Psyllid ID: psy7599
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 161 | ||||||
| 270002356 | 2021 | hypothetical protein TcasGA2_TC001372 [T | 0.422 | 0.033 | 0.838 | 5e-29 | |
| 189234985 | 1843 | PREDICTED: similar to myosin-rhogap prot | 0.422 | 0.036 | 0.838 | 5e-29 | |
| 328701263 | 1931 | PREDICTED: myosin-IXb isoform 2 [Acyrtho | 0.422 | 0.035 | 0.823 | 4e-28 | |
| 328701265 | 1863 | PREDICTED: myosin-IXb isoform 3 [Acyrtho | 0.422 | 0.036 | 0.823 | 5e-28 | |
| 328701269 | 1847 | PREDICTED: myosin-IXb isoform 1 [Acyrtho | 0.422 | 0.036 | 0.823 | 5e-28 | |
| 242011074 | 783 | myosin IIIB, putative [Pediculus humanus | 0.440 | 0.090 | 0.794 | 2e-27 | |
| 328701267 | 1776 | PREDICTED: myosin-IXb isoform 4 [Acyrtho | 0.422 | 0.038 | 0.823 | 3e-27 | |
| 357623270 | 1062 | hypothetical protein KGM_18974 [Danaus p | 0.422 | 0.064 | 0.823 | 3e-27 | |
| 427791915 | 1463 | Putative myosin class i heavy chain, par | 0.428 | 0.047 | 0.768 | 6e-26 | |
| 321455065 | 1839 | hypothetical protein DAPPUDRAFT_64918 [D | 0.422 | 0.036 | 0.779 | 1e-25 |
| >gi|270002356|gb|EEZ98803.1| hypothetical protein TcasGA2_TC001372 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 132 bits (332), Expect = 5e-29, Method: Compositional matrix adjust.
Identities = 57/68 (83%), Positives = 63/68 (92%)
Query: 29 FEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLC 88
FEQLCINYANEHLQYYFNQHVF+YEQEEY KEGIRW +I+F DNT CLQL+EGKPNGLLC
Sbjct: 524 FEQLCINYANEHLQYYFNQHVFKYEQEEYRKEGIRWNNIDFMDNTGCLQLIEGKPNGLLC 583
Query: 89 VLDDQANW 96
+LDDQ N+
Sbjct: 584 LLDDQCNF 591
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189234985|ref|XP_968193.2| PREDICTED: similar to myosin-rhogap protein, myr [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328701263|ref|XP_003241546.1| PREDICTED: myosin-IXb isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328701265|ref|XP_003241547.1| PREDICTED: myosin-IXb isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328701269|ref|XP_001944223.2| PREDICTED: myosin-IXb isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|242011074|ref|XP_002426282.1| myosin IIIB, putative [Pediculus humanus corporis] gi|212510345|gb|EEB13544.1| myosin IIIB, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|328701267|ref|XP_003241548.1| PREDICTED: myosin-IXb isoform 4 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|357623270|gb|EHJ74495.1| hypothetical protein KGM_18974 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|427791915|gb|JAA61409.1| Putative myosin class i heavy chain, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|321455065|gb|EFX66210.1| hypothetical protein DAPPUDRAFT_64918 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 161 | ||||||
| WB|WBGene00002040 | 1880 | hum-7 [Caenorhabditis elegans | 0.440 | 0.037 | 0.633 | 1.2e-20 | |
| UNIPROTKB|F1S9U2 | 548 | F1S9U2 "Uncharacterized protei | 0.527 | 0.155 | 0.505 | 1.5e-20 | |
| UNIPROTKB|E1BS57 | 2001 | Gga.50857 "Uncharacterized pro | 0.540 | 0.043 | 0.505 | 3.5e-20 | |
| UNIPROTKB|E1C471 | 2031 | Gga.50857 "Uncharacterized pro | 0.540 | 0.042 | 0.505 | 3.5e-20 | |
| UNIPROTKB|E1C470 | 2140 | Gga.50857 "Uncharacterized pro | 0.540 | 0.040 | 0.505 | 3.8e-20 | |
| UNIPROTKB|G3MXH1 | 1104 | Bt.27781 "Uncharacterized prot | 0.527 | 0.076 | 0.505 | 7e-20 | |
| UNIPROTKB|H3BMM1 | 1301 | MYO9A "Unconventional myosin-I | 0.527 | 0.065 | 0.505 | 8.8e-20 | |
| UNIPROTKB|E1BNV7 | 2159 | MYO9B "Uncharacterized protein | 0.527 | 0.039 | 0.505 | 1.3e-19 | |
| UNIPROTKB|E2R266 | 2161 | MYO9B "Uncharacterized protein | 0.527 | 0.039 | 0.505 | 1.3e-19 | |
| UNIPROTKB|G3MXE8 | 1951 | Bt.27781 "Uncharacterized prot | 0.527 | 0.043 | 0.505 | 1.5e-19 |
| WB|WBGene00002040 hum-7 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 259 (96.2 bits), Expect = 1.2e-20, P = 1.2e-20
Identities = 45/71 (63%), Positives = 59/71 (83%)
Query: 29 FEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLC 88
FEQLCINYANE LQ YFNQH+FQ+EQEEY KEGI W +IE++DNT C+QL + KP G+L
Sbjct: 556 FEQLCINYANEKLQSYFNQHIFQFEQEEYLKEGISWTNIEYTDNTECVQLFQSKPYGILR 615
Query: 89 VLDDQANWSRG 99
++D+++N + G
Sbjct: 616 LVDEESNINNG 626
|
|
| UNIPROTKB|F1S9U2 F1S9U2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BS57 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C471 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C470 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MXH1 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BMM1 MYO9A "Unconventional myosin-IXa" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BNV7 MYO9B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R266 MYO9B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MXE8 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 161 | |||
| cd01385 | 692 | cd01385, MYSc_type_IX, Myosin motor domain, type I | 1e-32 | |
| smart00242 | 677 | smart00242, MYSc, Myosin | 3e-31 | |
| cd00124 | 679 | cd00124, MYSc, Myosin motor domain | 9e-29 | |
| cd01381 | 671 | cd01381, MYSc_type_VII, Myosin motor domain, type | 1e-26 | |
| pfam00063 | 679 | pfam00063, Myosin_head, Myosin head (motor domain) | 1e-26 | |
| cd01384 | 674 | cd01384, MYSc_type_XI, Myosin motor domain, plant- | 4e-26 | |
