Psyllid ID: psy7590


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MAEEKIILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQFKGRITFDTNAADGQLKKTASNRKLRELRGPGFEFTPFQQAVQESVAWFRENHSVARL
cccccEEEEEcccccccHHHHHHHHHHccccccEEEEccccccccccHHHHHHHHHHccccEEEEHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccHHHHHHHHHHHHHccccccHHccccccccccccccccccccccccccccccccccEEEEcccccccEEEEEHHHHHHHHHHHHHHcccccccEEEccccccccHHHHHHHHHHHHccccEEEEccccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHccccccc
cccccEEEEEccccHHcHHHHHHHHHHcccccEEEEcccccccccccHHHHHHHHHHHcccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHccccccccEcHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEccccccccccccHHHHHHHHHHHcccccccccccccccccEEEEEEEccccccEEEEcccccccccccEEEEEccccccccEEEHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHcccccEEEcccccccHHHHEccHHHHHHHHccccccccHHHHHHHHHHHHHHccccccc
MAEEKIILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSskeadlsnLESTQQLFSKYKPTHVIHLAAMVGGlfhnmshnldFFRVNMKINDNVLDTSYKQGVKKVVSCLstcifpdkttypidetmvhngpphpsnfgysHAKRMLDVLNKAYYQqhgvtytsvipcnvfgphdnynlesshviPGLIRKLYDTiekgkdqsvfesrarfppgansfgldkldlipfslfpfcftggdefkvlgtgkplrqFIYSLDLARLFIWVLReydsvepiilsvdekdeVTIAEVAEAIANAFQfkgritfdtnaadgqlkktasnrklrelrgpgfeftpfqQAVQESVAWFRENHSVARL
maeekiilvtggtglvgkaIEKIVkeeekrddetwifvsskeadlsnLESTQQLFSKYKPTHVIHLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQFKGRITFDTNAADGQLKKTASNRKLRELRGPGFEFTPFQQAVQESVAWFRENHSVARL
MAEEKIILVTGGTGLVGkaiekivkeeekRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDevtiaevaeaianaFQFKGRITFDTNAADGQLKKTASNRKLRELRGPGFEFTPFQQAVQESVAWFRENHSVARL
*****IILVTGGTGLVGKAIEKIVKE*****DETWIFVSS**********TQQLFSKYKPTHVIHLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDETMVHN******NFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIPGLIRKLYDTIEKGK***VF****RFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQFKGRITFDTNA********************GFEFTPFQQAVQESVAWF*********
**EEKIILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQFKGRITFDTNAADGQLKKTASNRKLRELRGPGFEFTPFQQAVQESVAWFRENHSVA**
MAEEKIILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQFKGRITFDTNAADGQLKKTASNRKLRELRGPGFEFTPFQQAVQESVAWFRENHSVARL
***EKIILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQFKGRITFDTNAADGQLKKTASNRKLRELRGPGFEFTPFQQAVQESVAWFRENHSVARL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEEKIILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQFKGRITFDTNAADGQLKKTASNRKLRELRGPGFEFTPFQQAVQESVAWFRENHSVARL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query358 2.2.26 [Sep-21-2011]
Q8K3X2321 GDP-L-fucose synthase OS= yes N/A 0.868 0.968 0.586 1e-117
P23591321 GDP-L-fucose synthase OS= yes N/A 0.868 0.968 0.584 1e-116
Q9W1X8321 Probable GDP-L-fucose syn yes N/A 0.891 0.993 0.589 1e-116
Q13630321 GDP-L-fucose synthase OS= yes N/A 0.868 0.968 0.578 1e-116
Q5RBE5321 GDP-L-fucose synthase OS= yes N/A 0.868 0.968 0.578 1e-116
Q55C77320 GDP-L-fucose synthase OS= yes N/A 0.874 0.978 0.533 1e-107
Q9LMU0328 Putative GDP-L-fucose syn yes N/A 0.832 0.908 0.306 9e-40
O49213323 GDP-L-fucose synthase 1 O no N/A 0.832 0.922 0.297 4e-39
P55353314 Uncharacterized protein y yes N/A 0.773 0.882 0.317 8e-39
Q67WR2328 Probable GDP-L-fucose syn yes N/A 0.837 0.914 0.298 7e-38
>sp|Q8K3X2|FCL_CRIGR GDP-L-fucose synthase OS=Cricetulus griseus GN=TSTA3 PE=2 SV=1 Back     alignment and function desciption
 Score =  423 bits (1087), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/351 (58%), Positives = 250/351 (71%), Gaps = 40/351 (11%)

Query: 7   ILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHL 66
           ILVTGG+GLVG+AI+K+V +      E W+FVSSK+ADL++   TQ LF K +PTHVIHL
Sbjct: 10  ILVTGGSGLVGRAIQKVVADGAGLPGEEWVFVSSKDADLTDAAQTQALFQKVQPTHVIHL 69

Query: 67  AAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDET 126
           AAMVGGLF N+ +NLDF+R N+ INDNVL ++++ G +KVVSCLSTCIFPDKTTYPIDET
Sbjct: 70  AAMVGGLFRNIKYNLDFWRKNVHINDNVLHSAFEVGTRKVVSCLSTCIFPDKTTYPIDET 129

Query: 127 MVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIP 186
           M+HNGPPH SNFGYS+AKRM+DV N+AY+QQHG T+T+VIP NVFGPHDN+N+E  HV+P
Sbjct: 130 MIHNGPPHSSNFGYSYAKRMIDVQNRAYFQQHGCTFTAVIPTNVFGPHDNFNIEDGHVLP 189

Query: 187 GLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVLGT 246
           GLI K++                                          + G    V GT
Sbjct: 190 GLIHKVH---------------------------------------LAKSNGSALTVWGT 210

Query: 247 GKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQFKGRIT 306
           GKP RQFIYSLDLARLFIWVLREY+ VEPIILSV E+DEV+I E AEA+  A  F G +T
Sbjct: 211 GKPRRQFIYSLDLARLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFCGEVT 270

Query: 307 FDTNAADGQLKKTASNRKLRELRGPGFEFTPFQQAVQESVAWFRENHSVAR 357
           FD+  +DGQ KKTASN KLR    P F FTPF+QAV+E+ AWF +N+  AR
Sbjct: 271 FDSTKSDGQYKKTASNGKLRAYL-PDFRFTPFKQAVKETCAWFTDNYEQAR 320




Two step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction.
Cricetulus griseus (taxid: 10029)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 7EC: 1
>sp|P23591|FCL_MOUSE GDP-L-fucose synthase OS=Mus musculus GN=Tsta3 PE=2 SV=3 Back     alignment and function description
>sp|Q9W1X8|FCL_DROME Probable GDP-L-fucose synthase OS=Drosophila melanogaster GN=Gmer PE=2 SV=1 Back     alignment and function description
>sp|Q13630|FCL_HUMAN GDP-L-fucose synthase OS=Homo sapiens GN=TSTA3 PE=1 SV=1 Back     alignment and function description
>sp|Q5RBE5|FCL_PONAB GDP-L-fucose synthase OS=Pongo abelii GN=TSTA3 PE=2 SV=1 Back     alignment and function description
>sp|Q55C77|FCL_DICDI GDP-L-fucose synthase OS=Dictyostelium discoideum GN=ger PE=3 SV=1 Back     alignment and function description
>sp|Q9LMU0|FCL2_ARATH Putative GDP-L-fucose synthase 2 OS=Arabidopsis thaliana GN=GER2 PE=2 SV=1 Back     alignment and function description
>sp|O49213|FCL1_ARATH GDP-L-fucose synthase 1 OS=Arabidopsis thaliana GN=GER1 PE=1 SV=3 Back     alignment and function description
>sp|P55353|Y4AF_RHISN Uncharacterized protein y4aF OS=Rhizobium sp. (strain NGR234) GN=NGR_a00420 PE=3 SV=1 Back     alignment and function description
>sp|Q67WR2|FCL1_ORYSJ Probable GDP-L-fucose synthase 1 OS=Oryza sativa subsp. japonica GN=Os06g0652400 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
91085271318 PREDICTED: similar to nad dependent epim 0.885 0.996 0.652 1e-133
242023358316 GDP-L-fucose synthetase, putative [Pedic 0.874 0.990 0.651 1e-131
332375767318 unknown [Dendroctonus ponderosae] 0.885 0.996 0.627 1e-130
156541932321 PREDICTED: probable GDP-L-fucose synthas 0.893 0.996 0.638 1e-128
383858985322 PREDICTED: probable GDP-L-fucose synthas 0.891 0.990 0.620 1e-127
357621747325 putative nad dependent epimerase/dehydra 0.891 0.981 0.609 1e-125
380027361322 PREDICTED: probable GDP-L-fucose synthas 0.893 0.993 0.611 1e-125
242247583321 GDP-L-fucose synthase-like [Acyrthosipho 0.879 0.981 0.605 1e-124
66547543322 PREDICTED: probable GDP-L-fucose synthas 0.893 0.993 0.611 1e-124
340723148322 PREDICTED: probable GDP-L-fucose synthas 0.893 0.993 0.606 1e-123
>gi|91085271|ref|XP_967089.1| PREDICTED: similar to nad dependent epimerase/dehydratase [Tribolium castaneum] gi|270008444|gb|EFA04892.1| hypothetical protein TcasGA2_TC014956 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/357 (65%), Positives = 273/357 (76%), Gaps = 40/357 (11%)

Query: 1   MAEEKIILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKP 60
           M+E KIILVTGG+GLVGKAI+ ++ E+EK+ DETWIFV+SK+A+L +LE T++LF K+KP
Sbjct: 1   MSENKIILVTGGSGLVGKAIQTVL-EDEKKSDETWIFVNSKDANLCDLEETKKLFEKHKP 59

Query: 61  THVIHLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTT 120
           THVIHLAAMVGGLFHNM+HNLDF R N+++N NVLD SY  GVKKVVSCLSTCIFPDKTT
Sbjct: 60  THVIHLAAMVGGLFHNMNHNLDFLRNNLQMNSNVLDVSYATGVKKVVSCLSTCIFPDKTT 119

Query: 121 YPIDETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLE 180
            PIDETM+HNGPPHPSNFGYS+AKRM+D++NKAY++QHG  YTSV+PCNVFGPHDNYNLE
Sbjct: 120 CPIDETMIHNGPPHPSNFGYSYAKRMIDIMNKAYHEQHGCLYTSVVPCNVFGPHDNYNLE 179

