDVQFHMAPASINSDAGIQVRKVLGLTDEVYNTVYRPINNRD 454

Query: 444 SWSIWPMILYPRSRGKVLLKDSHPLTPPLIHANFFNDTRDLDVIVEGIKMAIELSKTKAF 503
           +W+I P++L P+SRG + L+ S+P   P+I+AN+F+D  D+ ++VEG K+A+++S+ K F
Sbjct: 455 AWTIMPLLLRPKSRGTIRLRSSNPFHHPIINANYFSDPMDIAILVEGAKIALKVSEAKVF 514

Query: 504 QSIGSTLHKAPIPGCSQYTFGSDAYWGCSVRHITTQLHHQCGTCKMGPRWDSSAVVDPQL 563
           +  GS LH+  +PGC    FG+DAYW C +RHI+  ++H  GT KMGP  D +AVVDP+L
Sbjct: 515 KQFGSKLHRVKLPGCKHIKFGTDAYWECHIRHISMTIYHPVGTAKMGPPTDPTAVVDPRL 574

Query: 564 KVYGVDNLRVVDASIIPVIPGGHTVAVVYMIAEKASDMIKKTWL 607
           +VYGV  LRV+DASI+P I  G+T A V MI EK +D+IK+ WL
Sbjct: 575 RVYGVAGLRVIDASIMPTICSGNTNAPVIMIGEKGADLIKQDWL 618

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|242018476\|ref\|XP_002429701.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] gi\|212514704\|gb\|EEB16963.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|307172021\|gb\|EFN63615.1\| Glucose dehydrogenase [acceptor] [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|242018470\|ref\|XP_002429698.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] gi\|212514701\|gb\|EEB16960.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|322796401\|gb\|EFZ18935.1\| hypothetical protein SINV_00375 [Solenopsis invicta]	Back alignment and taxonomy information

>gi\|156551708\|ref\|XP_001600419.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|307206069\|gb\|EFN84162.1\| Glucose dehydrogenase [acceptor] [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|345482592\|ref\|XP_001607779.2\| PREDICTED: glucose dehydrogenase [acceptor]-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|193620141\|ref\|XP_001952665.1\| PREDICTED: glucose dehydrogenase [acceptor]-like isoform 1 [Acyrthosiphon pisum] gi\|328705616\|ref\|XP_003242858.1\| PREDICTED: glucose dehydrogenase [acceptor]-like isoform 2 [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|340720647\|ref\|XP_003398745.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus terrestris]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		610
FB\|FBgn0030590		703	CG9518 [Drosophila melanogaste	0.952	0.826	0.464	1.1e-142
FB\|FBgn0030598		626	CG9503 [Drosophila melanogaste	0.929	0.905	0.476	7e-141
FB\|FBgn0039415		616	CG6142 [Drosophila melanogaste	0.921	0.912	0.467	6.3e-140
FB\|FBgn0030591		865	CG9517 [Drosophila melanogaste	0.919	0.648	0.451	9.8e-135
FB\|FBgn0030592		726	CG9514 [Drosophila melanogaste	0.975	0.819	0.441	1.2e-134
FB\|FBgn0030589		622	CG9519 [Drosophila melanogaste	0.931	0.913	0.445	9.9e-126
FB\|FBgn0030588		621	CG9521 [Drosophila melanogaste	0.932	0.916	0.429	1.7e-123
FB\|FBgn0030587		616	CG9522 [Drosophila melanogaste	0.916	0.907	0.430	1.8e-119
FB\|FBgn0030586		626	CG12539 [Drosophila melanogast	0.945	0.921	0.423	1.3e-116
FB\|FBgn0030596		633	CG12398 [Drosophila melanogast	0.954	0.919	0.394	8.4e-113

FB\|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1395 (496.1 bits), Expect = 1.1e-142, P = 1.1e-142
 Identities = 272/586 (46%), Positives = 391/586 (66%)

Query:    26 FEQLEYKSSNKDQ-DLLLEYDFIIVGAGPGGCTVANRLSEIPHWKILLLEAGHYFNYLVD 84
             ++ ++ +S   DQ +L  EYDFI+VG+G  G  VANRLSE+  WK+LL+EAG   N + D
Sbjct:    38 YDAVDPESRPLDQLNLYPEYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISD 97

Query:    85 IPVLNTNLILSPLNWGYKTEKEDCRACLGLKGQRCPWPSGKGVGGTSLINTMLYTRGNKR 144
             +P L   L LS L+W YKTE    +ACLG++  RC WP G+ +GG+S++N MLY RGN+ 
Sbjct:    98 VPSLAAYLQLSKLDWAYKTEPST-KACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRH 156

Query:   145 NYDDWAKLGNYGWSYNEVLPYFKKAERIQISELQNSSYHGTQGFIGVDYTEYNTPMLDAF 204
             +YD WA LGN GW Y+ VL YFKK+E  +   L N+ YHG  G + V  + +++P++ AF
Sbjct:   157 DYDHWASLGNPGWDYDNVLRYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAF 216

Query:   205 LQAGMEAGYPLVDYNGKTQTGFARAQATLHKRSRRSSAKDYIDPIKKRCNLTVKDSSFVK 264
             ++AG + GY   D NG  Q GF  AQ T+ + SR S+AK ++ PI+ R N  +  +S V 
Sbjct:   217 VEAGTQLGYDNRDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVT 276

Query:   265 KILIDPVTKKACGVLATIKGIDHKILARKEVILSAGAFNSPKLLMLSGIGPQEHLNDLNI 324
             +++I+P T +A  V     G  ++I AR+EVI+SAGA N+P+L+MLSG+GP++HL    I
Sbjct:   277 RVIIEPGTMRAQAVEFVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGI 336

Query:   325 PVIKNLRVGENLQEHLAMAGLTFLVNQPIGLLQDRLIKEMPKLFPQWYFEGKGKLTMLG- 383
              V+++L VGEN+Q+H+ M GLTFLV++P+ ++QDR        F Q+    +G +T LG 
Sbjct:   337 RVLQDLPVGENMQDHVGMGGLTFLVDKPVAIVQDRF-NPTAVTF-QYVLRERGPMTTLGG 394