| cd01380 | 691 | cd01380, MYSc_type_V, Myosin motor domain, type V | 3e-25 | |
| cd01387 | 677 | cd01387, MYSc_type_XV, Myosin motor domain, type X | 8e-25 | |
| cd01383 | 677 | cd01383, MYSc_type_VIII, Myosin motor domain, plan | 3e-24 | |
| cd01379 | 653 | cd01379, MYSc_type_III, Myosin motor domain, type | 2e-21 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 5e-21 | |
| cd01377 | 693 | cd01377, MYSc_type_II, Myosin motor domain, type I | 1e-20 | |
| cd01378 | 674 | cd01378, MYSc_type_I, Myosin motor domain, type I | 4e-20 | |
| cd01382 | 717 | cd01382, MYSc_type_VI, Myosin motor domain, type V | 1e-18 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 9e-11 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 4e-10 | |
| PTZ00014 | 821 | PTZ00014, PTZ00014, myosin-A; Provisional | 7e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-07 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-07 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-07 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 9e-07 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-06 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-06 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-06 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 1e-06 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-06 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 2e-06 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 2e-06 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 2e-06 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 2e-06 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 3e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 3e-06 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 4e-06 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 4e-06 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 4e-06 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 5e-06 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 5e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-06 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-06 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 8e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 9e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 9e-06 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 9e-06 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 1e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 1e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 2e-05 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 2e-05 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 2e-05 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 3e-05 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 4e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 4e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 4e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 4e-05 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 4e-05 | |
| pfam07222 | 243 | pfam07222, PBP_sp32, Proacrosin binding protein sp | 4e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 5e-05 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 5e-05 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 5e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 5e-05 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 5e-05 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 5e-05 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 5e-05 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 5e-05 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 5e-05 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 6e-05 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 6e-05 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 6e-05 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 7e-05 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 7e-05 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 7e-05 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 7e-05 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 7e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 7e-05 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 7e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 8e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 8e-05 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 8e-05 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 8e-05 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 9e-05 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 9e-05 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 9e-05 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 1e-04 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 1e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 1e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 1e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 1e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 1e-04 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 1e-04 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 1e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 2e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 2e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 2e-04 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 2e-04 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 2e-04 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 2e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 2e-04 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 2e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 2e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 2e-04 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 2e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 2e-04 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 2e-04 | |