Query: 181 SSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDE 240
           SSHVIPGLIR+L+D  E                                       GG  
Sbjct: 180 SSHVIPGLIRRLHDVTE--------------------------------------AGGKT 201

Query: 241 FKVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQ 300
           F VLGTGKPLRQFIYSLDLA+LF+WVLREY+ +EPIILSVDE  EV+I ++ E +A AF 
Sbjct: 202 FTVLGTGKPLRQFIYSLDLAKLFLWVLREYNEIEPIILSVDEAAEVSIRQLTEELAKAFD 261

Query: 301 FKGRITFDTNAADGQLKKTASNRKLRELRGPGFEFTPFQQAVQESVAWFRENHSVAR 357
           FKG I FDT  ADGQ KKTASN KLR+   P FEFTPF  AV+ESV W+R N+  AR
Sbjct: 262 FKGEIVFDTTKADGQYKKTASNAKLRKYL-PDFEFTPFPVAVKESVDWYRANYQNAR 317




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242023358|ref|XP_002432101.1| GDP-L-fucose synthetase, putative [Pediculus humanus corporis] gi|212517475|gb|EEB19363.1| GDP-L-fucose synthetase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332375767|gb|AEE63024.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|156541932|ref|XP_001600760.1| PREDICTED: probable GDP-L-fucose synthase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383858985|ref|XP_003704979.1| PREDICTED: probable GDP-L-fucose synthase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|357621747|gb|EHJ73476.1| putative nad dependent epimerase/dehydratase [Danaus plexippus] Back     alignment and taxonomy information
>gi|380027361|ref|XP_003697395.1| PREDICTED: probable GDP-L-fucose synthase-like [Apis florea] Back     alignment and taxonomy information
>gi|242247583|ref|NP_001156247.1| GDP-L-fucose synthase-like [Acyrthosiphon pisum] gi|239791242|dbj|BAH72114.1| ACYPI007507 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|66547543|ref|XP_625134.1| PREDICTED: probable GDP-L-fucose synthase [Apis mellifera] Back     alignment and taxonomy information
>gi|340723148|ref|XP_003399958.1| PREDICTED: probable GDP-L-fucose synthase-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
UNIPROTKB|E2RM30321 TSTA3 "Uncharacterized protein 0.555 0.619 0.633 2.8e-103
RGD|1307028321 Tsta3 "tissue specific transpl 0.555 0.619 0.633 9.5e-103
UNIPROTKB|Q2KIT8321 TSTA3 "Tissue specific transpl 0.555 0.619 0.623 2.5e-102
MGI|MGI:98857321 Tsta3 "tissue specific transpl 0.547 0.610 0.631 1.1e-101
UNIPROTKB|Q13630321 TSTA3 "GDP-L-fucose synthase" 0.555 0.619 0.618 3.6e-101
FB|FBgn0034794321 Gmer "GDP-4-keto-6-deoxy-D-man 0.547 0.610 0.654 3.7e-99
ZFIN|ZDB-GENE-040722-1318 tsta3 "tissue specific transpl 0.561 0.632 0.616 6e-99
ZFIN|ZDB-GENE-061013-348320 zgc:153776 "zgc:153776" [Danio 0.558 0.625 0.616 1.2e-98
ZFIN|ZDB-GENE-071004-107320 zgc:173683 "zgc:173683" [Danio 0.558 0.625 0.616 5.3e-98
ZFIN|ZDB-GENE-050417-317354 zgc:110348 "zgc:110348" [Danio 0.558 0.564 0.606 6.9e-96
UNIPROTKB|E2RM30 TSTA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 694 (249.4 bits), Expect = 2.8e-103, Sum P(2) = 2.8e-103
 Identities = 126/199 (63%), Positives = 156/199 (78%)

Query:     7 ILVTGGTGLVGXXXXXXXXXXXXRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHL 66
             ILVTGG+GLVG               E W+FVSSK+ADL++   T+ LF K +PTHVIHL
Sbjct:    10 ILVTGGSGLVGRAIQKVVADGAGLPGEDWVFVSSKDADLTDAAQTRALFEKVRPTHVIHL 69

Query:    67 AAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDET 126
             AAMVGGLF N+ +NLDF+R N+ INDNVL ++++ GV+KVVSCLSTCIFPDKTTYPIDET
Sbjct:    70 AAMVGGLFRNIKYNLDFWRKNVHINDNVLHSAFEVGVRKVVSCLSTCIFPDKTTYPIDET 129

Query:   127 MVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIP 186
             M+HNGPPH SNFGYS+AKRM+DV N+AY+QQHG T+T+VIP NVFGPHDN+N+E  HV+P
Sbjct:   130 MIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQHGCTFTAVIPTNVFGPHDNFNIEDGHVLP 189

Query:   187 GLIRKLYDTIEKGKDQSVF 205
             GLI K++     G   +V+
Sbjct:   190 GLIHKVHLAKSSGSALTVW 208


GO:0050577 "GDP-L-fucose synthase activity" evidence=IEA
GO:0019835 "cytolysis" evidence=IEA
GO:0019673 "GDP-mannose metabolic process" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
RGD|1307028 Tsta3 "tissue specific transplantation antigen P35B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIT8 TSTA3 "Tissue specific transplantation antigen P35B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:98857 Tsta3 "tissue specific transplantation antigen P35B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q13630 TSTA3 "GDP-L-fucose synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0034794 Gmer "GDP-4-keto-6-deoxy-D-mannose 3,5-epimerase/4-reductase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040722-1 tsta3 "tissue specific transplantation antigen P35B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061013-348 zgc:153776 "zgc:153776" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-107 zgc:173683 "zgc:173683" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-317 zgc:110348 "zgc:110348" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8K3X2FCL_CRIGR1, ., 1, ., 1, ., 2, 7, 10.58680.86870.9688yesN/A
Q55C77FCL_DICDI1, ., 1, ., 1, ., 2, 7, 10.53380.87430.9781yesN/A
P23591FCL_MOUSE1, ., 1, ., 1, ., 2, 7, 10.58400.86870.9688yesN/A
Q5RBE5FCL_PONAB1, ., 1, ., 1, ., 2, 7, 10.57830.86870.9688yesN/A
Q9W1X8FCL_DROME1, ., 1, ., 1, ., 2, 7, 10.58920.89100.9937yesN/A
P55353Y4AF_RHISNNo assigned EC number0.31770.77370.8821yesN/A
Q9LMU0FCL2_ARATH1, ., 1, ., 1, ., 2, 7, 10.30650.83240.9085yesN/A
Q13630FCL_HUMAN1, ., 1, ., 1, ., 2, 7, 10.57830.86870.9688yesN/A
Q67WR2FCL1_ORYSJ1, ., 1, ., 1, ., 2, 7, 10.29880.83790.9146yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.1.1.271LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
cd05239300 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, exte 1e-156
PLN02725306 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5- 1e-131
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 3e-54
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 5e-33
cd08946200 cd08946, SDR_e, extended (e) SDRs 5e-21
cd05273328 cd05273, GME-like_SDR_e, Arabidopsis thaliana GDP- 6e-21
cd05256304 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-e 7e-15
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 4e-13
cd05257316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 4e-11
TIGR01179328 TIGR01179, galE, UDP-glucose-4-epimerase GalE 2e-10
cd05247323 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, 7e-10
cd05246315 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydra 9e-10
COG1087329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envel 1e-09
cd05241331 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid d 4e-09
cd05254280 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4 6e-09
cd05237287 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-l 1e-08
cd05240306 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase 3e-08
cd05232303 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, 8e-08
pfam01073280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydr 8e-08
pfam02719280 pfam02719, Polysacc_synt_2, Polysaccharide biosynt 9e-08
COG1091281 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [C 1e-07
pfam04321284 pfam04321, RmlD_sub_bind, RmlD substrate binding d 2e-07
COG1086588 COG1086, COG1086, Predicted nucleoside-diphosphate 6e-07
TIGR04130337 TIGR04130, FnlA, UDP-N-acetylglucosamine 4,6-dehyd 2e-06
cd09813335 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD 8e-06
COG1088340 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cel 3e-05
cd05234305 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, 5e-05
cd09811354 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD 6e-05
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 2e-04
cd05230305 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase 3e-04
PLN02695370 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase 6e-04
TIGR01181317 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehyd 0.002
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.003
>gnl|CDD|187550 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, extended (e) SDRs Back     alignment and domain information
 Score =  440 bits (1135), Expect = e-156
 Identities = 149/344 (43%), Positives = 203/344 (59%), Gaps = 45/344 (13%)

Query: 7   ILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHL 66
           ILVTG  GLVG AI +++    +R  E  +F +SKE DL++ E+ +  F K KP +VIHL
Sbjct: 2   ILVTGHRGLVGSAIVRVL---ARRGYENVVFRTSKELDLTDQEAVRAFFEKEKPDYVIHL 58

Query: 67  AAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDET 126
           AA VGG+  NM++  DF R N+ INDNV+  +++ GVKK+V   S+CI+PD    PIDE+
Sbjct: 59  AAKVGGIVANMTYPADFLRDNLLINDNVIHAAHRFGVKKLVFLGSSCIYPDLAPQPIDES 118

Query: 127 MVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIP 186
            +  GPP P+N GY+ AKR    L +AY +Q+G  Y SV+P N++GPHDN++ E+SHVIP
Sbjct: 119 DLLTGPPEPTNEGYAIAKRAGLKLCEAYRKQYGCDYISVMPTNLYGPHDNFDPENSHVIP 178

Query: 187 GLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVLGT 246
            LIRK +               A            KL             GG E  V G+
Sbjct: 179 ALIRKFH--------------EA------------KL------------RGGKEVTVWGS 200

Query: 247 GKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQFKGRIT 306
           G P R+F+YS DLAR  +++L  YD  EPII++V    E++I E+AEAIA    FKG I 
Sbjct: 201 GTPRREFLYSDDLARAIVFLLENYD--EPIIVNVGSGVEISIRELAEAIAEVVGFKGEIV 258

Query: 307 FDTNAADGQLKKTASNRKLRELRGPGFEFTPFQQAVQESVAWFR 350
           FDT+  DGQ +K     KLR L    F FTP +Q ++E+  W+ 
Sbjct: 259 FDTSKPDGQPRKLLDVSKLRAL--GWFPFTPLEQGIRETYEWYL 300