Query:   384 CEGLAYVNTKYNVFPDDLPDIEFIFTAVSLASDGGVSLRQEMGITDHLYNSVYSSVDRKD 443
              EGLA+V+T Y+    D PDI+F     S+ SD G  +++ +G+ + +Y  VY  +  KD
Sbjct:   395 VEGLAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKD 454

Query:   444 SWSIWPMILYPRSRGKVLLKDSHPLTPPLIHANFFNDTRDLDVIVEGIKMAIELSKTKAF 503
             SW+I P++L PRSRG V L+ ++P   PLI+AN+F+D  D   +VEG K+A+ +++ + F
Sbjct:   455 SWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVF 514

Query:   504 QSIGSTLHKAPIPGCSQYTFGSDAYWGCSVRHITTQLHHQCGTCKMGPRWDSSAVVDPQL 563
             +  GS L + P+P C Q+ F SDAY  C VR I+  ++H CGT KMGP WD  AVVDP+L
Sbjct:   515 KQFGSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRL 574

Query:   564 KVYGVDNLRVVDASIIPVIPGGHTVAVVYMIAEKASDMIKKTWLPN 609
             +VYGV  LRV+DASI+P I  G+T A V MIAEK +D+IK+ WL N
Sbjct:   575 RVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDWLTN 620

GO:0008812 "choline dehydrogenase activity" evidence=ISS

GO:0006066 "alcohol metabolic process" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA

GO:0046331 "lateral inhibition" evidence=IMP

FB\|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030591 CG9517 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030592 CG9514 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030588 CG9521 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030587 CG9522 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030586 CG12539 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030596 CG12398 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
A5WA97	BETA_PSEP1	1, ., 1, ., 9, 9, ., 1	0.3525	0.8508	0.9185	yes	N/A
Q88CW6	BETA_PSEPK	1, ., 1, ., 9, 9, ., 1	0.3560	0.8508	0.9185	yes	N/A
B5Y008	BETA_KLEP3	1, ., 1, ., 9, 9, ., 1	0.3472	0.8540	0.9404	yes	N/A
B1LIJ7	BETA_ECOSM	1, ., 1, ., 9, 9, ., 1	0.3448	0.8606	0.9341	yes	N/A
Q8UH55	BETA_AGRT5	1, ., 1, ., 9, 9, ., 1	0.3344	0.8606	0.9562	yes	N/A
Q1RFM3	BETA_ECOUT	1, ., 1, ., 9, 9, ., 1	0.3482	0.8606	0.9341	yes	N/A
Q6UPE0	CHDH_RAT	1, ., 1, ., 9, 9, ., 1	0.3582	0.8508	0.8664	yes	N/A
Q4K4K7	BETA_PSEF5	1, ., 1, ., 9, 9, ., 1	0.3612	0.8508	0.9153	yes	N/A
B7N8L3	BETA_ECOLU	1, ., 1, ., 9, 9, ., 1	0.3482	0.8606	0.9442	yes	N/A
Q4ZM63	BETA_PSEU2	1, ., 1, ., 9, 9, ., 1	0.3623	0.8491	0.9119	yes	N/A
A7ZWV4	BETA_ECOHS	1, ., 1, ., 9, 9, ., 1	0.3432	0.8524	0.9352	yes	N/A
B7UJG4	BETA_ECO27	1, ., 1, ., 9, 9, ., 1	0.3482	0.8606	0.9442	yes	N/A
Q0T7N0	BETA_SHIF8	1, ., 1, ., 9, 9, ., 1	0.3449	0.8524	0.9352	yes	N/A
Q8NE62	CHDH_HUMAN	1, ., 1, ., 9, 9, ., 1	0.3617	0.8508	0.8737	yes	N/A
Q1QXE1	BETA1_CHRSD	1, ., 1, ., 9, 9, ., 1	0.3467	0.8540	0.9303	yes	N/A
A4XPI5	BETA_PSEMY	1, ., 1, ., 9, 9, ., 1	0.3501	0.8491	0.9168	yes	N/A
Q8YFY2	BETA_BRUME	1, ., 1, ., 9, 9, ., 1	0.3303	0.8524	0.9471	yes	N/A
B7M2V5	BETA_ECO8A	1, ., 1, ., 9, 9, ., 1	0.3432	0.8524	0.9352	yes	N/A
B5Z1R0	BETA_ECO5E	1, ., 1, ., 9, 9, ., 1	0.3465	0.8606	0.9341	yes	N/A
A7ZI50	BETA_ECO24	1, ., 1, ., 9, 9, ., 1	0.3432	0.8524	0.9352	yes	N/A
B7MCD0	BETA_ECO45	1, ., 1, ., 9, 9, ., 1	0.3482	0.8606	0.9341	yes	N/A
B1XE52	BETA_ECODH	1, ., 1, ., 9, 9, ., 1	0.3449	0.8524	0.9352	yes	N/A
A5VPA6	BETA_BRUO2	1, ., 1, ., 9, 9, ., 1	0.3321	0.8524	0.9471	yes	N/A
Q88AE7	BETA_PSESM	1, ., 1, ., 9, 9, ., 1	0.3606	0.8491	0.9119	yes	N/A
B1J0W6	BETA_ECOLC	1, ., 1, ., 9, 9, ., 1	0.3449	0.8524	0.9352	yes	N/A
Q8FKI9	BETA_ECOL6	1, ., 1, ., 9, 9, ., 1	0.3465	0.8606	0.9442	yes	N/A
B7L439	BETA_ECO55	1, ., 1, ., 9, 9, ., 1	0.3432	0.8524	0.9352	yes	N/A
Q3K5H3	BETA_PSEPF	1, ., 1, ., 9, 9, ., 1	0.3525	0.8508	0.9153	yes	N/A
Q1IG70	BETA_PSEE4	1, ., 1, ., 9, 9, ., 1	0.3542	0.8508	0.9185	yes	N/A
Q8BJ64	CHDH_MOUSE	1, ., 1, ., 9, 9, ., 1	0.3530	0.8508	0.8708	yes	N/A
Q48CM7	BETA_PSE14	1, ., 1, ., 9, 9, ., 1	0.3606	0.8491	0.9119	yes	N/A
Q0TKW1	BETA_ECOL5	1, ., 1, ., 9, 9, ., 1	0.3465	0.8606	0.9442	yes	N/A
A6T613	BETA_KLEP7	1, ., 1, ., 9, 9, ., 1	0.3490	0.8540	0.9404	yes	N/A
B6I074	BETA_ECOSE	1, ., 1, ., 9, 9, ., 1	0.3432	0.8524	0.9352	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.99	LOW CONFIDENCE prediction!
3rd Layer	1.1.3.4	LOW CONFIDENCE prediction!
3rd Layer	1.1.3	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		610
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	1e-141
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	1e-121
TIGR01810		532	TIGR01810, betA, choline dehydrogenase	1e-114
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	2e-61
pfam05199		139	pfam05199, GMC_oxred_C, GMC oxidoreductase	5e-49
pfam00732		218	pfam00732, GMC_oxred_N, GMC oxidoreductase	2e-45
PLN02785		587	PLN02785, PLN02785, Protein HOTHEAD	2e-15
PLN02785		587	PLN02785, PLN02785, Protein HOTHEAD	4e-09
TIGR01988		387	TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd	8e-04
COG0579		429	COG0579, COG0579, Predicted dehydrogenase [General	0.003
pfam13450		66	pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-	0.004