| cd02988 | 192 | cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil | 2e-04 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 2e-04 | |
| cd01386 | 767 | cd01386, MYSc_type_XVIII, Myosin motor domain, typ | 2e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 2e-04 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 2e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 3e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 3e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 3e-04 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 3e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 3e-04 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 3e-04 | |
| PHA00435 | 306 | PHA00435, PHA00435, capsid assembly protein | 3e-04 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 4e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 4e-04 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 4e-04 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 4e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 4e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 4e-04 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 4e-04 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 5e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 5e-04 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 5e-04 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 5e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 5e-04 | |
| pfam11831 | 363 | pfam11831, Myb_Cef, pre-mRNA splicing factor compo | 5e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 6e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 6e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 6e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-04 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 6e-04 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 6e-04 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 6e-04 | |
| pfam14283 | 213 | pfam14283, DUF4366, Domain of unknown function (DU | 6e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 7e-04 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 7e-04 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 7e-04 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 7e-04 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 8e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 8e-04 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 8e-04 | |
| pfam04931 | 784 | pfam04931, DNA_pol_phi, DNA polymerase phi | 8e-04 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 8e-04 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 8e-04 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 0.001 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 0.001 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.001 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 0.001 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.001 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 0.001 | |
| pfam06213 | 282 | pfam06213, CobT, Cobalamin biosynthesis protein Co | 0.001 | |
| pfam07222 | 243 | pfam07222, PBP_sp32, Proacrosin binding protein sp | 0.001 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.001 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.001 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.001 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.001 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.001 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.001 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.001 | |
| cd02988 | 192 | cd02988, Phd_like_VIAF, Phosducin (Phd)-like famil | 0.001 | |
| TIGR01651 | 600 | TIGR01651, CobT, cobaltochelatase, CobT subunit | 0.001 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.001 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.001 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.001 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.001 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.001 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.001 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 0.001 | |