GDP-fucose synthetase (aka 3, 5-epimerase-4-reductase) acts in the NADP-dependent synthesis of GDP-fucose from GDP-mannose. Two activities have been proposed for the same active site: epimerization and reduction. Proteins in this subgroup are extended SDRs, which have a characteristic active site tetrad and an NADP-binding motif, [AT]GXXGXXG, that is a close match to the archetypical form. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 300

>gnl|CDD|178326 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187581 cd05273, GME-like_SDR_e, Arabidopsis thaliana GDP-mannose-3',5'-epimerase (GME)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE Back     alignment and domain information
>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224012 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187564 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4-hexulose reductase and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked N-acetylglucosamine) inverting 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187551 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup 3, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>gnl|CDD|217199 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein Back     alignment and domain information
>gnl|CDD|224016 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|218026 pfam04321, RmlD_sub_bind, RmlD substrate binding domain Back     alignment and domain information
>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200381 TIGR04130, FnlA, UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase Back     alignment and domain information
>gnl|CDD|187673 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD(P)H steroid dehydrogenase-like protein)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224013 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187545 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, subgroup 2, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187671 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD (hydroxysteroid dehydrogenase) and HSD3B1(delta 5-delta 4-isomerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187541 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|178298 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 358
KOG1431|consensus315 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 100.0
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 100.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 100.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein 100.0
PLN02166436 dTDP-glucose 4,6-dehydratase 100.0
PLN02695370 GDP-D-mannose-3',5'-epimerase 100.0
PLN02427386 UDP-apiose/xylose synthase 100.0
PLN02206442 UDP-glucuronate decarboxylase 100.0
PLN02572442 UDP-sulfoquinovose synthase 100.0
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 100.0
PLN02240352 UDP-glucose 4-epimerase 100.0
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 100.0
KOG1429|consensus350 100.0
KOG0747|consensus331 100.0
PLN02653340 GDP-mannose 4,6-dehydratase 100.0
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 100.0
PLN02260 668 probable rhamnose biosynthetic enzyme 100.0
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 100.0
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 100.0
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 100.0
PRK10675338 UDP-galactose-4-epimerase; Provisional 100.0
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 100.0
PLN02214342 cinnamoyl-CoA reductase 100.0
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 100.0
KOG1371|consensus343 100.0
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 100.0
PLN00198338 anthocyanidin reductase; Provisional 100.0
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 100.0
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 100.0
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 100.0
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 100.0
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 100.0
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 100.0
KOG1502|consensus327 100.0
PLN02896353 cinnamyl-alcohol dehydrogenase 100.0
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 100.0
PLN02650351 dihydroflavonol-4-reductase 100.0
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 100.0
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 100.0
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 100.0
PLN00016378 RNA-binding protein; Provisional 100.0
PLN02686367 cinnamoyl-CoA reductase 100.0
KOG1430|consensus361 100.0
PLN02778298 3,5-epimerase/4-reductase 100.0
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 100.0
CHL00194317 ycf39 Ycf39; Provisional 100.0
PRK07201 657 short chain dehydrogenase; Provisional 99.97
PLN02996491 fatty acyl-CoA reductase 99.97
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.97
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.97
PRK05865 854 hypothetical protein; Provisional 99.97
PLN02583297 cinnamoyl-CoA reductase 99.96
PLN02260668 probable rhamnose biosynthetic enzyme 99.96
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.96
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.96
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.96
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.95
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.95
PLN02503605 fatty acyl-CoA reductase 2 99.92
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.92
PRK12320 699 hypothetical protein; Provisional 99.91
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.91
KOG2774|consensus366 99.9
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.9
COG3320382 Putative dehydrogenase domain of multifunctional n 99.88
KOG1372|consensus376 99.88
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.86
PRK06482276 short chain dehydrogenase; Provisional 99.85
KOG2865|consensus391 99.84
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.84
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.83
KOG1221|consensus467 99.82
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.82
PRK09135249 pteridine reductase; Provisional 99.82
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.81
PLN03209 576 translocon at the inner envelope of chloroplast su 99.8
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.8
PRK06180277 short chain dehydrogenase; Provisional 99.8
PRK08263275 short chain dehydrogenase; Provisional 99.79
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.79
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.79
PRK05875276 short chain dehydrogenase; Provisional 99.78
PRK07775274 short chain dehydrogenase; Provisional 99.78
PRK06194287 hypothetical protein; Provisional 99.77
PRK12746254 short chain dehydrogenase; Provisional 99.76
PRK06914280 short chain dehydrogenase; Provisional 99.76
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.76
PRK07074257 short chain dehydrogenase; Provisional 99.76
PRK07067257 sorbitol dehydrogenase; Provisional 99.76
PRK07774250 short chain dehydrogenase; Provisional 99.76
PRK07806248 short chain dehydrogenase; Provisional 99.76
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.75
PRK06138252 short chain dehydrogenase; Provisional 99.74
PRK12829264 short chain dehydrogenase; Provisional 99.74
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.74
PRK06179270 short chain dehydrogenase; Provisional 99.74
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.74
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.74
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.73
PRK12827249 short chain dehydrogenase; Provisional 99.73
PRK12828239 short chain dehydrogenase; Provisional 99.72
PRK06182273 short chain dehydrogenase; Validated 99.71
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.71
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.71
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.71
PRK08264238 short chain dehydrogenase; Validated 99.71
PRK08219227 short chain dehydrogenase; Provisional 99.7
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.7
PRK09186256 flagellin modification protein A; Provisional 99.7
PRK06128300 oxidoreductase; Provisional 99.7
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.7
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.7
PRK07890258 short chain dehydrogenase; Provisional 99.69
PRK05876275 short chain dehydrogenase; Provisional 99.69
PRK12939250 short chain dehydrogenase; Provisional 99.69
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.68
PRK07060245 short chain dehydrogenase; Provisional 99.68
PRK09134258 short chain dehydrogenase; Provisional 99.68
PLN02253280 xanthoxin dehydrogenase 99.67
PRK06701290 short chain dehydrogenase; Provisional 99.67
PRK06123248 short chain dehydrogenase; Provisional 99.67
PRK06181263 short chain dehydrogenase; Provisional 99.67
PRK05993277 short chain dehydrogenase; Provisional 99.67
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.66
PRK06500249 short chain dehydrogenase; Provisional 99.65
PRK07577234 short chain dehydrogenase; Provisional 99.65
PRK05717255 oxidoreductase; Validated 99.65
PRK06398258 aldose dehydrogenase; Validated 99.65
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.65
PRK06841255 short chain dehydrogenase; Provisional 99.65
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.64
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.64
PRK07326237 short chain dehydrogenase; Provisional 99.64
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.64
PRK08628258 short chain dehydrogenase; Provisional 99.64
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.63
PRK06523260 short chain dehydrogenase; Provisional 99.63
PRK12747252 short chain dehydrogenase; Provisional 99.63
PRK12937245 short chain dehydrogenase; Provisional 99.63
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.62
PRK10538248 malonic semialdehyde reductase; Provisional 99.62
PRK08017256 oxidoreductase; Provisional 99.62
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.62
PRK08324681 short chain dehydrogenase; Validated 99.62
PRK09291257 short chain dehydrogenase; Provisional 99.62
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.61
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.61
PRK07024257 short chain dehydrogenase; Provisional 99.61
PRK07856252 short chain dehydrogenase; Provisional 99.61
PRK07985294 oxidoreductase; Provisional 99.61
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.6
PRK07454241 short chain dehydrogenase; Provisional 99.6
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.6
PRK06196315 oxidoreductase; Provisional 99.6
PRK05650270 short chain dehydrogenase; Provisional 99.59
PRK07069251 short chain dehydrogenase; Validated 99.59
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.59
PRK12743256 oxidoreductase; Provisional 99.59
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.58
PRK12744257 short chain dehydrogenase; Provisional 99.58
PRK12742237 oxidoreductase; Provisional 99.58
PRK07825273 short chain dehydrogenase; Provisional 99.58
PRK08643256 acetoin reductase; Validated 99.57
PRK07478254 short chain dehydrogenase; Provisional 99.57
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.57
PRK06198260 short chain dehydrogenase; Provisional 99.56
PRK06101240 short chain dehydrogenase; Provisional 99.56
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.56
PRK07109334 short chain dehydrogenase; Provisional 99.56
PRK08267260 short chain dehydrogenase; Provisional 99.56
PRK05693274 short chain dehydrogenase; Provisional 99.56
PRK09242257 tropinone reductase; Provisional 99.56
PRK07102243 short chain dehydrogenase; Provisional 99.55
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.55
PRK07814263 short chain dehydrogenase; Provisional 99.55
PRK07063260 short chain dehydrogenase; Provisional 99.55
PRK08265261 short chain dehydrogenase; Provisional 99.55
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.55
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.55
PRK07035252 short chain dehydrogenase; Provisional 99.55
PRK06197306 short chain dehydrogenase; Provisional 99.55
PRK07041230 short chain dehydrogenase; Provisional 99.54
PRK07023243 short chain dehydrogenase; Provisional 99.54
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.54
PRK06172253 short chain dehydrogenase; Provisional 99.54
PRK08277278 D-mannonate oxidoreductase; Provisional 99.54
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.53
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.52
PRK07904253 short chain dehydrogenase; Provisional 99.52
PRK05866293 short chain dehydrogenase; Provisional 99.51
PRK06114254 short chain dehydrogenase; Provisional 99.51
PRK06947248 glucose-1-dehydrogenase; Provisional 99.51
PRK06139330 short chain dehydrogenase; Provisional 99.51
PRK08226263 short chain dehydrogenase; Provisional 99.51
PRK08251248 short chain dehydrogenase; Provisional 99.51
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.5
PRK07576264 short chain dehydrogenase; Provisional 99.5
PRK06924251 short chain dehydrogenase; Provisional 99.5
PRK06057255 short chain dehydrogenase; Provisional 99.5
PRK05867253 short chain dehydrogenase; Provisional 99.5
PRK05854313 short chain dehydrogenase; Provisional 99.5
PRK06949258 short chain dehydrogenase; Provisional 99.49
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.48
PRK06953222 short chain dehydrogenase; Provisional 99.48
PRK08703239 short chain dehydrogenase; Provisional 99.48
PRK06483236 dihydromonapterin reductase; Provisional 99.47
PRK09072263 short chain dehydrogenase; Provisional 99.47
PRK07578199 short chain dehydrogenase; Provisional 99.47
COG2910211 Putative NADH-flavin reductase [General function p 99.47
PRK08339263 short chain dehydrogenase; Provisional 99.47
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.47
PRK08278273 short chain dehydrogenase; Provisional 99.46
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.46
PRK08589272 short chain dehydrogenase; Validated 99.45
PRK07831262 short chain dehydrogenase; Provisional 99.45
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.45
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.45
PRK05872296 short chain dehydrogenase; Provisional 99.44
PRK08177225 short chain dehydrogenase; Provisional 99.44
PRK08936261 glucose-1-dehydrogenase; Provisional 99.43
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.43
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.43
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.42
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.41
PRK07677252 short chain dehydrogenase; Provisional 99.41
PRK09009235 C factor cell-cell signaling protein; Provisional 99.4
PRK07832272 short chain dehydrogenase; Provisional 99.4
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.4
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.39