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

 Score =  421 bits (1085), Expect = e-141
 Identities = 222/581 (38%), Positives = 303/581 (52%), Gaps = 62/581 (10%)

Query: 43  EYDFIIVGAGPGGCTVANRLSEIPHWKILLLEAG---HYFNYLVDIPV-LNTNLILSPLN 98
           EYD+II+GAG  GC +ANRLSE P   +LLLEAG   + +++ + +P  L   L     N
Sbjct: 5   EYDYIIIGAGSAGCVLANRLSEDPDVSVLLLEAGGPDYRWDFFIQMPAALAFPLQGKRYN 64

Query: 99  WGYKTEKEDCRACLGLKGQRCPWPSGKGVGGTSLINTMLYTRGNKRNYDDWAKL-GNYGW 157
           W Y+TE E       +  +R   P GK +GG+S IN M+Y RGN  +YD+WA+L G  GW
Sbjct: 65  WAYETEPEP-----HMNNRRMECPRGKVLGGSSSINGMVYIRGNAMDYDNWAELPGLEGW 119

Query: 158 SYNEVLPYFKKAERIQISELQNSSYHGTQGFIGVDY-TEYNTPMLDAFLQAGMEAGYPLV 216
           SY + LPYFKKAE     E     Y G  G + V        P+  AF++AG++AGYP  
Sbjct: 120 SYADCLPYFKKAETRDGGE---DDYRGGDGPLSVTRGKPGTNPLFQAFVEAGVQAGYPRT 176

Query: 217 -DYNGKTQTGFARAQATLHKRSRRSSAKDYIDPIKKRCNLTVKDSSFVKKILIDPVTKKA 275
            D NG  Q GF     T+    R S+A+ Y+DP  KR NLT+   +   +IL +   K+A
Sbjct: 177 DDLNGYQQEGFGPMDRTVTNGRRWSAARAYLDPALKRPNLTIVTHALTDRILFEG--KRA 234

Query: 276 CGVLATIKGIDHKILARKEVILSAGAFNSPKLLMLSGIGPQEHLNDLNIPVIKNLR-VGE 334
            GV     G      AR+EVILSAGA NSP+LL LSGIGP EHL +L IPV+ +L  VGE
Sbjct: 235 VGVEYERGGGRETARARREVILSAGAINSPQLLQLSGIGPAEHLKELGIPVVHDLPGVGE 294

Query: 335 NLQEHLAMAGLTFLVNQPIGLLQDRLIKEMPKLFPQWYFEGKGKLTMLGC----EGLAYV 390
           NLQ+HL +  + +   QP+ L         PK+  +W F G G    LG     E   ++
Sbjct: 295 NLQDHLEVY-IQYECKQPVSLYPALKWWNKPKIGAEWLFTGTG----LGASNHFEAGGFI 349

Query: 391 NTKYNVFPDDLPDIEFIFTAVSLASDGGVSLRQEMGITDHLYNSVYSSVDRKDSWSIWPM 450
            ++  V   D P+I++ F  V++  DG  ++ +  G   H                + PM
Sbjct: 350 RSRAGV---DWPNIQYHFLPVAIRYDGSNAV-KGHGFQAH----------------VGPM 389

Query: 451 ILYPRSRGKVLLKDSHPLTPPLIHANFFNDTRDLDVIVEGIKMAIELSKTKAFQSI-GST 509
                SRG V LK + P   P I  N+ +  +D     + I++  E+    A     G  
Sbjct: 390 --RSPSRGSVKLKSADPRAHPSILFNYMSTEQDWREFRDAIRLTREIMAQPALDPYRGRE 447

Query: 510 LHKAPIPGCS-QYTFGSDAYWGCSVRHITTQLHHQCGTCKMGPRWDSSAVVDPQLKVYGV 568
           +     PG   Q    +D      VR      +H   TCKMG   D  AVVDP+ +V+GV
Sbjct: 448 IS----PGADVQ----TDEEIDAFVREHAETAYHPSCTCKMGT--DPMAVVDPEGRVHGV 497

Query: 569 DNLRVVDASIIPVIPGGHTVAVVYMIAEKASDMIK-KTWLP 608
           + LRVVDASI+P I  G+  A   MIAEKA+D+I+ +T L 
Sbjct: 498 EGLRVVDASIMPTITNGNLNAPTIMIAEKAADLIRGRTPLA 538

Length = 560

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233581 TIGR01810, betA, choline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase	Back alignment and domain information

>gnl\|CDD\|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase	Back alignment and domain information

>gnl\|CDD\|215420 PLN02785, PLN02785, Protein HOTHEAD	Back alignment and domain information

>gnl\|CDD\|215420 PLN02785, PLN02785, Protein HOTHEAD	Back alignment and domain information