| PHA03169 | 413 | PHA03169, PHA03169, hypothetical protein; Provisio | 0.001 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.001 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 0.001 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 0.001 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 0.001 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.001 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.002 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 0.002 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.002 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 0.002 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 0.002 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.002 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.002 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.002 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.002 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.002 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 0.002 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.002 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.002 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 0.002 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 0.002 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 0.002 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 0.003 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.003 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.003 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.003 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.003 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.003 | |
| PRK09510 | 387 | PRK09510, tolA, cell envelope integrity inner memb | 0.003 | |
| COG4547 | 620 | COG4547, CobT, Cobalamin biosynthesis protein CobT | 0.003 | |
| pfam07423 | 214 | pfam07423, DUF1510, Protein of unknown function (D | 0.003 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.003 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.003 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 0.003 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 0.003 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.003 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.003 | |
| PRK14150 | 193 | PRK14150, PRK14150, heat shock protein GrpE; Provi | 0.003 | |
| COG5167 | 776 | COG5167, VID27, Protein involved in vacuole import | 0.003 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 0.003 | |
| PRK12298 | 390 | PRK12298, obgE, GTPase CgtA; Reviewed | 0.003 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.003 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 0.003 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.004 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 0.004 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 0.004 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.004 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.004 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.004 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.004 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.004 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 0.004 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 0.004 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.004 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| pfam09073 | 424 | pfam09073, BUD22, BUD22 | 0.004 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.004 | |
| COG5406 | 1001 | COG5406, COG5406, Nucleosome binding factor SPN, S | 0.004 | |
| pfam12118 | 261 | pfam12118, SprA-related, SprA-related family | 0.004 | |
| PRK12585 | 197 | PRK12585, PRK12585, putative monovalent cation/H+ | 0.004 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 0.004 | |
| pfam00428 | 88 | pfam00428, Ribosomal_60s, 60s Acidic ribosomal pro | 0.004 | |
| TIGR03685 | 105 | TIGR03685, L12P_arch, 50S ribosomal protein L12P | 0.004 | |
| COG5117 | 657 | COG5117, NOC3, Protein involved in the nuclear exp | 0.004 |
| >gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
Score = 121 bits (304), Expect = 1e-32
Identities = 46/76 (60%), Positives = 57/76 (75%), Gaps = 2/76 (2%)
Query: 26 GSC--FEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKP 83
G C FEQLCINYANE LQYYFNQH+F+ EQEEY EGI W +IE++DN C+QL KP
Sbjct: 390 GRCNSFEQLCINYANEQLQYYFNQHIFKLEQEEYQGEGITWTNIEYTDNVGCIQLFSKKP 449
Query: 84 NGLLCVLDDQANWSRG 99
GLL +LD+++N+
Sbjct: 450 TGLLYLLDEESNFPHA 465
|
Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 692 |
| >gnl|CDD|214580 smart00242, MYSc, Myosin | Back alignment and domain information |
|---|
| >gnl|CDD|238071 cd00124, MYSc, Myosin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) | Back alignment and domain information |
|---|
| >gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|148682 pfam07222, PBP_sp32, Proacrosin binding protein sp32 | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222648 pfam14283, DUF4366, Domain of unknown function (DUF4366) | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT | Back alignment and domain information |
|---|
| >gnl|CDD|148682 pfam07222, PBP_sp32, Proacrosin binding protein sp32 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|239286 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|184539 PRK14150, PRK14150, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227496 COG5167, VID27, Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|220102 pfam09073, BUD22, BUD22 | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227693 COG5406, COG5406, Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|221429 pfam12118, SprA-related, SprA-related family | Back alignment and domain information |