PRK06125259 short chain dehydrogenase; Provisional 99.39
PRK08340259 glucose-1-dehydrogenase; Provisional 99.39
PRK06484520 short chain dehydrogenase; Validated 99.39
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.38
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.38
PRK07062265 short chain dehydrogenase; Provisional 99.37
COG0300265 DltE Short-chain dehydrogenases of various substra 99.37
PRK07201657 short chain dehydrogenase; Provisional 99.37
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.37
PRK05855582 short chain dehydrogenase; Validated 99.36
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.36
KOG3019|consensus315 99.35
PRK05884223 short chain dehydrogenase; Provisional 99.33
PRK07791286 short chain dehydrogenase; Provisional 99.32
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.29
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.29
PLN02780320 ketoreductase/ oxidoreductase 99.28
PRK12367245 short chain dehydrogenase; Provisional 99.26
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.25
KOG4039|consensus238 99.24
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.24
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.22
KOG1203|consensus411 99.21
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.2
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.2
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.2
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.2
PRK06940275 short chain dehydrogenase; Provisional 99.19
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.19
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.19
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.19
PRK06484 520 short chain dehydrogenase; Validated 99.18
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.15
PLN00015308 protochlorophyllide reductase 99.15
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.14
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.14
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.1
PRK08303305 short chain dehydrogenase; Provisional 99.1
PRK05599246 hypothetical protein; Provisional 99.09
KOG4288|consensus283 99.08
KOG1205|consensus282 99.07
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.07
PRK08862227 short chain dehydrogenase; Provisional 99.0
COG1028251 FabG Dehydrogenases with different specificities ( 98.98
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 98.94
PTZ00325321 malate dehydrogenase; Provisional 98.9
KOG1208|consensus314 98.85
PLN02730303 enoyl-[acyl-carrier-protein] reductase 98.83
KOG1209|consensus289 98.76
KOG1201|consensus300 98.75
KOG1610|consensus322 98.75
PLN00106323 malate dehydrogenase 98.73
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 98.7
KOG0725|consensus270 98.68
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.66
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 98.65
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 98.64
KOG1200|consensus256 98.61
KOG1210|consensus331 98.54
KOG1611|consensus249 98.52
KOG4169|consensus261 98.41
PRK08309177 short chain dehydrogenase; Provisional 98.34
PF1395062 Epimerase_Csub: UDP-glucose 4-epimerase C-term sub 98.29
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 98.16
PRK09620229 hypothetical protein; Provisional 98.12
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 98.12
PRK06720169 hypothetical protein; Provisional 98.11
KOG1204|consensus253 98.08
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 98.02
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.9
PRK05086312 malate dehydrogenase; Provisional 97.85
KOG1478|consensus341 97.81
KOG1014|consensus312 97.77
KOG1207|consensus245 97.71
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 97.69
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 97.6
PRK06732229 phosphopantothenate--cysteine ligase; Validated 97.52
COG0623259 FabI Enoyl-[acyl-carrier-protein] 97.49
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.46
KOG1199|consensus260 97.45
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 97.44
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 97.33
KOG2733|consensus423 97.22
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 97.09
PRK05442326 malate dehydrogenase; Provisional 97.04
COG3268382 Uncharacterized conserved protein [Function unknow 96.86
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 96.85
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 96.83
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.81
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 96.81
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.79
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.72
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 96.72
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 96.69
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 96.64
PRK14982340 acyl-ACP reductase; Provisional 96.61
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 96.6
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.56
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 96.52
PRK00048257 dihydrodipicolinate reductase; Provisional 96.49
PRK08040336 putative semialdehyde dehydrogenase; Provisional 96.34
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 96.2
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 96.16
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 96.11
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 96.06
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 95.96
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 95.93
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 95.93
PLN02383344 aspartate semialdehyde dehydrogenase 95.9
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 95.85
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 95.82
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 95.72
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 95.71
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 95.59
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 95.58
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 95.55
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 95.48
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.39
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 95.3
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 95.3
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 95.27
PTZ00082321 L-lactate dehydrogenase; Provisional 95.19
KOG1494|consensus345 95.13
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.08
KOG4022|consensus236 95.08
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 95.07
PLN00112444 malate dehydrogenase (NADP); Provisional 95.07
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 95.07
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 95.02
cd01483143 E1_enzyme_family Superfamily of activating enzymes 95.0
KOG2018|consensus430 95.0
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 94.99
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 94.98
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 94.95
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 94.95
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.64
COG4982866 3-oxoacyl-[acyl-carrier protein] 94.55
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 94.47
PLN02602350 lactate dehydrogenase 94.44
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 94.41
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 94.39
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 94.39
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 94.29
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 94.26
PRK08223287 hypothetical protein; Validated 94.2
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 94.19
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 94.15
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 94.13
PRK06223307 malate dehydrogenase; Reviewed 94.11
PRK06849389 hypothetical protein; Provisional 94.06
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 94.05
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 94.0
PRK09496453 trkA potassium transporter peripheral membrane com 93.97
PRK08328231 hypothetical protein; Provisional 93.94
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 93.91
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 93.79
PRK09496453 trkA potassium transporter peripheral membrane com 93.7
PTZ00117319 malate dehydrogenase; Provisional 93.7
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 93.61
PLN02775286 Probable dihydrodipicolinate reductase 93.54
PRK15116268 sulfur acceptor protein CsdL; Provisional 93.45
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 93.32
PRK07877 722 hypothetical protein; Provisional 93.3
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 93.11
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 93.02
TIGR00036266 dapB dihydrodipicolinate reductase. 92.72
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 92.72
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 92.71
PF08732410 HIM1: HIM1; InterPro: IPR014843 HIM1 (high inducti 92.62
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2 92.52
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.43
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 92.42
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 92.41
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 92.31
PRK05600370 thiamine biosynthesis protein ThiF; Validated 92.01
PRK14852 989 hypothetical protein; Provisional 91.96
TIGR00877423 purD phosphoribosylamine--glycine ligase. This enz 91.93
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 91.91
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 91.87
PRK12548289 shikimate 5-dehydrogenase; Provisional 91.86
PF1008797 DUF2325: Uncharacterized protein conserved in bact 91.78
PRK08300302 acetaldehyde dehydrogenase; Validated 91.77
KOG1202|consensus 2376 91.74
PRK14851 679 hypothetical protein; Provisional 91.74
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 91.69
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 91.69
PLN00125300 Succinyl-CoA ligase [GDP-forming] subunit alpha 91.46
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 91.32
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 91.24
KOG1198|consensus347 91.09
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 90.99
KOG1496|consensus332 90.97
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 90.95
PRK13303265 L-aspartate dehydrogenase; Provisional 90.87
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 90.8
PRK08818370 prephenate dehydrogenase; Provisional 90.62
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 90.57
PRK07411390 hypothetical protein; Validated 90.43
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 90.22
TIGR01142380 purT phosphoribosylglycinamide formyltransferase 2 90.2
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 90.0
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 89.96
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 89.79
PRK13301267 putative L-aspartate dehydrogenase; Provisional 89.78
COG0027394 PurT Formate-dependent phosphoribosylglycinamide f 89.75
PRK05447385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 89.57
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 89.43
PRK04148134 hypothetical protein; Provisional 89.35
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 89.28
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 89.05
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 89.05
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.9
PRK06444197 prephenate dehydrogenase; Provisional 88.86
PRK12767326 carbamoyl phosphate synthase-like protein; Provisi 88.51
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 88.35
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 88.08
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 88.02
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 87.94
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.87
COG2085211 Predicted dinucleotide-binding enzymes [General fu 87.45
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 87.29
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 87.19
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 87.15
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 87.12
PRK08462445 biotin carboxylase; Validated 86.96
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 86.71
TIGR00243389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 86.29
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 86.28
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.18
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 85.34
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 85.33
PRK13302271 putative L-aspartate dehydrogenase; Provisional 85.01
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 85.0
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 84.97
PRK08591451 acetyl-CoA carboxylase biotin carboxylase subunit; 84.74
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 84.38
PRK13197215 pyrrolidone-carboxylate peptidase; Provisional 84.31
PRK10537393 voltage-gated potassium channel; Provisional 84.25
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 84.12
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 83.99
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.92
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 83.86
PRK13304265 L-aspartate dehydrogenase; Reviewed 83.34
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 83.24
TIGR00514449 accC acetyl-CoA carboxylase, biotin carboxylase su 83.18
PF00289110 CPSase_L_chain: Carbamoyl-phosphate synthase L cha 83.09
PRK10669558 putative cation:proton antiport protein; Provision 83.09
PRK06111450 acetyl-CoA carboxylase biotin carboxylase subunit; 82.85
COG2130340 Putative NADP-dependent oxidoreductases [General f 82.83
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 82.44
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.38
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 82.33
PRK03659601 glutathione-regulated potassium-efflux system prot 81.89
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 81.79
PRK12833467 acetyl-CoA carboxylase biotin carboxylase subunit; 81.66
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 81.61
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 81.61
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 81.56
PRK07178472 pyruvate carboxylase subunit A; Validated 81.05
PRK13195222 pyrrolidone-carboxylate peptidase; Provisional 80.53
PRK08306296 dipicolinate synthase subunit A; Reviewed 80.47
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 80.09
>KOG1431|consensus Back     alignment and domain information
Probab=100.00  E-value=3.7e-48  Score=333.15  Aligned_cols=310  Identities=65%  Similarity=1.051  Sum_probs=288.8