>gnl\|CDD\|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>gnl\|CDD\|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		610
KOG1238\|consensus		623		100.0
PRK02106		560	choline dehydrogenase; Validated	100.0
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	100.0
COG2303		542	BetA Choline dehydrogenase and related flavoprotei	100.0
PLN02785		587	Protein HOTHEAD	100.0
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	100.0
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	100.0
PF05199		144	GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078	100.0
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.5
PRK07121		492	hypothetical protein; Validated	99.49
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	99.47
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.47
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	99.46
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	99.45
PRK08274		466	tricarballylate dehydrogenase; Validated	99.45
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.44
PRK06175		433	L-aspartate oxidase; Provisional	99.4
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	99.39
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	99.39
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	99.38
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	99.37
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	99.36
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	99.35
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.35
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	99.34
PRK07395		553	L-aspartate oxidase; Provisional	99.34
PLN02815		594	L-aspartate oxidase	99.32
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	99.32
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	99.31
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	99.31
PRK07804		541	L-aspartate oxidase; Provisional	99.3
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	99.29
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	99.29
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	99.28
PRK12839		572	hypothetical protein; Provisional	99.28
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	99.28
PRK12842		574	putative succinate dehydrogenase; Reviewed	99.27
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	99.27
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	99.26
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	99.26
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	99.26
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	99.25
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	99.25
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	99.25
COG0579		429	Predicted dehydrogenase [General function predicti	99.25
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	99.24
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	99.24
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	99.24
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	99.24
COG2081		408	Predicted flavoproteins [General function predicti	99.24
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	99.24
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	99.24
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	99.22
PRK09077		536	L-aspartate oxidase; Provisional	99.22
PTZ00383		497	malate:quinone oxidoreductase; Provisional	99.22
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	99.22
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	99.21
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	99.21
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	99.2
PRK08275		554	putative oxidoreductase; Provisional	99.18
PRK08071		510	L-aspartate oxidase; Provisional	99.17
PRK11728		393	hydroxyglutarate oxidase; Provisional	99.17
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	99.16
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	99.16
PRK07512		513	L-aspartate oxidase; Provisional	99.15
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	99.13
PLN02464		627	glycerol-3-phosphate dehydrogenase	99.13
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	99.13
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	99.12
COG1635		262	THI4 Ribulose 1,5-bisphosphate synthetase, convert	99.11
PLN02661		357	Putative thiazole synthesis	99.1
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	99.09
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	99.07
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	99.07
KOG2820\|consensus		399		99.07
PF01946		230	Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K.	99.07
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	99.06
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	99.05
PRK05257		494	malate:quinone oxidoreductase; Validated	99.04
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	99.04
PRK13339		497	malate:quinone oxidoreductase; Reviewed	99.02
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	99.02
COG3573		552	Predicted oxidoreductase [General function predict	99.02
COG0029		518	NadB Aspartate oxidase [Coenzyme metabolism]	99.02
PRK08401		466	L-aspartate oxidase; Provisional	98.98
COG1053		562	SdhA Succinate dehydrogenase/fumarate reductase, f	98.95
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	98.94
PRK10157		428	putative oxidoreductase FixC; Provisional	98.88
KOG0042\|consensus		680		98.86
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	98.84
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	98.84
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	98.81
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	98.78
PRK10015		429	oxidoreductase; Provisional	98.78
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	98.77
PRK13977		576	myosin-cross-reactive antigen; Provisional	98.77
KOG2844\|consensus		856		98.77
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	98.73
PRK06185		407	hypothetical protein; Provisional	98.72
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	98.71
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	98.69
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	98.68
KOG2415\|consensus		621		98.64
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	98.63
KOG2853\|consensus		509		98.62
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	98.58
KOG4254\|consensus		561		98.58
PRK07208		479	hypothetical protein; Provisional	98.58
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	98.56
TIGR00275		400	flavoprotein, HI0933 family. The model when search	98.55
PLN02985		514	squalene monooxygenase	98.54
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	98.54
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	98.54
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	98.53
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	98.52
PRK08244		493	hypothetical protein; Provisional	98.52
KOG2404\|consensus		477		98.51
KOG1298\|consensus		509		98.49
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	98.46
PRK06126		545	hypothetical protein; Provisional	98.45
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	98.43
PRK06847		375	hypothetical protein; Provisional	98.43
PRK06184		502	hypothetical protein; Provisional	98.41
PRK11445		351	putative oxidoreductase; Provisional	98.41
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	98.41
PRK07045		388	putative monooxygenase; Reviewed	98.41
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	98.4
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	98.39
PRK09126		392	hypothetical protein; Provisional	98.38
KOG2665\|consensus		453		98.38
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	98.37
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	98.37
PRK07190		487	hypothetical protein; Provisional	98.37
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	98.36
COG0445		621	GidA Flavin-dependent tRNA uridine 5-carboxymethyl	98.34
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	98.34
PRK06834		488	hypothetical protein; Provisional	98.33
PRK05675		570	sdhA succinate dehydrogenase flavoprotein subunit;	98.33
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	98.32
PLN02697		529	lycopene epsilon cyclase	98.32
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	98.32
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	98.29
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	98.26
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	98.26
PRK08132		547	FAD-dependent oxidoreductase; Provisional	98.26
TIGR03377		516	glycerol3P_GlpA glycerol-3-phosphate dehydrogenase	98.26
PF13450		68	NAD_binding_8: NAD(P)-binding Rossmann-like domain	98.25
PRK08163		396	salicylate hydroxylase; Provisional	98.23
PRK07588		391	hypothetical protein; Provisional	98.22
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	98.21
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	98.19
KOG2852\|consensus		380		98.18
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	98.18
PRK07236		386	hypothetical protein; Provisional	98.14
PRK07538		413	hypothetical protein; Provisional	98.13
PF00743		531	FMO-like: Flavin-binding monooxygenase-like; Inter	98.09
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	98.08
TIGR01816		565	sdhA_forward succinate dehydrogenase, flavoprotein	98.08
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	98.06
COG0562		374	Glf UDP-galactopyranose mutase [Cell envelope biog	97.96
PRK06116		450	glutathione reductase; Validated	97.92
PRK06475		400	salicylate hydroxylase; Provisional	97.9
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	97.89
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	97.87
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	97.87
PRK08013		400	oxidoreductase; Provisional	97.86
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	97.86
PLN02463		447	lycopene beta cyclase	97.85
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	97.85
PRK06370		463	mercuric reductase; Validated	97.84
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	97.83
KOG1399\|consensus		448		97.82
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.82
TIGR00031		377	UDP-GALP_mutase UDP-galactopyranose mutase. The ge	97.81
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	97.81
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	97.8
KOG0029\|consensus		501		97.79
COG0492		305	TrxB Thioredoxin reductase [Posttranslational modi	97.78
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	97.78
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.77
PLN02576		496	protoporphyrinogen oxidase	97.76
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	97.75
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	97.75
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	97.74
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	97.74
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	97.73
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	97.73
PRK09897		534	hypothetical protein; Provisional	97.73
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	97.71
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	97.7
PTZ00367		567	squalene epoxidase; Provisional	97.69
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	97.69
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	97.67
PTZ00052		499	thioredoxin reductase; Provisional	97.67
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	97.67
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	97.66
PLN02268		435	probable polyamine oxidase	97.65
KOG2311\|consensus		679		97.63
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	97.61
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	97.61
PRK07233		434	hypothetical protein; Provisional	97.61
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	97.6
TIGR02053		463	MerA mercuric reductase. This model represents the	97.6
PRK11883		451	protoporphyrinogen oxidase; Reviewed	97.59
PRK14694		468	putative mercuric reductase; Provisional	97.59
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	97.58
PTZ00058		561	glutathione reductase; Provisional	97.58
PRK08294		634	phenol 2-monooxygenase; Provisional	97.56
COG3349		485	Uncharacterized conserved protein [Function unknow	97.55
TIGR01789		370	lycopene_cycl lycopene cyclase. This model represe	97.53
PRK13748		561	putative mercuric reductase; Provisional	97.51
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	97.51
COG2907		447	Predicted NAD/FAD-binding protein [General functio	97.51
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	97.51