|---|
| >gnl|CDD|183610 PRK12585, PRK12585, putative monovalent cation/H+ antiporter subunit G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215914 pfam00428, Ribosomal_60s, 60s Acidic ribosomal protein | Back alignment and domain information |
|---|
| >gnl|CDD|234311 TIGR03685, L12P_arch, 50S ribosomal protein L12P | Back alignment and domain information |
|---|
| >gnl|CDD|227447 COG5117, NOC3, Protein involved in the nuclear export of pre-ribosomes [Translation, ribosomal structure and biogenesis / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| PTZ00014 | 821 | myosin-A; Provisional | 100.0 | |
| cd01383 | 677 | MYSc_type_VIII Myosin motor domain, plant-specific | 100.0 | |
| cd01387 | 677 | MYSc_type_XV Myosin motor domain, type XV myosins. | 100.0 | |
| cd01381 | 671 | MYSc_type_VII Myosin motor domain, type VII myosin | 100.0 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 100.0 | |
| cd01382 | 717 | MYSc_type_VI Myosin motor domain, type VI myosins. | 100.0 | |
| cd01384 | 674 | MYSc_type_XI Myosin motor domain, plant-specific t | 100.0 | |
| cd01379 | 653 | MYSc_type_III Myosin motor domain, type III myosin | 100.0 | |
| cd01385 | 692 | MYSc_type_IX Myosin motor domain, type IX myosins. | 100.0 | |
| cd01378 | 674 | MYSc_type_I Myosin motor domain, type I myosins. M | 100.0 | |
| cd01377 | 693 | MYSc_type_II Myosin motor domain, type II myosins. | 100.0 | |
| cd01380 | 691 | MYSc_type_V Myosin motor domain, type V myosins. M | 99.98 | |
| smart00242 | 677 | MYSc Myosin. Large ATPases. ATPase; molecular moto | 99.98 | |
| cd00124 | 679 | MYSc Myosin motor domain. This catalytic (head) do | 99.97 | |
| cd01386 | 767 | MYSc_type_XVIII Myosin motor domain, type XVIII my | 99.97 | |
| PF00063 | 689 | Myosin_head: Myosin head (motor domain); InterPro: | 99.97 | |
| KOG0161|consensus | 1930 | 99.97 | ||
| KOG0164|consensus | 1001 | 99.96 | ||
| KOG0163|consensus | 1259 | 99.94 | ||
| KOG0160|consensus | 862 | 99.92 | ||
| KOG0162|consensus | 1106 | 99.92 | ||
| KOG4229|consensus | 1062 | 99.9 |
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.1e-35 Score=277.19 Aligned_cols=103 Identities=28% Similarity=0.359 Sum_probs=99.7
Q ss_pred cceeeeeecCcccCCCcCcchhhhhhhchhhhhhHHHHhhhhhhHHhhhhcCceeeecccCCcHHHHHHhhcCCCccccc
Q psy7599 10 HRSLGVFKTSLVKHLKGSCFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCV 89 (161)
Q Consensus 10 ~~~IGILDi~GFE~f~~NsfEQLcINyaNErLq~~f~~~if~~eqeeY~~EGI~w~~i~~~dN~~~ldLI~~kp~GLLsL 89 (161)
..+||||||||||+|..|||+|||||||||+||++|++++|+.+|++|.+|||.|..|+|.||++||+||++||.|||+|
T Consensus 461 ~~~IGiLDI~GFE~f~~NSfEQLcINy~NEkLQq~F~~~vF~~EqeeY~~EgI~~~~i~f~dN~~~idLie~k~~GIl~l 540 (821)
T PTZ00014 461 KVFIGMLDIFGFEVFKNNSLEQLFINITNEMLQKNFVDIVFERESKLYKDEGISTEELEYTSNESVIDLLCGKGKSVLSI 540 (821)
T ss_pred CceEEEEecccccccCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccCCCCCCCCcHHHHHHHhcCCccHHHH
Confidence 36899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccccCCCCChhHHHHHHhCC
Q psy7599 90 LDDQANWSRGNPMVSCVFWMIKP 112 (161)
Q Consensus 90 LDEEc~~pk~tD~tfl~~l~~~~ 112 (161)
|||+|++|++||.+|+.++..+.
T Consensus 541 LDEec~~p~~tD~~f~~kl~~~~ 563 (821)
T PTZ00014 541 LEDQCLAPGGTDEKFVSSCNTNL 563 (821)
T ss_pred HHHHhCCCCCCHHHHHHHHHHHh
Confidence 99999999999999999998654
|
|
| >cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >cd01387 MYSc_type_XV Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >cd01381 MYSc_type_VII Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01382 MYSc_type_VI Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >cd01379 MYSc_type_III Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >cd01385 MYSc_type_IX Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >cd01378 MYSc_type_I Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >cd01377 MYSc_type_II Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >cd01380 MYSc_type_V Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >smart00242 MYSc Myosin | Back alignment and domain information |
|---|
| >cd00124 MYSc Myosin motor domain | Back alignment and domain information |
|---|
| >cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >KOG0164|consensus | Back alignment and domain information |
|---|
| >KOG0163|consensus | Back alignment and domain information |
|---|
| >KOG0160|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG4229|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 161 | ||||
| 1w8j_A | 766 | Crystal Structure Of Myosin V Motor Domain - Nucleo | 4e-17 | ||
| 1oe9_A | 795 | Crystal Structure Of Myosin V Motor With Essential | 4e-17 | ||
| 2dfs_A | 1080 | 3-D Structure Of Myosin-V Inhibited State Length = | 1e-16 | ||
| 3mnq_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-16 | ||
| 2xo8_A | 776 | Crystal Structure Of Myosin-2 In Complex With Tribr | 1e-16 | ||
| 2jhr_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-16 | ||
| 1mmg_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 1e-16 | ||
| 1mmd_A | 762 | Truncated Head Of Myosin From Dictyostelium Discoid | 1e-16 | ||