Q ss_pred             CCEEEEEcCCChhHHHHHHHHHHccccCCCCceeeecccccCCCHHHHHHHHhccCCcEEEEcccccCCccccccchhhH
Q psy7590           4 EKIILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHLAAMVGGLFHNMSHNLDF   83 (358)
Q Consensus         4 ~~~VlItGatG~lG~~l~~~L~~~g~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~d~Vih~a~~~~~~~~~~~~~~~~   83 (358)
                      ||||||||++|.+|++|.+.+.+++. ...+|.++....+||++.++.+++|+..+|.+|||+|+.+++..++...+.++
T Consensus         1 s~kIlVtGg~GLVGsAi~~vv~~q~~-~~e~wvf~~skd~DLt~~a~t~~lF~~ekPthVIhlAAmVGGlf~N~~ynldF   79 (315)
T KOG1431|consen    1 SKKILVTGGTGLVGSAIVKVVQEQGF-DDENWVFIGSKDADLTNLADTRALFESEKPTHVIHLAAMVGGLFHNNTYNLDF   79 (315)
T ss_pred             CceEEEecCCchHHHHHHHHHHhcCC-CCcceEEeccccccccchHHHHHHHhccCCceeeehHhhhcchhhcCCCchHH
Confidence            46899999999999999999999987 77889999999999999999999999999999999999999988999999999


Q ss_pred             HHHHHHHHHHHHHHHHhcCCCEEEEeeccceecCCCCCCCccccccCCCCCCCCcchHHHHHHHHHHHHHHHhhcCceEE
Q psy7590          84 FRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYT  163 (358)
Q Consensus        84 ~~~nv~~~~~ll~aa~~~~v~r~V~~SS~~vy~~~~~~~~~E~~~~~~~~~p~~~~Y~~sK~~~E~~~~~~~~~~g~~~~  163 (358)
                      ++.|+....|++..|.+.|++++|++.|+++|++..+.|++|+..+.+|++|++..|+.+|++..-..+.|..++|.+++
T Consensus        80 ~r~Nl~indNVlhsa~e~gv~K~vsclStCIfPdkt~yPIdEtmvh~gpphpsN~gYsyAKr~idv~n~aY~~qhg~~~t  159 (315)
T KOG1431|consen   80 IRKNLQINDNVLHSAHEHGVKKVVSCLSTCIFPDKTSYPIDETMVHNGPPHPSNFGYSYAKRMIDVQNQAYRQQHGRDYT  159 (315)
T ss_pred             HhhcceechhHHHHHHHhchhhhhhhcceeecCCCCCCCCCHHHhccCCCCCCchHHHHHHHHHHHHHHHHHHHhCCcee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEecCcccCCCCCCCCCcccchhHHHHHHHHhhhhcCccchhhcccCCCCCCCCCCCCccCCCcccCCccccCCCc-eEE
Q psy7590         164 SVIPCNVFGPHDNYNLESSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGD-EFK  242 (358)
Q Consensus       164 ilRp~~v~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~-~~~  242 (358)
                      ++.|+++|||.++++++.++++|.++.++-.+...                                       |. ++.
T Consensus       160 sviPtNvfGphDNfnpe~sHVlPali~r~h~ak~~---------------------------------------gtd~~~  200 (315)
T KOG1431|consen  160 SVIPTNVFGPHDNFNPENSHVLPALIHRFHEAKRN---------------------------------------GTDELT  200 (315)
T ss_pred             eeccccccCCCCCCCcccccchHHHHHHHHHHHhc---------------------------------------CCceEE
Confidence            99999999999999999999999999999877665                                       44 899


Q ss_pred             EcCCCCceeeeeeHHHHHHHHHHHHHhcCCCCCceEEccCCC--cccHHHHHHHHHHHhCCCcceeecCCCCCCcccccc
Q psy7590         243 VLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKD--EVTIAEVAEAIANAFQFKGRITFDTNAADGQLKKTA  320 (358)
Q Consensus       243 ~~~~~~~~~~~i~v~D~a~~~~~~~~~~~~~~~~v~n~~~~~--~~s~~ei~~~i~~~~g~~~~i~~~~~~~~~~~~~~~  320 (358)
                      ++|.|.+.|+|+|++|+|+++++++++....+.  ++++.++  .+|++|+++++.++++...++.+...+.+.......
T Consensus       201 VwGsG~PlRqFiys~DLA~l~i~vlr~Y~~vEp--iils~ge~~EVtI~e~aeaV~ea~~F~G~l~~DttK~DGq~kKta  278 (315)
T KOG1431|consen  201 VWGSGSPLRQFIYSDDLADLFIWVLREYEGVEP--IILSVGESDEVTIREAAEAVVEAVDFTGKLVWDTTKSDGQFKKTA  278 (315)
T ss_pred             EecCCChHHHHhhHhHHHHHHHHHHHhhcCccc--eEeccCccceeEHHHHHHHHHHHhCCCceEEeeccCCCCCccccc
Confidence            999999999999999999999999999877776  5566655  899999999999999999999999888888889999


Q ss_pred             chHHHHhhhCCCCc--cccHHHHHHHHHHHHHHhhccccC
Q psy7590         321 SNRKLRELRGPGFE--FTPFQQAVQESVAWFRENHSVARL  358 (358)
Q Consensus       321 ~~~k~~~~l~~G~~--~~~~~~~l~~~~~~~~~~~~~~~~  358 (358)
                      |++|++.+   +|.  .+++++++.++++||.++.+.+|+
T Consensus       279 snsKL~sl---~pd~~ft~l~~ai~~t~~Wy~~Ny~qark  315 (315)
T KOG1431|consen  279 SNSKLRSL---LPDFKFTPLEQAISETVQWYLDNYEQARK  315 (315)
T ss_pred             chHHHHHh---CCCcccChHHHHHHHHHHHHHHhHHhhcC
Confidence            99999997   565  568999999999999998876653



>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>KOG2774|consensus Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG3019|consensus Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>KOG4039|consensus Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>KOG4288|consensus Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>KOG2733|consensus Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG1494|consensus Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>KOG2018|consensus Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PF08732 HIM1: HIM1; InterPro: IPR014843 HIM1 (high induction of mutagenesis protein 1) plays a role in the control of spontaneous and induced mutagenesis [] Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PLN00125 Succinyl-CoA ligase [GDP-forming] subunit alpha Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>KOG1496|consensus Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK13197 pyrrolidone-carboxylate peptidase; Provisional Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK13195 pyrrolidone-carboxylate peptidase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
4b8z_A320 Crystal Structure Of Human Gdp-l-fucose Synthase Wi 1e-107
4b8w_A319 Crystal Structure Of Human Gdp-L-Fucose Synthase Wi 1e-107
1e6u_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Le 1e-27
1e7q_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase S1 3e-27
1bsv_A321 Gdp-Fucose Synthetase From Escherichia Coli Complex 5e-27
1bws_A321 Crystal Structure Of Gdp-4-Keto-6-Deoxy-D-Mannose E 6e-27
1e7s_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase K1 8e-27
1e7r_A321 Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Y1 4e-26
1i3k_A348 Molecular Basis For Severe Epimerase-Deficiency Gal 1e-05
1ek5_A348 Structure Of Human Udp-Galactose 4-Epimerase In Com 2e-05
1hzj_A348 Human Udp-Galactose 4-Epimerase: Accommodation Of U 2e-05
2p5u_A311 Crystal Structure Of Thermus Thermophilus Hb8 Udp-G 2e-05
>pdb|4B8Z|A Chain A, Crystal Structure Of Human Gdp-l-fucose Synthase With Bound Nadp And Gdp, Rhombohedral Crystal Form Length = 320 Back     alignment and structure

Iteration: 1

Score = 383 bits (983), Expect = e-107, Method: Compositional matrix adjust. Identities = 190/351 (54%), Positives = 231/351 (65%), Gaps = 40/351 (11%) Query: 7 ILVTGGTGLVGXXXXXXXXXXXXRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHL 66 ILVTGG+GLVG E W+FVSSK+ADL++ T+ LF K +PTHVIHL Sbjct: 10 ILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHL 69 Query: 67 AAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDET 126 AAMVGGLF N+ +NLDF+R N+ +NDNVL ++++ G +KVVSCLSTCIFPDKTTYPIDET Sbjct: 70 AAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDET 129 Query: 127 MVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIP 186 M+HNGPPH SNFGYS+AKRM+DV N+AY+QQ+G T+T+VIP NVFGPHDN+N+E HV+P Sbjct: 130 MIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLP 189 Query: 187 GLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVLGT 246 GLI K++ + G V GT Sbjct: 190 GLIHKVH---------------------------------------LAKSSGSALTVWGT 210 Query: 247 GKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDXXXXXXXXXXXXXXFQFKGRIT 306 G P RQFIYSLDLA+LFIWVLREY+ VEPIILSV E+D F G +T Sbjct: 211 GNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVT 270 Query: 307 FDTNAADGQLKKTASNRKLRELRGPGFEFTPFQQAVQESVAWFRENHSVAR 357 FDT +DGQ KKTASN KLR P F FTPF+QAV+E+ AWF +N+ AR Sbjct: 271 FDTTKSDGQFKKTASNSKLRTYL-PDFRFTPFKQAVKETCAWFTDNYEQAR 320
>pdb|4B8W|A Chain A, Crystal Structure Of Human Gdp-L-Fucose Synthase With Bound Nadp And Gdp, Tetragonal Crystal Form Length = 319 Back     alignment and structure
>pdb|1E6U|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Length = 321 Back     alignment and structure
>pdb|1E7Q|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase S107a Length = 321 Back     alignment and structure
>pdb|1BSV|A Chain A, Gdp-Fucose Synthetase From Escherichia Coli Complex With Nadph Length = 321 Back     alignment and structure
>pdb|1BWS|A Chain A, Crystal Structure Of Gdp-4-Keto-6-Deoxy-D-Mannose EpimeraseREDUCTASE From Escherichia Coli A Key Enzyme In The Biosynthesis Of Gdp-L- Fucose Length = 321 Back     alignment and structure
>pdb|1E7S|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase K140r Length = 321 Back     alignment and structure
>pdb|1E7R|A Chain A, Gdp 4-Keto-6-Deoxy-D-Mannose Epimerase Reductase Y136e Length = 321 Back     alignment and structure
>pdb|1I3K|A Chain A, Molecular Basis For Severe Epimerase-Deficiency Galactosemia: X-Ray Structure Of The Human V94m- Substituted Udp-Galactose 4-Epimerase Length = 348 Back     alignment and structure
>pdb|1EK5|A Chain A, Structure Of Human Udp-Galactose 4-Epimerase In Complex With Nad+ Length = 348 Back     alignment and structure
>pdb|1HZJ|A Chain A, Human Udp-Galactose 4-Epimerase: Accommodation Of Udp-N- Acetylglucosamine Within The Active Site Length = 348 Back     alignment and structure
>pdb|2P5U|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8 Udp-Glucose 4- Epimerase Complex With Nad Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 3e-80
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 5e-39
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 2e-24
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 3e-23
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 6e-23
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 6e-22
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 4e-19
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 1e-18
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 2e-18
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 5e-18
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 1e-17
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 9e-17
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 3e-15
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 7e-15
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 8e-15
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 9e-15
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 9e-15
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 1e-14
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 3e-13
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 6e-13
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 1e-12
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 2e-12
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 3e-12
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 2e-10
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 8e-10
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 7e-09
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 1e-08
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 2e-08
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 2e-08
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 3e-08
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 5e-08
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 1e-07
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 4e-07
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 4e-07
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 1e-06
3slg_A372 PBGP3 protein; structural genomics, seattle struct 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 3e-06
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 3e-06
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 2e-05
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 3e-05
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 4e-05
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 8e-05
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 1e-04
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 1e-04
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 2e-04
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 2e-04
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 3e-04
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 5e-04
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Length = 321 Back     alignment and structure
 Score =  247 bits (632), Expect = 3e-80
 Identities = 95/365 (26%), Positives = 164/365 (44%), Gaps = 53/365 (14%)