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	97.5
PRK06996		398	hypothetical protein; Provisional	97.5
PRK06753		373	hypothetical protein; Provisional	97.49
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	97.48
PLN02507		499	glutathione reductase	97.48
PLN02568		539	polyamine oxidase	97.48
COG3634		520	AhpF Alkyl hydroperoxide reductase, large subunit	97.45
PLN02546		558	glutathione reductase	97.45
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	97.44
PRK14727		479	putative mercuric reductase; Provisional	97.42
PRK05335		436	tRNA (uracil-5-)-methyltransferase Gid; Reviewed	97.41
PF06100		500	Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross	97.41
PF07992		201	Pyr_redox_2: Pyridine nucleotide-disulphide oxidor	97.4
PRK10262		321	thioredoxin reductase; Provisional	97.4
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	97.4
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	97.4
PTZ00153		659	lipoamide dehydrogenase; Provisional	97.39
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	97.38
PLN02676		487	polyamine oxidase	97.37
PRK05868		372	hypothetical protein; Validated	97.37
PRK12416		463	protoporphyrinogen oxidase; Provisional	97.31
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	97.27
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	97.25
COG3075		421	GlpB Anaerobic glycerol-3-phosphate dehydrogenase	97.25
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	97.25
PRK13512		438	coenzyme A disulfide reductase; Provisional	97.22
KOG2614\|consensus		420		97.19
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	97.18
PLN02328		808	lysine-specific histone demethylase 1 homolog	97.18
COG1232		444	HemY Protoporphyrinogen oxidase [Coenzyme metaboli	97.17
PRK12831		464	putative oxidoreductase; Provisional	97.16
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	97.15
TIGR00137		433	gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo	97.13
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	97.11
PLN02612		567	phytoene desaturase	97.09
PLN02529		738	lysine-specific histone demethylase 1	97.05
PF00996		438	GDI: GDP dissociation inhibitor; InterPro: IPR0182	97.04
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	97.04
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	97.0
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	96.96
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	96.96
PRK12775		1006	putative trifunctional 2-polyprenylphenol hydroxyl	96.95
PRK12779		944	putative bifunctional glutamate synthase subunit b	96.93
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	96.93
PLN02487		569	zeta-carotene desaturase	96.9
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	96.89
KOG4716\|consensus		503		96.86
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	96.8
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	96.78
PRK07846		451	mycothione reductase; Reviewed	96.74
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	96.71
KOG1335\|consensus		506		96.7
KOG2960\|consensus		328		96.7
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	96.69
PLN02852		491	ferredoxin-NADP+ reductase	96.61
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	96.6
PLN03000		881	amine oxidase	96.59
KOG0685\|consensus		498		96.56
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	96.55
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	96.52
KOG3855\|consensus		481		96.49
PRK07845		466	flavoprotein disulfide reductase; Reviewed	96.44
PRK12814		652	putative NADPH-dependent glutamate synthase small	96.44
PLN02976		1713	amine oxidase	96.41
PRK06567		1028	putative bifunctional glutamate synthase subunit b	96.4
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	96.35
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	96.35
PRK12770		352	putative glutamate synthase subunit beta; Provisio	96.33
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	96.29
PRK06370		463	mercuric reductase; Validated	96.29
TIGR02053		463	MerA mercuric reductase. This model represents the	96.28
TIGR01317		485	GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal	96.28
KOG1276\|consensus		491		96.22
PTZ00188		506	adrenodoxin reductase; Provisional	96.22
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	96.19
KOG0405\|consensus		478		96.13
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	96.12
PRK13984		604	putative oxidoreductase; Provisional	96.09
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	96.07
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	96.06
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	95.98
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	95.87
PRK14989		847	nitrite reductase subunit NirD; Provisional	95.87
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	95.81
PRK09564		444	coenzyme A disulfide reductase; Reviewed	95.78
PRK10262		321	thioredoxin reductase; Provisional	95.75
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	95.69
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	95.49
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	95.29
PRK07845		466	flavoprotein disulfide reductase; Reviewed	95.22
PRK09564		444	coenzyme A disulfide reductase; Reviewed	95.18
PRK06116		450	glutathione reductase; Validated	95.14
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	95.12
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	95.05
KOG4405\|consensus		547		94.99
COG0493		457	GltD NADPH-dependent glutamate synthase beta chain	94.98
PRK12831		464	putative oxidoreductase; Provisional	94.88
KOG1439\|consensus		440		94.78
KOG2403\|consensus		642		94.48
COG1206		439	Gid NAD(FAD)-utilizing enzyme possibly involved in	94.45
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	94.34
COG5044		434	MRS6 RAB proteins geranylgeranyltransferase compon	94.28
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	94.28
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	94.15
KOG1800\|consensus		468		94.13
KOG0399\|consensus		2142		94.01
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	93.61
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	93.58
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	93.54
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	93.36
COG0446		415	HcaD Uncharacterized NAD(FAD)-dependent dehydrogen	93.17
KOG0404\|consensus		322		92.85
KOG2755\|consensus		334		92.76
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	92.48
KOG3851\|consensus		446		92.47
COG0569		225	TrkA K+ transport systems, NAD-binding component [	92.44
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	92.21
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	92.15
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	91.81
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	91.68
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	91.54
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	91.49
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	91.39
KOG1336\|consensus		478		91.27
COG4529		474	Uncharacterized protein conserved in bacteria [Fun	90.92
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	90.79
PRK07846		451	mycothione reductase; Reviewed	90.75
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	90.59
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	90.44
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	90.39
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	90.38
PF01593		450	Amino_oxidase: Flavin containing amine oxidoreduct	90.2
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	90.19
PRK06249		313	2-dehydropantoate 2-reductase; Provisional	90.1
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	90.06
PRK04148		134	hypothetical protein; Provisional	90.06
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	90.01
TIGR03385		427	CoA_CoA_reduc CoA-disulfide reductase. Members of	89.76
PRK14989		847	nitrite reductase subunit NirD; Provisional	89.68
PRK13512		438	coenzyme A disulfide reductase; Provisional	89.67
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	89.41
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	89.37
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	89.26
PRK02705		459	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	89.23
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	89.14
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	88.91
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	88.85
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	88.79
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	88.76
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	88.52
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	88.26
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	88.01
PTZ00153		659	lipoamide dehydrogenase; Provisional	87.78
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	87.45
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	87.17
PRK06719		157	precorrin-2 dehydrogenase; Validated	87.13
PTZ00058		561	glutathione reductase; Provisional	87.13
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	87.04
PRK15116		268	sulfur acceptor protein CsdL; Provisional	86.99
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	86.94
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	86.86
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	86.79
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	86.78
PLN02507		499	glutathione reductase	86.77
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	86.64
COG3486		436	IucD Lysine/ornithine N-monooxygenase [Secondary m	86.51
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	86.35
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	86.32
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	86.27
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	86.15
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	86.08
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	85.98
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	85.91
PLN02546		558	glutathione reductase	85.88
PLN02487		569	zeta-carotene desaturase	85.86
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	85.71
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	85.6
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	85.47
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	85.31
PRK08223		287	hypothetical protein; Validated	85.23
PRK14694		468	putative mercuric reductase; Provisional	84.7
PRK12770		352	putative glutamate synthase subunit beta; Provisio	84.61
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	84.53
PRK13748		561	putative mercuric reductase; Provisional	84.42
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	84.38
cd01080		168	NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of	84.35
KOG3923\|consensus		342		84.23
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	84.19
PRK07411		390	hypothetical protein; Validated	84.04
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	83.98
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	83.79
PRK14727		479	putative mercuric reductase; Provisional	83.74
COG1893		307	ApbA Ketopantoate reductase [Coenzyme metabolism]	83.51
PTZ00052		499	thioredoxin reductase; Provisional	83.29
PRK14620		326	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	83.28
cd05292		308	LDH_2 A subgroup of L-lactate dehydrogenases. L-la	83.12
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	82.89
COG1004		414	Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en	82.76
TIGR01763		305	MalateDH_bact malate dehydrogenase, NAD-dependent.	82.73
TIGR02355		240	moeB molybdopterin synthase sulfurylase MoeB. This	82.48
PRK05690		245	molybdopterin biosynthesis protein MoeB; Provision	82.24
PF01262		168	AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal	82.12
TIGR00518		370	alaDH alanine dehydrogenase. The family of known L	82.05
PRK11730		715	fadB multifunctional fatty acid oxidation complex	81.9
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	81.83
PF13478		136	XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2	81.71
TIGR03736		244	PRTRC_ThiF PRTRC system ThiF family protein. A nov	81.6
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	81.26
PRK08328		231	hypothetical protein; Provisional	81.03
PRK12549		284	shikimate 5-dehydrogenase; Reviewed	80.93
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	80.89
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	80.84
TIGR03026		411	NDP-sugDHase nucleotide sugar dehydrogenase. All o	80.69
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	80.62
KOG2018\|consensus		430		80.33