| 1mmn_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 1e-16 | ||
| 2xel_A | 776 | Molecular Mechanism Of Pentachloropseudilin Mediate | 1e-16 | ||
| 3myh_X | 762 | Insights Into The Importance Of Hydrogen Bonding In | 1e-16 | ||
| 1jwy_A | 776 | Crystal Structure Of The Dynamin A Gtpase Domain Co | 1e-16 | ||
| 1yv3_A | 762 | The Structural Basis Of Blebbistatin Inhibition And | 1e-16 | ||
| 2aka_A | 776 | Structure Of The Nucleotide-Free Myosin Ii Motor Do | 1e-16 | ||
| 2y0r_X | 758 | Structural Basis For The Allosteric Interference Of | 1e-16 | ||
| 1mma_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 1e-16 | ||
| 2y9e_X | 758 | Structural Basis For The Allosteric Interference Of | 1e-16 | ||
| 1d0x_A | 761 | Dictyostelium Myosin S1dc (Motor Domain Fragment) C | 1e-16 | ||
| 1fmv_A | 761 | Crystal Structure Of The Apo Motor Domain Of Dictyo | 1e-16 | ||
| 2x9h_A | 695 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 1e-16 | ||
| 1g8x_A | 1010 | Structure Of A Genetically Engineered Molecular Mot | 2e-16 | ||
| 4db1_A | 783 | Cardiac Human Myosin S1dc, Beta Isoform Complexed W | 3e-16 | ||
| 1w9k_A | 770 | Dictyostelium Discoideum Myosin Ii Motor Domain S45 | 4e-16 | ||
| 2ec6_A | 838 | Placopecten Striated Muscle Myosin Ii Length = 838 | 4e-16 | ||
| 1lvk_A | 762 | X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N | 4e-16 | ||
| 2os8_A | 840 | Rigor-Like Structures Of Muscle Myosins Reveal Key | 4e-16 | ||
| 1w9l_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 4e-16 | ||
| 1qvi_A | 840 | Crystal Structure Of Scallop Myosin S1 In The Pre-P | 6e-16 | ||
| 1dfl_A | 831 | Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra | 6e-16 | ||
| 1w9i_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 6e-16 | ||
| 1kk7_A | 837 | Scallop Myosin In The Near Rigor Conformation Lengt | 6e-16 | ||
| 1b7t_A | 835 | Myosin Digested By Papain Length = 835 | 6e-16 | ||
| 1dfk_A | 830 | Nucleotide-Free Scallop Myosin S1-Near Rigor State | 6e-16 | ||
| 1w9j_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 6e-16 | ||
| 3mkd_A | 692 | Crystal Structure Of Myosin-2 Dictyostelium Discoid | 8e-16 | ||
| 2w4g_M | 840 | Isometrically Contracting Insect Asynchronous Fligh | 8e-16 | ||
| 3i5g_A | 839 | Crystal Structure Of Rigor-Like Squid Myosin S1 Len | 2e-15 | ||
| 2mys_A | 843 | Myosin Subfragment-1, Alpha Carbon Coordinates Only | 1e-14 | ||
| 1m8q_A | 840 | Molecular Models Of Averaged Rigor Crossbridges Fro | 1e-14 | ||
| 1br2_A | 791 | Smooth Muscle Myosin Motor Domain Complexed With Mg | 6e-14 | ||
| 1br1_A | 820 | Smooth Muscle Myosin Motor Domain-Essential Light C | 6e-14 | ||
| 2ycu_A | 995 | Crystal Structure Of Human Non Muscle Myosin 2c In | 7e-14 | ||
| 3dtp_B | 973 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 9e-14 | ||
| 3dtp_A | 971 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 9e-14 | ||
| 3j04_A | 909 | Em Structure Of The Heavy Meromyosin Subfragment Of | 1e-13 | ||
| 1i84_S | 1184 | Cryo-Em Structure Of The Heavy Meromyosin Subfragme | 1e-13 | ||
| 2bki_A | 858 | Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St | 7e-13 | ||
| 2x51_A | 789 | M6 Delta Insert1 Length = 789 | 7e-13 | ||
| 2vas_A | 788 | Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo | 7e-13 | ||
| 4e7s_A | 798 | Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat | 7e-13 | ||
| 4dbr_A | 786 | Myosin Vi D179y (md) Pre-powerstroke State Length = | 7e-13 | ||
| 4e7z_A | 798 | Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F | 7e-13 | ||
| 4dbq_A | 788 | Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos | 7e-13 | ||
| 2v26_A | 784 | Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L | 7e-13 | ||
| 2bkh_A | 814 | Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc | 7e-13 | ||
| 4dbp_A | 814 | Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal | 7e-13 | ||
| 3l9i_A | 814 | Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant | 7e-13 | ||
| 4anj_A | 1052 | Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St | 8e-13 | ||
| 1lkx_A | 697 | Motor Domain Of Myoe, A Class-I Myosin Length = 697 | 1e-12 | ||
| 4a7f_C | 697 | Structure Of The Actin-Tropomyosin-Myosin Complex ( | 1e-12 |
| >pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 | Back alignment and structure |
|
| >pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 | Back alignment and structure |
| >pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 | Back alignment and structure |
| >pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 | Back alignment and structure |
| >pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 | Back alignment and structure |
| >pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 | Back alignment and structure |
| >pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 | Back alignment and structure |
| >pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 | Back alignment and structure |
| >pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 | Back alignment and structure |
| >pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 | Back alignment and structure |