Query: 1   MAEEKIILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKP 60
           MA++++  + G  G+VG AI    ++ E+R D   +  +  E +L +  +    F+  + 
Sbjct: 1   MAKQRV-FIAGHRGMVGSAI---RRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERI 56

Query: 61  THVIHLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTT 120
             V   AA VGG+  N ++  DF   NM I  N++  +++  V K++   S+CI+P    
Sbjct: 57  DQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAK 116

Query: 121 YPIDETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLE 180
            P+ E+ +  G   P+N  Y+ AK     L ++Y +Q+G  Y SV+P N++GPHDN++  
Sbjct: 117 QPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPS 176

Query: 181 SSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDE 240
           +SHVIP L+R+ ++   +                                         +
Sbjct: 177 NSHVIPALLRRFHEATAQKA--------------------------------------PD 198

Query: 241 FKVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEK-------DEVTIAEVAE 293
             V G+G P+R+F++  D+A   I V+     V                  + TI E+A+
Sbjct: 199 VVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQ 258

Query: 294 AIANAFQFKGRITFDTNAADGQLKKTASNRKLRELRGPGFEF-TPFQQAVQESVAWFREN 352
            IA    +KGR+ FD +  DG  +K     +L +L   G+      +  +  +  WF EN
Sbjct: 259 TIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQL---GWYHEISLEAGLASTYQWFLEN 315

Query: 353 HSVAR 357
               R
Sbjct: 316 QDRFR 320


>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Length = 379 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} Length = 313 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Length = 377 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} PDB: 3icp_A* 3aw9_A* Length = 312 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Length = 310 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Length = 321 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Length = 369 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Length = 292 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} Length = 287 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Length = 315 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Length = 273 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Length = 343 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Length = 330 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} Length = 341 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Length = 344 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Length = 345 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Length = 338 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Length = 372 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Length = 699 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Length = 299 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Length = 348 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Length = 397 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Length = 347 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Length = 361 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Length = 660 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Length = 224 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 100.0
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 100.0
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 100.0
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 100.0
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 100.0
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 100.0
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 100.0
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 100.0
3slg_A372 PBGP3 protein; structural genomics, seattle struct 100.0
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 100.0
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 100.0
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 100.0
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 100.0
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 100.0
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 100.0
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 100.0
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 100.0
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 100.0
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 100.0
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 100.0
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 100.0
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 100.0
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 100.0
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 100.0
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 100.0
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 100.0
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 100.0
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 100.0
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 100.0
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 100.0
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 100.0
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 100.0
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 100.0
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 100.0
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 100.0
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 100.0
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 100.0
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 100.0
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 100.0
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 100.0
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 100.0
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 100.0
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 100.0
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 100.0
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 100.0
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 100.0
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 100.0
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 100.0
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 100.0
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 100.0
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 100.0
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 100.0
3ius_A286 Uncharacterized conserved protein; APC63810, silic 100.0
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 100.0
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 100.0
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 100.0
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 100.0
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 100.0
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 100.0
4f6c_A427 AUSA reductase domain protein; thioester reductase 100.0
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 100.0
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.98
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.98
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.98
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.98
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.97
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.97
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.97
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.97
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.97
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.96
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.96
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.95
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.95
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.94
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.94
1xq6_A253 Unknown protein; structural genomics, protein stru 99.94
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.94
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.94
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.93
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.93
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.93
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.93
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.92
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.92
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.92
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.9
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.89
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.89
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.88
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.87
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.87
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.85
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.85
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.84
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.84
1spx_A278 Short-chain reductase family member (5L265); paral 99.84
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.83
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.83
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.83
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.83
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.83
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.82
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.82
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.82
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.82
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.82
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.81
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.81
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.81
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.81
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.81
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.81
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.81
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.8
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.8
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.8
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.8
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.8
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.8
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.8
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.79
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.79
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.79
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.79
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.79
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.79
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.79
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.79
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.79
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.79
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.79
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.79
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.79
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.79
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.78
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.78
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.78
4e4y_A244 Short chain dehydrogenase family protein; structur 99.78
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.78
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.78
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.78
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.78
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.78
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.78
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.78
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.78
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.78
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.78
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.77
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.77
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.77
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.77
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.77
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.77
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.77
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.77
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.77
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.77
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.77
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.77
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.77
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.76
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.76
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.76
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.76
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.76
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.76
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.76
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.76
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.76
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.76
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.76
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.76
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.76
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.76
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.75
3rih_A293 Short chain dehydrogenase or reductase; structural 99.75
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.75
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.75
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.75
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.75
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.75
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.75
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.75
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.75
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.75
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.75
1xkq_A280 Short-chain reductase family member (5D234); parra 99.74
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.74
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.74
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.74
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.74
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.74
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.74
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.74
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.74
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.74
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.74
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.74
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.74
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.74
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.74
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.74
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.73
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.73
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.73
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.73
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.73
3cxt_A291 Dehydrogenase with different specificities; rossma 99.73
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.73
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.73
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.73
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.73
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.73
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.73
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.72
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.72
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.72
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.72
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.72
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.72
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.72
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.72
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.72
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.72
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.71
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.71
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.71
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.71
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.71
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.71
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.71
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.71
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.71
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.71
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.71
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.7
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.7
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.7
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.7
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 99.7
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.7
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.7
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.7
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.69
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.69
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.69
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.69
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.69
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.69
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.68
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.68
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.68
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.68
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.68
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.68
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.68
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.68
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.67
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.67
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.67
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.67
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.67
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.67
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.67
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.66
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.66
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.65
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.65
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.65
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.64
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.64
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.63
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.63
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.62
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.61
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.6
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.6
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.59
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.59
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.58
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.58
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.58
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.56
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.55
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.54
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.52
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.51
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.48
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.48
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.47
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.45
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.43
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.41
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.41
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.4
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.37
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.36
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.35
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.33
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.3
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.3
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.26
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.92
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 98.9
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 98.89
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 98.86
3slk_A795 Polyketide synthase extender module 2; rossmann fo 98.85
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 98.81
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 98.68
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.67
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 98.64
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 98.63
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 98.62
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.61
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 98.59
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 98.58
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 98.35
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.13
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 97.98
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 97.96
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 97.92
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 97.89
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.87
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 97.86
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 97.84
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.73
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.61
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 97.59
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 97.47
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 97.45
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.31
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.26
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.16
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.13
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.12
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 97.1
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 97.06
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 97.04
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 96.94
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 96.83
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 96.76
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.63
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.59
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 96.46
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 96.45
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 96.33
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.28
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 96.25
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 96.22
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 96.22
3tl2_A315 Malate dehydrogenase; center for structural genomi 96.18
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.16
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 96.16
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 96.08
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 96.05
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 96.04
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.0
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.93
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 95.9
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 95.9
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 95.69
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 95.61
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 95.6
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 95.6
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 95.56
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 95.53
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 95.49
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 95.43
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 95.35
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 95.34
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.3
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 95.13
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 95.06
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 95.03
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 95.03
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 95.02
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 94.89
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 94.8
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 94.7
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 94.58
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 94.55
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 94.55
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 94.44
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 94.42
4dim_A403 Phosphoribosylglycinamide synthetase; structural g 94.41
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 94.31
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 94.14
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 93.81
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 93.75
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 93.74
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 93.71
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 93.67
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 93.65
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 93.53
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 93.24
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 93.23
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 93.18
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 93.01
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 92.99
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 92.87
4g65_A461 TRK system potassium uptake protein TRKA; structur 92.54
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 92.48
2d59_A144 Hypothetical protein PH1109; COA binding, structur 92.41
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 92.4
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 92.33
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 92.26
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 92.25
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 92.24
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 92.05
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 92.05
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 91.93
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 91.85
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 91.85
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 91.83
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 91.79
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 91.78
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 91.61
1lnq_A336 MTHK channels, potassium channel related protein; 91.6
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 91.58
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 91.57
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 91.51
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 91.48
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 91.26
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 91.21
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 91.15
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 91.11
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 91.03
1iuk_A140 Hypothetical protein TT1466; structural genomics, 90.93
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 90.87
2duw_A145 Putative COA-binding protein; ligand binding prote 90.85
2dwc_A433 PH0318, 433AA long hypothetical phosphoribosylglyc 90.83
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 90.83
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 90.78
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 90.72
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 90.59
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 90.45
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 90.42
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 90.3
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 90.17
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 90.14
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 90.14
3ouz_A446 Biotin carboxylase; structural genomics, center fo 90.1
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 90.09
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 90.04
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 89.96
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 89.88
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 89.84
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 89.76
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 89.29
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 89.1
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 89.07
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 89.04
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 88.95
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 88.6
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 88.6
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 88.12
4eye_A342 Probable oxidoreductase; structural genomics, niai 88.03
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 88.03
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 87.99
3gms_A340 Putative NADPH:quinone reductase; structural genom 87.95
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 87.9
3qha_A296 Putative oxidoreductase; seattle structural genomi 87.89
3euw_A344 MYO-inositol dehydrogenase; protein structure init 87.87
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 87.85
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 87.58
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 87.52
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 87.42
1yb4_A295 Tartronic semialdehyde reductase; structural genom 87.4
2w70_A449 Biotin carboxylase; ligase, ATP-binding, fatty aci 87.35
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 87.2
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 87.15
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 87.1
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 86.73
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 86.49
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 86.44
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 86.25
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 86.21
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 86.19
3au8_A488 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 86.04
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 85.93
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 85.92
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 85.65
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 85.57
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 85.53
4gx0_A565 TRKA domain protein; membrane protein, ION channel 85.48
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 85.31
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 85.07
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 85.04
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 84.89
3l6d_A306 Putative oxidoreductase; structural genomics, prot 84.82
1ydw_A362 AX110P-like protein; structural genomics, protein 84.76
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 84.65
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 84.6
3p2o_A285 Bifunctional protein fold; structural genomics, ce 84.52
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 84.51
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 84.41
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 84.4
3ro0_A223 Pyrrolidone-carboxylate peptidase; hydrolase-hydro 84.11
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2e-50  Score=377.87  Aligned_cols=315  Identities=63%  Similarity=1.026  Sum_probs=277.5