>KOG1238\|consensus	Back alignment and domain information

Probab=100.00  E-value=3.5e-95  Score=750.96  Aligned_cols=568  Identities=47%  Similarity=0.807  Sum_probs=511.3

Q ss_pred             CCcccCCcccEEEECCCchHHHHHHHHhcCCCCcEEEEcCCCCCCCCcccCcccccccCCCCcccccccccccccccCCC
Q psy754           36 KDQDLLLEYDFIIVGAGPGGCTVANRLSEIPHWKILLLEAGHYFNYLVDIPVLNTNLILSPLNWGYKTEKEDCRACLGLK  115 (610)
Q Consensus        36 ~~~~~~~~~DvIIVGsG~~G~~~A~~La~~~G~~VlvLE~G~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  115 (610)
                      ...+...+||+||||||.+||++|.+|++++.++|||||+|+......+.|.....++.+.++|.|.++|+. ..+....
T Consensus        50 ~~~~~~~~yDyIVVGgGtAGcvlAarLSEn~~~~VLLLEaGg~~~~~~~~p~~~~~~q~s~~dw~y~t~Ps~-~ac~~m~  128 (623)
T KOG1238|consen   50 TGSELDSSYDYIVVGGGTAGCVLAARLSENPNWSVLLLEAGGDPPLYSDPPLLAANLQLSLYDWSYHTEPSQ-HACLAMS  128 (623)
T ss_pred             cccccccCCCEEEECCCchhHHHHHhhccCCCceEEEEecCCCCcccccchHHHHHhccccccccCcCccCh-hhhhhhc
Confidence            344577789999999999999999999998889999999999887677888777788899999999999998 7777788