| >pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 | Back alignment and structure |
| >pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 | Back alignment and structure |
| >pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 | Back alignment and structure |
| >pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 | Back alignment and structure |
| >pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 | Back alignment and structure |
| >pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 | Back alignment and structure |
| >pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 | Back alignment and structure |
| >pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 | Back alignment and structure |
| >pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 | Back alignment and structure |
| >pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 | Back alignment and structure |
| >pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 | Back alignment and structure |
| >pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 | Back alignment and structure |
| >pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 | Back alignment and structure |
| >pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 | Back alignment and structure |
| >pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 | Back alignment and structure |
| >pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 | Back alignment and structure |
| >pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 | Back alignment and structure |
| >pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 | Back alignment and structure |
| >pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 | Back alignment and structure |
| >pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 | Back alignment and structure |
| >pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 | Back alignment and structure |
| >pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 | Back alignment and structure |
| >pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 | Back alignment and structure |
| >pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 | Back alignment and structure |
| >pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 | Back alignment and structure |
| >pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 | Back alignment and structure |
| >pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 | Back alignment and structure |
| >pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 | Back alignment and structure |
| >pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 | Back alignment and structure |
| >pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 | Back alignment and structure |
| >pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 | Back alignment and structure |
| >pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 | Back alignment and structure |
| >pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 | Back alignment and structure |
| >pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 | Back alignment and structure |
| >pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 | Back alignment and structure |
| >pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 | Back alignment and structure |
| >pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 100.0 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 100.0 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 100.0 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 100.0 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 100.0 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 100.0 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 100.0 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 100.0 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 100.0 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 100.0 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 100.0 |
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-36 Score=283.49 Aligned_cols=113 Identities=29% Similarity=0.511 Sum_probs=105.6
Q ss_pred Cccccccccc---------ceeeeeecCcccCCCcCcchhhhhhhchhhhhhHHHHhhhhhhHHhhhhcCceeeecccCC
Q psy7599 1 MYLQLDIGIH---------RSLGVFKTSLVKHLKGSCFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSD 71 (161)
Q Consensus 1 ~~~~~~i~i~---------~~IGILDi~GFE~f~~NsfEQLcINyaNErLq~~f~~~if~~eqeeY~~EGI~w~~i~~~d 71 (161)
||.|++..|+ .+||||||||||+|..|||+|||||||||+||++|++++|+.+|++|.+|||.|.+|+|.|
T Consensus 427 LF~wlV~~IN~~l~~~~~~~~IGvLDI~GFE~f~~NsFEQlcINyaNEkLQq~F~~~~f~~EqeeY~~EgI~w~~i~f~D 506 (784)
T 2v26_A 427 LFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVD 506 (784)
T ss_dssp HHHHHHHHHHTTSCCSCCSEEEEEEECCCCCCCSSCCHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHTTCCCCCCCCCC
T ss_pred HHHHHHHHHHHhcCcccccceeeecccCCcccCCcCCHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHhcCCCcccccccC
Confidence 4666655444 5799999999999999999999999999999999999999999999999999999999999
Q ss_pred cHHHHHHhhcCCCccccccccccccCCCCChhHHHHHHhCCC
Q psy7599 72 NTLCLQLVEGKPNGLLCVLDDQANWSRGNPMVSCVFWMIKPK 113 (161)
Q Consensus 72 N~~~ldLI~~kp~GLLsLLDEEc~~pk~tD~tfl~~l~~~~~ 113 (161)
|++|++||+++|+|||+|||++|++|++||.+|+.++.....