Q ss_pred             CCCCEEEEEcCCChhHHHHHHHHHHccccCCCCceeeecccccCCCHHHHHHHHhccCCcEEEEcccccCCccccccchh
Q psy7590           2 AEEKIILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVIHLAAMVGGLFHNMSHNL   81 (358)
Q Consensus         2 ~~~~~VlItGatG~lG~~l~~~L~~~g~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~d~Vih~a~~~~~~~~~~~~~~   81 (358)
                      |+||+|||||||||||++|+++|+++|++.......++.+.+|++|++++.+++++.++|+|||+|+..+.......++.
T Consensus         4 ~~~~~vlVtGatG~iG~~l~~~L~~~g~~~~~~~~~~~~~~~D~~d~~~~~~~~~~~~~d~Vih~A~~~~~~~~~~~~~~   83 (319)
T 4b8w_A            4 FQSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNL   83 (319)
T ss_dssp             CCCCEEEEETCSSHHHHHHHHHHHTTTCCTTCEEEECCTTTCCTTSHHHHHHHHHHSCCSEEEECCCCCCCHHHHTTCHH
T ss_pred             ccCCeEEEECCCcHHHHHHHHHHHhcCCcccccccccCceecccCCHHHHHHHHhhcCCCEEEECceecccccccccCHH
Confidence            45689999999999999999999999986556667778889999999999999997779999999998653334557788


Q ss_pred             hHHHHHHHHHHHHHHHHHhcCCCEEEEeeccceecCCCCCCCccccccCCCCCCCCcchHHHHHHHHHHHHHHHhhcCce
Q psy7590          82 DFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVT  161 (358)
Q Consensus        82 ~~~~~nv~~~~~ll~aa~~~~v~r~V~~SS~~vy~~~~~~~~~E~~~~~~~~~p~~~~Y~~sK~~~E~~~~~~~~~~g~~  161 (358)
                      ..+++|+.++.+|+++|++.++++|||+||.++|+.....+++|+++...++.|.+.+|+.+|+.+|++++.+++..+++
T Consensus        84 ~~~~~nv~gt~~ll~a~~~~~~~~~v~~SS~~vyg~~~~~~~~E~~~~~~~~~p~~~~Y~~sK~~~E~~~~~~~~~~~~~  163 (319)
T 4b8w_A           84 DFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCT  163 (319)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTCSEEEEECCGGGSCSSCCSSBCGGGGGBSCCCSSSHHHHHHHHHHHHHHHHHHHHHCCE
T ss_pred             HHHHHHHHHHHHHHHHHHHcCCCeEEEEcchhhcCCCCCCCccccccccCCCCCCcchHHHHHHHHHHHHHHHHHhhCCC
Confidence            89999999999999999999999999999999999887889999986655666766469999999999999999989999


Q ss_pred             EEEEecCcccCCCCCCCCCcccchhHHHHHHHHhhhhcCccchhhcccCCCCCCCCCCCCccCCCcccCCccccCCCceE
Q psy7590         162 YTSVIPCNVFGPHDNYNLESSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEF  241 (358)
Q Consensus       162 ~~ilRp~~v~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~  241 (358)
                      ++++||+++|||...+....+.+++.++..++.....                                       |.++
T Consensus       164 ~~ilRp~~v~Gp~~~~~~~~~~~~~~~~~~~~~~~~~---------------------------------------~~~~  204 (319)
T 4b8w_A          164 FTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSS---------------------------------------GSAL  204 (319)
T ss_dssp             EEEEEECEEECTTCCCCTTTSCHHHHHHHHHHHHHHH---------------------------------------TCCE
T ss_pred             EEEEeeccccCCCCCCCCccccccHHHHHHHHHHhcc---------------------------------------CCce
Confidence            9999999999999876666667888888887766676                                       8899


Q ss_pred             EEcCCCCceeeeeeHHHHHHHHHHHHHhcCCCCCceEEccCCCcccHHHHHHHHHHHhCCCcceeecCCCCCCccccccc
Q psy7590         242 KVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQFKGRITFDTNAADGQLKKTAS  321 (358)
Q Consensus       242 ~~~~~~~~~~~~i~v~D~a~~~~~~~~~~~~~~~~v~n~~~~~~~s~~ei~~~i~~~~g~~~~i~~~~~~~~~~~~~~~~  321 (358)
                      .+++++.+.++|+|++|+|++++.+++++....+++||+++++.+|+.|+++.+.+.+|.+.++...+.+........+|
T Consensus       205 ~~~~~g~~~~~~i~v~Dva~a~~~~~~~~~~~~~~~~ni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~~~~~~~~~d  284 (319)
T 4b8w_A          205 TVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTAS  284 (319)
T ss_dssp             EEESCSCCEECEEEHHHHHHHHHHHHHHCCCSSCEEECCCGGGCEEHHHHHHHHHHHTTCCSCEEEETTSCCCCSCCCBC
T ss_pred             EEeCCCCeeEEEEeHHHHHHHHHHHHhccccCCceEEEecCCCceeHHHHHHHHHHHhCCCCcEEeCCCCCcCcccccCC
Confidence            99999999999999999999999999986655567999999999999999999999999998888877666556667899


Q ss_pred             hHHHHhhhCCCCccc-cHHHHHHHHHHHHHHhhcccc
Q psy7590         322 NRKLRELRGPGFEFT-PFQQAVQESVAWFRENHSVAR  357 (358)
Q Consensus       322 ~~k~~~~l~~G~~~~-~~~~~l~~~~~~~~~~~~~~~  357 (358)
                      ++|++++|  ||.|. +++++|+++++|++++.+.+|
T Consensus       285 ~~k~~~~l--g~~p~~~~~~~l~~~~~~~~~~~~~~r  319 (319)
T 4b8w_A          285 NSKLRTYL--PDFRFTPFKQAVKETCAWFTDNYEQAR  319 (319)
T ss_dssp             CHHHHHHC--TTCCCCCHHHHHHHHHHHHHHSCSSCC
T ss_pred             HHHHHHhc--CCCCCCCHHHHHHHHHHHHHHHHhhcC
Confidence            99999999  99964 999999999999999887664



>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3au8_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH binding; HET: NDP; 1.86A {Plasmodium falciparum} PDB: 3au9_A* 3aua_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3ro0_A Pyrrolidone-carboxylate peptidase; hydrolase-hydrolase inhibitor complex; HET: TPT; 1.50A {Bacillus amyloliquefaciens} SCOP: c.56.4.1 PDB: 3rnz_A* 1aug_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 358
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 6e-56
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 2e-41
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 2e-35
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 6e-33
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 9e-27
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 3e-25
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 4e-25
d1z45a2347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 9e-23
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 4e-19
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 4e-19
d1gy8a_383 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 2e-17
d1ek6a_346 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 2e-17
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 2e-16
d1orra_338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 2e-14
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 2e-13
d1n7ha_339 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr 8e-11
d1vl0a_281 c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD 3e-09
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 2e-08
d1n2sa_298 c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reduct 3e-08
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 5e-08
d2blla1342 c.2.1.2 (A:316-657) Polymyxin resistance protein A 1e-06
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 4e-06
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 7e-06
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 1e-05
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 2e-05
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 2e-05
d1rkxa_356 c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia 3e-05
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 4e-05
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 6e-05
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 9e-05
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 2e-04
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-04
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 2e-04
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 3e-04
d2a35a1212 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pse 4e-04
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 5e-04
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 6e-04
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 6e-04
d1i24a_393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 6e-04
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 7e-04
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 8e-04
d1qyca_307 c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta 9e-04
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 9e-04
d1qyda_312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 9e-04
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 0.001
d2bkaa1232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 0.001
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 0.001
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 0.002
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 0.002
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 0.002
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 0.002
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 0.003
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 0.004
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 0.004
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase)
species: Escherichia coli [TaxId: 562]
 Score =  183 bits (464), Expect = 6e-56
 Identities = 91/356 (25%), Positives = 156/356 (43%), Gaps = 52/356 (14%)

Query: 5   KIILVTGGTGLVGKAIEKIVKEEEKRDDETWIFVSSKEADLSNLESTQQLFSKYKPTHVI 64
           + + + G  G+VG AI    ++ E+R D   +  +  E +L +  +    F+  +   V 
Sbjct: 3   QRVFIAGHRGMVGSAI---RRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVY 59

Query: 65  HLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPID 124
             AA VGG+  N ++  DF   NM I  N++  +++  V K++   S+CI+P     P+ 
Sbjct: 60  LAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMA 119

Query: 125 ETMVHNGPPHPSNFGYSHAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHV 184
           E+ +  G   P+N  Y+ AK     L ++Y +Q+G  Y SV+P N++GPHDN++  +SHV
Sbjct: 120 ESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHV 179

Query: 185 IPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLDKLDLIPFSLFPFCFTGGDEFKVL 244
           IP                                       +             +  V 
Sbjct: 180 IPA--------------------------------------LLRRFHEATAQKAPDVVVW 201