Q ss_pred             CCeeeecCcccccchhhhccceeecCCccchHHHHhcCCCCCCcCchHHHHHHHhhhccccccCCCCCCCcceEEEeeCC
Q psy754          116 GQRCPWPSGKGVGGTSLINTMLYTRGNKRNYDDWAKLGNYGWSYNEVLPYFKKAERIQISELQNSSYHGTQGFIGVDYTE  195 (610)
Q Consensus       116 ~~~~~~~~g~~lGG~s~~~~~~~~r~~~~~~~~~~~~g~~~w~~~~~~~~~~~~e~~~~~~~~~~~~~~~~G~l~~~~~~  195 (610)
                      +..+.|+||+++||+|.+|+|.|.|....||+.|.+.+.++|+|+++.+||+++|+.........++|+..|++.+....
T Consensus       129 ~~~c~wpRGrVLGGsS~iN~m~Y~RG~r~Dyd~W~~~gnpgW~y~~vl~yf~k~E~~~~~~~~~~~y~~~~g~~~ve~~~  208 (623)
T KOG1238|consen  129 EDRCYWPRGRVLGGSSVLNAMFYVRGNRRDYDRWAAEGNPGWSYDEVLPYFKKSEDKVVPDPELTPYHGAGGPLLVEAGV  208 (623)
T ss_pred             CCceecCccceecccccccceEEecCCccchHHHHHhcCCCCCHHHHHHHHHHHhhccCCCcccCcccccCCcceecccc
Confidence            99999999999999999999999999999999999999999999999999999999977755566789999999999988


Q ss_pred             CCChhHHHHHHHHHHcCCCccCCCCCCcceeeeecccccCCeecchhHhhhhcccC-CCCcEEecCceEEEEEEcCCCCe
Q psy754          196 YNTPMLDAFLQAGMEAGYPLVDYNGKTQTGFARAQATLHKRSRRSSAKDYIDPIKK-RCNLTVKDSSFVKKILIDPVTKK  274 (610)
Q Consensus       196 ~~~~~~~~~~~~~~~~G~~~~~~~~~~~~g~~~~~~~~~~g~~~~~~~~~l~~~~~-~~gv~i~~~~~V~~i~~~~~~~r  274 (610)
                      +..+....+.++..+.|.+..|+++....|+...+.+.+++.|++...+|+.+... ++|+.+..++.|++|.+|+.+.+
T Consensus       209 ~~~~~~~~~~~ag~e~G~~~~D~nG~~~tg~~~l~~t~~~g~R~s~~~a~l~~~~~~R~NL~~~~~~~vtrvl~D~~~~~  288 (623)
T KOG1238|consen  209 YPNNLFTAFHRAGTEIGGSIFDRNGERHTGASLLQYTIRNGIRVSLAKAYLKPIRLTRPNLHISRNAAVTRVLIDPAGKR  288 (623)
T ss_pred             ccCchhhHhHHhHHhcCCCccCCCCccccchhhhhccccCCEEEEehhhhhhhhhccCccccccccceEEEEEEcCCCce
Confidence            99999999999999999888899999999999989999999999999999988766 88999999999999999988889


Q ss_pred             EEEEEEEEc-CeEEEEEecceEEeccCCcCchhHHHHhCCCChhhhhhCCCCceeecc-cchhhhhccccceeEEEEcCC
Q psy754          275 ACGVLATIK-GIDHKILARKEVILSAGAFNSPKLLMLSGIGPQEHLNDLNIPVIKNLR-VGENLQEHLAMAGLTFLVNQP  352 (610)
Q Consensus       275 v~GV~~~~~-g~~~~i~a~~~VVlAaG~~~sp~LL~~Sgig~~~~l~~~gi~~~~~~~-vG~~l~dH~~~~~~~~~~~~~  352 (610)
                      +.||++... ++.+++.|+|+|||+||+++||+|||+|||||.++|++.||+++.++| ||+||+||+......+ ...+
T Consensus       289 a~gv~~~~~~~~~~~v~a~kEVILSAGAi~SPQLLMLSGIGP~~~L~~~gIpvv~dLP~VG~nLqDH~~~~~~~~-~~~~  367 (623)
T KOG1238|consen  289 AKGVEFVRDGGKEHTVKARKEVILSAGAINSPQLLMLSGIGPADHLKKLGIPVVLDLPGVGQNLQDHPMNPGFVF-STNP  367 (623)
T ss_pred             EEEEEEEecCceeeeecccceEEEeccccCCHHHHHHcCCCcHHHHHhcCCCeeccCcccccccccccccceeee-cCCC
Confidence            999999987 799999999999999999999999999999999999999999999999 9999999999844443 4334


Q ss_pred             cccchhhhhhcccchhhhHhhcCCCcccccccceEEEEecCCCCCCCCCCCeEEEEecccccCCCCccchhccccchhhh
Q psy754          353 IGLLQDRLIKEMPKLFPQWYFEGKGKLTMLGCEGLAYVNTKYNVFPDDLPDIEFIFTAVSLASDGGVSLRQEMGITDHLY  432 (610)
Q Consensus       353 ~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  432 (610)
                      .......+.  ....+.+|+..+.|+++..+.+..+|+++..+..+..+||+++++....+..+.+..+....+   +++
T Consensus       368 ~~~~~~~~~--~~~~~~~yl~~~~G~~~~~~~e~~~f~~t~~~~~~~~~PD~~~~~~~~~~~~~~~~~~~~~~~---~~y  442 (623)
T KOG1238|consen  368 VELSLIRLV--GITTVGQYLEGGSGPLASPGVETLGFINTVSSNLSLDWPDIELHFVAGSLSSDGLTALRKALG---EIY  442 (623)
T ss_pred             ccccccccc--cchHHHHHHHcCCCCcccCcceeeEEeccccccCcCCCCCeeEEeccccccccchhhhhhhcc---hHH
Confidence            333223332  456678888888899886668889999999888888999999988877776665444444333   677


Q ss_pred             hhhcccCCCCCeeEEEeeeccccceeEEEeeCCCCCCCCeeccCCCCChhhHHHHHHHHHHHHHHHcCcchhhhcccccc
Q psy754          433 NSVYSSVDRKDSWSIWPMILYPRSRGKVLLKDSHPLTPPLIHANFFNDTRDLDVIVEGIKMAIELSKTKAFQSIGSTLHK  512 (610)
Q Consensus       433 ~~~~~~~~~~~~~~i~~~~~~p~s~g~v~l~~~d~~~~p~i~~~~~~~~~D~~~~~~~~~~~~~i~~~~~~~~~~~~~~~  512 (610)
                      +.++.+......+.|+..+.+|.|+|+|.|+++||...|.|++||+.+|+|++.+.++++.+.++.++++|+++++.++.
T Consensus       443 ~~~~~~~~~~~~~~i~~~~l~P~SrG~l~L~s~nP~~~P~I~~NY~~~p~Dv~~~vegi~~~~~l~~s~af~~~~~r~~~  522 (623)
T KOG1238|consen  443 QALFGELTNSDSFVIFPKLLRPKSRGRLKLRSTNPRDNPLITPNYFTHPEDVATLVEGIRTIIRLSNSKAFQRFGARLWK  522 (623)
T ss_pred             HHhhhhhhcCceeEEeehhcCCCccceEEecCCCCCcCceeccCcCCCHHHHHHHHHHHHHHHHHHcCHHHHHhcchhcc
Confidence            77776665555688888889999999999999999999999999999999999999999999999999999999999988


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHhhcCCCccccccccccCCCCCCCccCCCCcEeccCCceEeeccCCCCCCCcccHHHHH
Q psy754          513 APIPGCSQYTFGSDAYWGCSVRHITTQLHHQCGTCKMGPRWDSSAVVDPQLKVYGVDNLRVVDASIIPVIPGGHTVAVVY  592 (610)
Q Consensus       513 ~~~p~~~~~~~~~~~~~~~~~~~~~~~~~H~~Gt~rMG~~~~~~~VVD~~~rv~g~~nL~V~D~Sv~P~~~~~NPtlTi~  592 (610)
                      .+.|+|+...+.++++|++++|....|.+|++|||+||+..||++|||+++||||++||||+|+|+||.++++||.+|+|
T Consensus       523 ~~~~~c~~~~~~sd~yw~c~~R~~~~TiyH~~GtckMGp~~D~~aVVD~~lrV~Gv~~LRVVDaSimP~~psgN~nA~v~  602 (623)
T KOG1238|consen  523 KPVPGCDLLAFLSDAYWECFCRHTVVTIYHYSGTCKMGPSSDPTAVVDPQLRVHGVRGLRVVDASIMPESPSGNPNAPVM  602 (623)
T ss_pred             ccCCCcccccCCCHHHHHHHHHhccceeeccCCceEeCCccCCCcccCCcceeccccCceEeeccccCCCCCCCccHHHH
Confidence            88999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhcCCCC
Q psy754          593 MIAEKASDMIKKTWLPNQ  610 (610)
Q Consensus       593 Ala~r~a~~i~~~~~~~~  610 (610)
                      |+|+|+|+.|+++|..++
T Consensus       603 MIgek~ad~Ik~~~~~~~  620 (623)
T KOG1238|consen  603 MIGEKAADMIKEEWLANK  620 (623)
T ss_pred             HHHHHHHHHHHHHhhhcC
Confidence            999999999999998763

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02785 Protein HOTHEAD	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02661 Putative thiazole synthesis	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>KOG2820\|consensus	Back alignment and domain information

>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>COG3573 Predicted oxidoreductase [General function prediction only]	Back alignment and domain information

>COG0029 NadB Aspartate oxidase [Coenzyme metabolism]	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>KOG0042\|consensus	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>KOG2844\|consensus	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>KOG2415\|consensus	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>KOG2853\|consensus	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>KOG4254\|consensus	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>KOG2404\|consensus	Back alignment and domain information

>KOG1298\|consensus	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>KOG2665\|consensus	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit	Back alignment and domain information

>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>KOG2852\|consensus	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes []	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>KOG1399\|consensus	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>KOG0029\|consensus	Back alignment and domain information

>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PTZ00367 squalene epoxidase; Provisional	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>KOG2311\|consensus	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>COG3349 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01789 lycopene_cycl lycopene cyclase	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>COG2907 Predicted NAD/FAD-binding protein [General function prediction only]	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed	Back alignment and domain information

>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis []	Back alignment and domain information

>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>KOG2614\|consensus	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>PLN02612 phytoene desaturase	Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>KOG4716\|consensus	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>KOG1335\|consensus	Back alignment and domain information

>KOG2960\|consensus	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PLN02852 ferredoxin-NADP+ reductase	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>KOG0685\|consensus	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>KOG3855\|consensus	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit	Back alignment and domain information

>KOG1276\|consensus	Back alignment and domain information

>PTZ00188 adrenodoxin reductase; Provisional	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>KOG0405\|consensus	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>KOG4405\|consensus	Back alignment and domain information

>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>KOG1439\|consensus	Back alignment and domain information

>KOG2403\|consensus	Back alignment and domain information

>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>KOG1800\|consensus	Back alignment and domain information

>KOG0399\|consensus	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>KOG0404\|consensus	Back alignment and domain information

>KOG2755\|consensus	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>KOG3851\|consensus	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>KOG1336\|consensus	Back alignment and domain information

>COG4529 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO)	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>PRK06249 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>PRK08223 hypothetical protein; Validated	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>KOG3923\|consensus	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK07411 hypothetical protein; Validated	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent	Back alignment and domain information

>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1	Back alignment and domain information

>TIGR00518 alaDH alanine dehydrogenase	Back alignment and domain information

>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A	Back alignment and domain information

>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK08328 hypothetical protein; Provisional	Back alignment and domain information

>PRK12549 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>KOG2018\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		610
3fim_B		566	Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu		1e-55
3q9t_A		577	Crystal Structure Analysis Of Formate Oxidase Lengt		1e-47
2jbv_A		546	Crystal Structure Of Choline Oxidase Reveals Insigh		1e-42
3nne_A		546	Crystal Structure Of Choline Oxidase S101a Mutant L		1e-42
3ljp_A		546	Crystal Structure Of Choline Oxidase V464a Mutant L		2e-42
1cf3_A		583	Glucose Oxidase From Apergillus Niger Length = 583		3e-41
3t37_A		526	Crystal Structure Of Pyridoxine 4-Oxidase From Meso		5e-38
1gpe_A		587	Glucose Oxidase From Penicillium Amagasakiense Leng		8e-35
1ju2_A		536	Crystal Structure Of The Hydroxynitrile Lyase From		6e-24
3gdn_A		521	Almond Hydroxynitrile Lyase In Complex With Benzald		6e-24
3red_A		521	3.0 A Structure Of The Prunus Mume Hydroxynitrile L		1e-23
1kdg_A		546	Crystal Structure Of The Flavin Domain Of Cellobios		7e-14
1naa_A		541	Cellobiose Dehydrogenase Flavoprotein Fragment In C		7e-14

>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566