T Consensus 507 N~~~idLie~kp~GIlslLDEe~~~p~~tD~~f~~kl~~~~~ 548 (784)
T 2v26_A 507 NQDCIDLIEARLVGILDILDEENRLPQPSDQHFTSAVHQKHK 548 (784)
T ss_dssp CHHHHHHHHCTTTSHHHHHHHHHHSSSCCHHHHHHHHHHHTT
T ss_pred hHHHHHHHhhccccHHHHHHHHhcCCCCChHHHHHHHHHHhC
Confidence 999999999999999999999999999999999999987654
|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 161 | ||||
| d1lkxa_ | 684 | c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli | 5e-18 | |
| d2mysa2 | 794 | c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain | 1e-16 | |
| d1kk8a2 | 789 | c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain | 7e-16 | |
| d1br2a2 | 710 | c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick | 2e-15 | |
| d1w7ja2 | 730 | c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick | 2e-14 | |
| d1d0xa2 | 712 | c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain | 2e-12 |
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]
Score = 77.8 bits (191), Expect = 5e-18
Identities = 32/100 (32%), Positives = 53/100 (53%)
Query: 1 MYLQLDIGIHRSLGVFKTSLVKHLKGSCFEQLCINYANEHLQYYFNQHVFQYEQEEYNKE 60
+ +G+ + + + FEQL IN+ NE LQ F + + EQEEY +E
Sbjct: 362 TIINCTTEKGPVIGILDIYGFEVFQNNSFEQLNINFCNEKLQQLFIELTLKSEQEEYVRE 421
Query: 61 GIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQANWSRGN 100
GI W++IE+ +N +L+E KP GL+ +LD+ ++
Sbjct: 422 GIEWKNIEYFNNKPICELIEKKPIGLISLLDEACLIAKST 461
|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 99.97 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 99.97 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.97 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.96 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.96 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 99.96 |
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Dictyostelium discoideum [TaxId: 44689]
Probab=99.97 E-value=2.6e-32 Score=250.86 Aligned_cols=102 Identities=39% Similarity=0.677 Sum_probs=91.0
Q ss_pred ceeeeeecCcccCCCcCcchhhhhhhchhhhhhHHHHhhhhhhHHhhhhcCceeeecccC-CcHHHHHHhhc-CCCcccc
Q psy7599 11 RSLGVFKTSLVKHLKGSCFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFS-DNTLCLQLVEG-KPNGLLC 88 (161)
Q Consensus 11 ~~IGILDi~GFE~f~~NsfEQLcINyaNErLq~~f~~~if~~eqeeY~~EGI~w~~i~~~-dN~~~ldLI~~-kp~GLLs 88 (161)
.+|||||+||||+|..|||+||||||||||||++|++++|..++++|.+|||.|..++|. ||++|++||.+ +|.|||+
T Consensus 401 ~~IgiLDifGFE~f~~NsfEQLcINyaNEkLQ~~f~~~~f~~eq~eY~~EgI~~~~i~~~~dn~~~~~Li~~k~p~Gll~ 480 (712)
T d1d0xa2 401 YFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQFFNHHMFKLEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILA 480 (712)
T ss_dssp EEEEEEECCCCCCCSSBCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCC--------CHHHHHHHHHCTTTTCHHH
T ss_pred ceeeeeecccccccccCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCcccccCCCcHHHHHHHhccCCCcHHH
Confidence 579999999999999999999999999999999999999999999999999999999994 99999999985 5899999
Q ss_pred ccccccccCCCCChhHHHHHHhCC
Q psy7599 89 VLDDQANWSRGNPMVSCVFWMIKP 112 (161)
Q Consensus 89 LLDEEc~~pk~tD~tfl~~l~~~~ 112 (161)
+||++|++|++||.+|+.++....
T Consensus 481 lLdee~~~~~~td~~~l~kl~~~~ 504 (712)
T d1d0xa2 481 LLDEQSVFPNATDNTLITKLHSHF 504 (712)
T ss_dssp HHHHHHTCTTCCHHHHHHHHHHHH
T ss_pred HhHHHhcCCCCChHHHHHHHHHHh
Confidence 999999999999999999997654
|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|