Query: 245 GTGKPLRQFIYSLDLARLFIWVLREYDSVEPI-------ILSVDEKDEVTIAEVAEAIAN 297
           G+G P+R+F++  D+A   I V+     V           ++V    + TI E+A+ IA 
Sbjct: 202 GSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAK 261

Query: 298 AFQFKGRITFDTNAADGQLKKTASNRKLRELRGPGFE-FTPFQQAVQESVAWFREN 352
              +KGR+ FD +  DG  +K     +L +L   G+      +  +  +  WF EN
Sbjct: 262 VVGYKGRVVFDASKPDGTPRKLLDVTRLHQL---GWYHEISLEAGLASTYQWFLEN 314


>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Length = 298 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 100.0
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 100.0
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 100.0
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 100.0
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 100.0
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 100.0
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 100.0
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 100.0
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 100.0
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 100.0
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 100.0
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 100.0
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 100.0
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.94
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.94
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.94
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.93
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.89
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.89
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 99.84
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.56
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.54
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.53
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.52
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.51
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.5
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.5
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.5
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.49
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.49
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.49
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.49
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.48
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.48
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.48
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.47
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.47
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.47
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.47
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.46
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.46
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.46
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.46
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.45
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.44
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.44
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.43
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.42
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.42
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.41
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.41
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.41
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.4
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.4
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.39
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.38
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.38
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.36
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.36
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.34
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.33
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.33
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.32
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.32
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.31
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.3
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.29
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.29
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.29
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.27
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.27
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.27
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.22
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.18
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.14
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.14
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.12
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.1
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.09
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.05
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.05
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 98.92
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 98.88
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 98.87
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 98.73
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 98.58
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.15
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.91
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.81
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.74
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.6
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.57
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 97.36
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.28
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.27
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.21
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.15
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.03
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.0
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 96.99
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.97
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.95
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.95
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.81
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.8
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 96.61
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.5
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 96.48
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.48
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.42
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.31
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.24
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 96.22
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.1
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 96.06
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.03
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.91
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.8
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 95.63
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.39
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 95.38
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 95.31
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 95.24
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.13
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 94.88
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.37
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 93.79
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 93.52
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 93.38
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 92.97
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 92.9
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.86
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 92.18
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 91.94
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 91.82
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 91.76
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 91.59
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 91.24
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.24
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 91.22
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 91.19
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 91.13
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 90.26
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 90.12
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 89.74
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.71
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 89.43
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 89.4
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 89.37
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.56
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 88.41
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 88.34
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 88.3
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 88.24
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 88.17
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 88.16
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 87.95
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 87.91
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 87.87
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 87.15
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 87.06
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 87.05
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 85.26
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 85.24
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 84.9
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 84.53
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 84.44
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 84.05
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 84.05
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.0
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 83.2
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 83.02
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 82.97
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 82.65
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 82.62
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 82.07
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 82.05
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 81.08
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 81.04
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: dTDP-glucose 4,6-dehydratase (RmlB)
species: Streptomyces venezuelae [TaxId: 54571]
Probab=100.00  E-value=2.7e-46  Score=350.90  Aligned_cols=291  Identities=19%  Similarity=0.294  Sum_probs=247.9

Q ss_pred             CEEEEEcCCChhHHHHHHHHHHccccCC-----------------------CCceeeecccccCCCHHHHHHHHhccCCc
Q psy7590           5 KIILVTGGTGLVGKAIEKIVKEEEKRDD-----------------------ETWIFVSSKEADLSNLESTQQLFSKYKPT   61 (358)
Q Consensus         5 ~~VlItGatG~lG~~l~~~L~~~g~~~~-----------------------~~~~~~~~~~~Dl~~~~~~~~~~~~~~~d   61 (358)
                      |||||||||||||++|++.|+++|+...                       .....+.++.+|+.+.........  ++|
T Consensus         1 MkIlItG~tGfIG~~l~~~L~~~g~~v~~~~~i~~~d~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~--~~d   78 (322)
T d1r6da_           1 MRLLVTGGAGFIGSHFVRQLLAGAYPDVPADEVIVLDSLTYAGNRANLAPVDADPRLRFVHGDIRDAGLLARELR--GVD   78 (322)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHHTSCTTSCCSEEEEEECCCTTCCGGGGGGGTTCTTEEEEECCTTCHHHHHHHTT--TCC
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCccCCceEEEEeCCCccccHhHhhhhhcCCCeEEEEeccccchhhhcccc--ccc
Confidence            5899999999999999999999987310                       111235567899999998887776  699


Q ss_pred             EEEEcccccCCccccccchhhHHHHHHHHHHHHHHHHHhcCCCEEEEeeccceecCCCCCCCccccccCCCCCCCCcchH
Q psy7590          62 HVIHLAAMVGGLFHNMSHNLDFFRVNMKINDNVLDTSYKQGVKKVVSCLSTCIFPDKTTYPIDETMVHNGPPHPSNFGYS  141 (358)
Q Consensus        62 ~Vih~a~~~~~~~~~~~~~~~~~~~nv~~~~~ll~aa~~~~v~r~V~~SS~~vy~~~~~~~~~E~~~~~~~~~p~~~~Y~  141 (358)
                      +|+|+|+.... .....++...+++|+.++.+|+++|.+.++++|||+||.++|++....+++|++    +..|.+ .|+
T Consensus        79 ~vi~~a~~~~~-~~~~~~~~~~~~~N~~gt~~ll~~~~~~~~~~~I~~Ss~~~yg~~~~~~~~E~~----~~~p~~-~Y~  152 (322)
T d1r6da_          79 AIVHFAAESHV-DRSIAGASVFTETNVQGTQTLLQCAVDAGVGRVVHVSTNQVYGSIDSGSWTESS----PLEPNS-PYA  152 (322)
T ss_dssp             EEEECCSCCCH-HHHHHCCHHHHHHHTHHHHHHHHHHHHTTCCEEEEEEEGGGGCCCSSSCBCTTS----CCCCCS-HHH
T ss_pred             eEEeecccccc-cccccchHHHhhhhHHHHHHHHHHHHHcCCceEEEeecceeecCCCCCCCCCCC----CCCCCC-HHH
Confidence            99999987542 234467788899999999999999999999999999999999998888999999    778877 799


Q ss_pred             HHHHHHHHHHHHHHhhcCceEEEEecCcccCCCCCCCCCcccchhHHHHHHHHhhhhcCccchhhcccCCCCCCCCCCCC
Q psy7590         142 HAKRMLDVLNKAYYQQHGVTYTSVIPCNVFGPHDNYNLESSHVIPGLIRKLYDTIEKGKDQSVFESRARFPPGANSFGLD  221 (358)
Q Consensus       142 ~sK~~~E~~~~~~~~~~g~~~~ilRp~~v~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  221 (358)
                      .+|..+|.+++.++++++++++++||++||||.+.+.    .+++.++..+.    .                       
T Consensus       153 ~sK~~~E~~~~~~~~~~~~~~~~lR~~~vyGp~~~~~----~~i~~~i~~~~----~-----------------------  201 (322)
T d1r6da_         153 ASKAGSDLVARAYHRTYGLDVRITRCCNNYGPYQHPE----KLIPLFVTNLL----D-----------------------  201 (322)
T ss_dssp             HHHHHHHHHHHHHHHHHCCCEEEEEECEEECTTCCTT----SHHHHHHHHHH----T-----------------------
T ss_pred             HHHHHHHHHHHHHHHHhCCCEEEEEeeeEECcCCCcC----cHHHHHHHHHH----c-----------------------
Confidence            9999999999999999999999999999999986543    45565555443    4                       


Q ss_pred             ccCCCcccCCccccCCCceEEEcCCCCceeeeeeHHHHHHHHHHHHHhcCCCCCceEEccCCCcccHHHHHHHHHHHhCC
Q psy7590         222 KLDLIPFSLFPFCFTGGDEFKVLGTGKPLRQFIYSLDLARLFIWVLREYDSVEPIILSVDEKDEVTIAEVAEAIANAFQF  301 (358)
Q Consensus       222 ~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~i~v~D~a~~~~~~~~~~~~~~~~v~n~~~~~~~s~~ei~~~i~~~~g~  301 (358)
                                      |+++.+++++.+.++|+|++|+|++++.++++...+  ++||++++.++++.|+++.+.+.+|.
T Consensus       202 ----------------~~~i~v~~~g~~~r~~i~v~D~a~ai~~~~~~~~~~--~~~ni~~~~~~s~~e~~~~i~~~~~~  263 (322)
T d1r6da_         202 ----------------GGTLPLYGDGANVREWVHTDDHCRGIALVLAGGRAG--EIYHIGGGLELTNRELTGILLDSLGA  263 (322)
T ss_dssp             ----------------TCCEEEETTSCCEEEEEEHHHHHHHHHHHHHHCCTT--CEEEECCCCEEEHHHHHHHHHHHHTC
T ss_pred             ----------------CCCcEEecCCCeEEccEEHHHHHHHHHHHHhCCCCC--CeeEEeecccchhHHHHHHHHHHhCC
Confidence                            889999999999999999999999999999987654  38999999999999999999999998


Q ss_pred             Cccee-ecCCCCCCccccccchHHHHhhhCCCCccc-cHHHHHHHHHHHHHHhhc
Q psy7590         302 KGRIT-FDTNAADGQLKKTASNRKLRELRGPGFEFT-PFQQAVQESVAWFRENHS  354 (358)
Q Consensus       302 ~~~i~-~~~~~~~~~~~~~~~~~k~~~~l~~G~~~~-~~~~~l~~~~~~~~~~~~  354 (358)
                      +.... ....++.......+|++|+++.|  ||+|+ +++|+|+++++|++++++
T Consensus       264 ~~~~~~~~~~~~~~~~~~~~d~~k~~~~l--g~~p~~~~eegI~~~i~w~~~n~~  316 (322)
T d1r6da_         264 DWSSVRKVADRKGHDLRYSLDGGKIEREL--GYRPQVSFADGLARTVRWYRENRG  316 (322)
T ss_dssp             CGGGEEEECCCTTCCCBCCBCCHHHHHHH--CCCCCSCHHHHHHHHHHHHHHCHH
T ss_pred             CccceeecCCCCCCCceeeeCHHHHHHHH--CCCCCCCHHHHHHHHHHHHHHhHH
Confidence            86543 44444555666789999999999  99976 999999999999998775



>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure