Psyllid ID: psy7655

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MESLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSIRTLTTERLNTSAAELGAPVSNGMGKPVLLFAGEATSEDQYATVNGAIETGWREADRILKG
cccccHHHHHHHHHHHHHHHHccccccccccEEEEccccccccccccccccccccccccccHHHHcccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHc
cccccHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccccEEEEEEcccccccccccccccccccccccEEEEEcccccccccccHHHHHHccHHHHHHHHcc
MESLTDKQVQIEVMKAFRFFlgakytipeparilttswgsnkhfrgsysiRTLTTERLNTsaaelgapvsngmgkpvllfageatsedqyATVNGAIETGWREADRILKG
mesltdkqVQIEVMKAFRFFLGAKYTIPEParilttswgsnkhfrGSYSIRTLTTERLNTSAAElgapvsngmGKPVLLFAGEATSEDQYATVNGAietgwreadrilkg
MESLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSIRTLTTERLNTSAAELGAPVSNGMGKPVLLFAGEATSEDQYATVNGAIETGWREADRILKG
********VQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSIRTLTTERLNT****L***V**GMGKPVLLFAGEATSEDQYATVNGAIETGWR********
*ESLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSIRTLTTERLNTSAAELGAPVSNGMGKPVLLFAGEATSEDQYATVNGAIETGWREADRILKG
MESLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSIRTLTTERLNTSAAELGAPVSNGMGKPVLLFAGEATSEDQYATVNGAIETGWREADRILKG
**SLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSIRTLTTERLNTSAAELGAPVSNGMGKPVLLFAGEATSEDQYATVNGAIETGWREADRILKG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSIRTLTTERLNTSAAELGAPVSNGMGKPVLLFAGEATSEDQYATVNGAIETGWREADRILKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query110 2.2.26 [Sep-21-2011]
Q9NWM0555 Spermine oxidase OS=Homo yes N/A 0.963 0.190 0.362 5e-11
Q99K82555 Spermine oxidase OS=Mus m no N/A 0.963 0.190 0.362 5e-11
Q6QHF9649 Peroxisomal N(1)-acetyl-s no N/A 0.972 0.164 0.342 8e-11
Q865R1512 Peroxisomal N(1)-acetyl-s no N/A 0.954 0.205 0.363 3e-10
Q8C0L6504 Peroxisomal N(1)-acetyl-s no N/A 0.945 0.206 0.351 6e-09
Q9SU79533 Probable polyamine oxidas yes N/A 0.990 0.204 0.268 3e-07
Q9LID0 746 Lysine-specific histone d no N/A 0.781 0.115 0.38 5e-07
P18487504 Protein anon-37Cs OS=Dros no N/A 0.936 0.204 0.287 1e-05
P31225489 Corticosteroid-binding pr N/A N/A 0.709 0.159 0.340 1e-05
O60341852 Lysine-specific histone d no N/A 0.927 0.119 0.293 2e-05
>sp|Q9NWM0|SMOX_HUMAN Spermine oxidase OS=Homo sapiens GN=SMOX PE=1 SV=1 Back     alignment and function desciption
 Score = 66.6 bits (161), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 61/113 (53%), Gaps = 7/113 (6%)

Query: 1   MESLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSIRTLTTERLNT 60
           ME   D+ V     +  R F G    IP+P RIL ++WGSN +FRGSYS   + +     
Sbjct: 436 MEKCDDEAVAEICTEMLRQFTGNP-NIPKPRRILRSAWGSNPYFRGSYSYTQVGSS--GA 492

Query: 61  SAAELGAPV----SNGMGKPVLLFAGEATSEDQYATVNGAIETGWREADRILK 109
              +L  P+    S+      +LF+GEAT    Y+T +GA+ +G REA R+++
Sbjct: 493 DVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGALLSGQREAARLIE 545
Flavoenzyme which catalyzes the oxidation of spermine to spermidine. Can also use N(1)-acetylspermine and spermidine as substrates, with different affinity depending on the isoform (isozyme) and on the experimental conditions. Plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. May contribute to beta-alanine production via aldehyde dehydrogenase conversion of 3-amino-propanal.
Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 5EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q99K82|SMOX_MOUSE Spermine oxidase OS=Mus musculus GN=Smox PE=1 SV=1 Back     alignment and function description
>sp|Q6QHF9|PAOX_HUMAN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Homo sapiens GN=PAOX PE=1 SV=3 Back     alignment and function description
>sp|Q865R1|PAOX_BOVIN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Bos taurus GN=PAOX PE=1 SV=3 Back     alignment and function description
>sp|Q8C0L6|PAOX_MOUSE Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Mus musculus GN=Paox PE=1 SV=3 Back     alignment and function description
>sp|Q9SU79|PAO5_ARATH Probable polyamine oxidase 5 OS=Arabidopsis thaliana GN=PAO5 PE=2 SV=1 Back     alignment and function description
>sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 Back     alignment and function description
>sp|P18487|A37C_DROME Protein anon-37Cs OS=Drosophila melanogaster GN=anon-37Cs PE=2 SV=3 Back     alignment and function description
>sp|P31225|CBP1_CANAL Corticosteroid-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBP1 PE=1 SV=2 Back     alignment and function description
>sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
158287397 486 AGAP011207-PA [Anopheles gambiae str. PE 0.972 0.220 0.509 2e-24
312373967 1048 hypothetical protein AND_16683 [Anophele 0.972 0.102 0.5 2e-24
157123150 478 amine oxidase [Aedes aegypti] gi|1088745 0.972 0.223 0.527 1e-23
170045018 791 peroxisomal N1-acetyl-spermine/spermidin 0.972 0.135 0.518 1e-23
170065849 947 spermine oxidase [Culex quinquefasciatus 0.972 0.112 0.518 1e-23
110456536123 unknown [Diaphorina citri] 0.718 0.642 0.670 2e-23
157120556 472 amine oxidase [Aedes aegypti] gi|1088749 0.963 0.224 0.513 2e-23
170054634 481 spermine oxidase [Culex quinquefasciatus 0.972 0.222 0.462 6e-23
345483413 481 PREDICTED: peroxisomal N(1)-acetyl-sperm 0.981 0.224 0.5 8e-23
328723284 475 PREDICTED: peroxisomal N(1)-acetyl-sperm 0.990 0.229 0.477 8e-23
>gi|158287397|ref|XP_309435.4| AGAP011207-PA [Anopheles gambiae str. PEST] gi|157019631|gb|EAA05268.4| AGAP011207-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/108 (50%), Positives = 76/108 (70%), Gaps = 1/108 (0%)

Query: 1   MESLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSIRTLTTERLNT 60
           ME  +D++V+   M   R F+    T+PEP R   TSW SN +FRGSY+ R++TT+ LNT
Sbjct: 375 MERASDEEVRRACMFLLRKFMKGC-TVPEPVRFQRTSWYSNPNFRGSYTFRSMTTDLLNT 433

Query: 61  SAAELGAPVSNGMGKPVLLFAGEATSEDQYATVNGAIETGWREADRIL 108
           SA+ L  P++N  G PV+ FAGEAT +  Y+TV+GA+ETGWREA R++
Sbjct: 434 SASHLAIPLTNSCGMPVVQFAGEATHDHYYSTVHGAVETGWREASRLI 481

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|312373967|gb|EFR21628.1| hypothetical protein AND_16683 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|157123150|ref|XP_001660032.1| amine oxidase [Aedes aegypti] gi|108874525|gb|EAT38750.1| AAEL009396-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170045018|ref|XP_001850121.1| peroxisomal N1-acetyl-spermine/spermidine oxidase [Culex quinquefasciatus] gi|167868073|gb|EDS31456.1| peroxisomal N1-acetyl-spermine/spermidine oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170065849|ref|XP_001868046.1| spermine oxidase [Culex quinquefasciatus] gi|167862588|gb|EDS25971.1| spermine oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|110456536|gb|ABG74721.1| unknown [Diaphorina citri] Back     alignment and taxonomy information
>gi|157120556|ref|XP_001653662.1| amine oxidase [Aedes aegypti] gi|108874902|gb|EAT39127.1| AAEL009050-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170054634|ref|XP_001863219.1| spermine oxidase [Culex quinquefasciatus] gi|167874906|gb|EDS38289.1| spermine oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|345483413|ref|XP_001602253.2| PREDICTED: peroxisomal N(1)-acetyl-spermine/spermidine oxidase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328723284|ref|XP_001948577.2| PREDICTED: peroxisomal N(1)-acetyl-spermine/spermidine oxidase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
FB|FBgn0033584509 CG7737 [Drosophila melanogaste 0.618 0.133 0.471 3.5e-20
FB|FBgn0036749486 CG7460 [Drosophila melanogaste 0.954 0.216 0.457 7.9e-20
FB|FBgn0036750479 CG6034 [Drosophila melanogaste 0.954 0.219 0.420 3.5e-19
FB|FBgn0035943480 CG5653 [Drosophila melanogaste 0.963 0.220 0.444 1.5e-17
UNIPROTKB|H9GWF4137 PAOX "Uncharacterized protein" 0.954 0.766 0.372 7.1e-13
ZFIN|ZDB-GENE-031201-3539 smox "spermine oxidase" [Danio 0.981 0.200 0.405 3.1e-12
UNIPROTKB|Q5TE25442 SMOX "Spermine oxidase" [Homo 0.436 0.108 0.469 5.9e-12
ZFIN|ZDB-GENE-081104-436490 si:dkey-7o6.3 "si:dkey-7o6.3" 0.954 0.214 0.363 7.1e-12
UNIPROTKB|E2R8S7555 SMOX "Uncharacterized protein" 0.981 0.194 0.378 1.5e-11
UNIPROTKB|D4A776546 D4A776 "Uncharacterized protei 0.981 0.197 0.360 4.9e-11
FB|FBgn0033584 CG7737 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 155 (59.6 bits), Expect = 3.5e-20, Sum P(2) = 3.5e-20
 Identities = 33/70 (47%), Positives = 47/70 (67%)

Query:     1 MESLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSIRTLTTERLNT 60
             ME+L   +VQ  VM  FR FL  ++ IP+PA   T++W +N +FRGSYS R++ TE+L T
Sbjct:   369 METLPVDEVQAGVMYLFRRFL--RWKIPDPANFRTSAWYTNDNFRGSYSYRSMDTEQLGT 426

Query:    61 SAAELGAPVS 70
              A EL  P++
Sbjct:   427 GARELSHPLT 436
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
FB|FBgn0036749 CG7460 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0036750 CG6034 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0035943 CG5653 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|H9GWF4 PAOX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031201-3 smox "spermine oxidase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TE25 SMOX "Spermine oxidase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-436 si:dkey-7o6.3 "si:dkey-7o6.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8S7 SMOX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D4A776 D4A776 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
pfam01593444 pfam01593, Amino_oxidase, Flavin containing amine 2e-16
PLN02568539 PLN02568, PLN02568, polyamine oxidase 8e-12
PLN02676487 PLN02676, PLN02676, polyamine oxidase 8e-12
PLN02268435 PLN02268, PLN02268, probable polyamine oxidase 1e-09
PLN02976 1713 PLN02976, PLN02976, amine oxidase 1e-09
PLN02529 738 PLN02529, PLN02529, lysine-specific histone demeth 3e-09
PLN02328 808 PLN02328, PLN02328, lysine-specific histone demeth 3e-07
PLN03000 881 PLN03000, PLN03000, amine oxidase 2e-06
>gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase Back     alignment and domain information 
 Score = 73.0 bits (179), Expect = 2e-16
 Identities = 38/109 (34%), Positives = 55/109 (50%), Gaps = 10/109 (9%)

Query: 1   MESLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYS-IRTLTTERLN 59
           +E L+D+++   V++  R  LG +  +P+P   L + W ++ + RGSYS        R  
Sbjct: 345 LEDLSDEELLEAVLRDLRKLLGPED-VPDPVNFLVSDWHTDPYARGSYSYPPVGDDSRY- 402

Query: 60  TSAAELGAPVSNGMGKPVLLFAGEATSEDQYATVNGAIETGWREADRIL 108
                L  PV  G     L FAGE TS     TV GA+E+G R A R+L
Sbjct: 403 --RPALRTPVGPG-----LFFAGEHTSGGYPGTVEGAVESGLRAARRVL 444

This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins. Length = 444
>gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase Back     alignment and domain information
>gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase Back     alignment and domain information
>gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase Back     alignment and domain information
>gnl|CDD|215527 PLN02976, PLN02976, amine oxidase Back     alignment and domain information
>gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 Back     alignment and domain information
>gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>gnl|CDD|178578 PLN03000, PLN03000, amine oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 110
PLN02568539 polyamine oxidase 99.94
PLN02676487 polyamine oxidase 99.94
PLN03000 881 amine oxidase 99.94
KOG0685|consensus498 99.93
PLN02976 1713 amine oxidase 99.93
PLN02268435 probable polyamine oxidase 99.93
PLN02328 808 lysine-specific histone demethylase 1 homolog 99.92
PLN02529 738 lysine-specific histone demethylase 1 99.91
KOG0029|consensus501 99.86
COG1231450 Monoamine oxidase [Amino acid transport and metabo 99.84
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.78
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.64
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.46
PLN02612567 phytoene desaturase 99.42
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.14
PLN02487569 zeta-carotene desaturase 99.1
PRK07233434 hypothetical protein; Provisional 99.08
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.99
PRK12416463 protoporphyrinogen oxidase; Provisional 98.89
PLN02576496 protoporphyrinogen oxidase 98.87
PRK07208479 hypothetical protein; Provisional 98.43
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.37
COG3349485 Uncharacterized conserved protein [Function unknow 97.74
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.6
TIGR02730493 carot_isom carotene isomerase. Members of this fam 96.32
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 95.49
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 95.36
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 94.93
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 87.44
KOG1276|consensus491 83.85
>PLN02568 polyamine oxidase Back     alignment and domain information 
Probab=99.94  E-value=3.6e-27  Score=182.65  Aligned_cols=106  Identities=32%  Similarity=0.516  Sum_probs=92.1

Q ss_pred             CCCCCHHHHHHHHHHHHHHHhCCCCC---------------------CCccceeeccccCCCCCCCcccCCCCCCccccc
Q psy7655           1 MESLTDKQVQIEVMKAFRFFLGAKYT---------------------IPEPARILTTSWGSNKHFRGSYSIRTLTTERLN   59 (110)
Q Consensus         1 ~~~ls~e~~~~~~~~~L~~~fg~~~~---------------------~~~~~~~~~~~W~~dp~~~G~ys~~~~g~~~~~   59 (110)
                      +++++++++++.++.+|+++||. ..                     .++|+.+++++|.+|||++|+|++++||+... 
T Consensus       400 ~e~l~~~~~~~~~~~~L~~~~g~-~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~t~W~~dp~~~GsYs~~~~g~~~~-  477 (539)
T PLN02568        400 LEKLSDEEIIRGVQTTLSSFLKR-RVAGLGSQSHPLCNGGASSNDGSRWKFVKVLKSKWGTDPLFLGSYSYVAVGSSGD-  477 (539)
T ss_pred             HHcCCHHHHHHHHHHHHHHHcCC-cccCcccccccccccccccccccCCCCceEEeCCCCCCCccCCccCCCcCCCChh-
Confidence            46899999999999999999982 22                     24799999999999999999999999998764 


Q ss_pred             ccHHHhcCccCC-------CCCCCcEEEcccccccccccchhHHHHHHHHHHHHHHc
Q psy7655          60 TSAAELGAPVSN-------GMGKPVLLFAGEATSEDQYATVNGAIETGWREADRILK  109 (110)
Q Consensus        60 ~~~~~l~~p~~~-------~~~~~rl~FAGe~ts~~~~g~~~GA~~SG~raA~~i~~  109 (110)
                       +.+.|++|+.+       ....+|||||||||+..++||||||++||+|+|++|++
T Consensus       478 -~~~~La~P~~~~~~~~~~~~~~~~l~FAGEat~~~~~~Tv~GA~~SG~RaA~~i~~  533 (539)
T PLN02568        478 -DLDRMAEPLPRISDHDQAGGPPLQLLFAGEATHRTHYSTTHGAYFSGLREANRLLQ  533 (539)
T ss_pred             -HHHHHhCccccccccccccCCCccEEEeecccCCCccchHHHHHHHHHHHHHHHHH
Confidence             67899999962       11234899999999999999999999999999999985

>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
2xaf_A852 Crystal Structure Of Lsd1-Corest In Complex With Pa 1e-06
2v1d_A730 Structural Basis Of Lsd1-Corest Selectivity In Hist 2e-06
2dw4_A660 Crystal Structure Of Human Lsd1 At 2.3 A Resolution 2e-06
2iw5_A666 Structural Basis For Corest-dependent Demethylation 2e-06
2x0l_A734 Crystal Structure Of A Neuro-Specific Splicing Vari 2e-06
2ejr_A662 Lsd1-Tranylcypromine Complex Length = 662 2e-06
2hko_A664 Crystal Structure Of Lsd1 Length = 664 2e-06
2h94_A664 Crystal Structure And Mechanism Of Human Lysine-Spe 2e-06
3kpf_A478 X-Ray Structure Of The Mutant Lys300met Of Polyamin 2e-05
1b37_A472 A 30 Angstrom U-Shaped Catalytic Tunnel In The Crys 3e-05
4gur_A776 Crystal Structure Of Lsd2-npac With H3 In Space Gro 6e-05
4gu1_A784 Crystal Structure Of Lsd2 Length = 784 7e-05
4fwe_A796 Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup 7e-05
>pdb|2XAF|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine Length = 852 Back     alignment and structure 
Iteration: 1

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 14/116 (12%)
Query: 1   MESLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSI---------R 51
           ME+++D  +    +   +   G+   +P+P   + + W ++   RGSYS           
Sbjct: 715 MENISDDVIVGRCLAILKGIFGSS-AVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDY 773
Query: 52  TLTTERLNTSAAELGAPVSNGMGKPVLLFAGEATSEDQYATVNGAIETGWREADRI 107
            L  + +    +  GAP       P L FAGE T  +  ATV+GA+ +G REA RI
Sbjct: 774 DLMAQPITPGPSIPGAP----QPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRI 825
>pdb|2V1D|A Chain A, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 730 Back     alignment and structure
>pdb|2DW4|A Chain A, Crystal Structure Of Human Lsd1 At 2.3 A Resolution Length = 660 Back     alignment and structure
>pdb|2IW5|A Chain A, Structural Basis For Corest-dependent Demethylation Of Nucleosomes By The Human Lsd1 Histone Demethylase Length = 666 Back     alignment and structure
>pdb|2X0L|A Chain A, Crystal Structure Of A Neuro-Specific Splicing Variant Of Human Histone Lysine Demethylase Lsd1 Length = 734 Back     alignment and structure
>pdb|2EJR|A Chain A, Lsd1-Tranylcypromine Complex Length = 662 Back     alignment and structure
>pdb|2HKO|A Chain A, Crystal Structure Of Lsd1 Length = 664 Back     alignment and structure
>pdb|2H94|A Chain A, Crystal Structure And Mechanism Of Human Lysine-Specific Demethylase-1 Length = 664 Back     alignment and structure
>pdb|3KPF|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine Oxidase From Zea Mays Length = 478 Back     alignment and structure
>pdb|1B37|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase Length = 472 Back     alignment and structure
>pdb|4GUR|A Chain A, Crystal Structure Of Lsd2-npac With H3 In Space Group P21 Length = 776 Back     alignment and structure
>pdb|4GU1|A Chain A, Crystal Structure Of Lsd2 Length = 784 Back     alignment and structure
>pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of C2221 At 2.13a Length = 796 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 1e-27
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 6e-27
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 3e-26
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 4e-24
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 2e-23
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 7e-23
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 2e-19
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 1e-16
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 4e-16
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 1e-13
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 1e-12
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
 Score =  104 bits (260), Expect = 1e-27
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 6/114 (5%)

Query: 1   MESLTDKQVQIEVMKAFRFFLGAKYTIPEPARILTTSWGSNKHFRGSYSIRTLTT----- 55
           ME+++D  +    +   +   G+   +P+P   + + W ++   RGSYS     +     
Sbjct: 544 MENISDDVIVGRCLAILKGIFGSS-AVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDY 602

Query: 56  ERLNTSAAELGAPVSNGMGKPVLLFAGEATSEDQYATVNGAIETGWREADRILK 109
           + +        +        P L FAGE T  +  ATV+GA+ +G REA RI  
Sbjct: 603 DLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIAD 656
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.94
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 99.92
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 99.91
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.91
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.89
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.88
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.86
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.84
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.82
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.81
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.79
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.73
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 99.52
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.21
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.11
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.03
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.96
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.93
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.64
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.52
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.35
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.31
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.24
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 97.9
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.85
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.43
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 96.67
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 95.89
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 90.22
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 87.98
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 86.83
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 86.0
2cul_A232 Glucose-inhibited division protein A-related PROT 85.4
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 85.05
2gqf_A401 Hypothetical protein HI0933; structural genomics, 84.39
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 83.71
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 80.42
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 80.27
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
Probab=99.94  E-value=6.4e-28  Score=163.39  Aligned_cols=97  Identities=23%  Similarity=0.186  Sum_probs=85.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHhCCCCCCCcccee--eccccCCCCCCCcccCCCCCCcccccccHHHhcCccCCCCCCCcEE
Q psy7655           2 ESLTDKQVQIEVMKAFRFFLGAKYTIPEPARI--LTTSWGSNKHFRGSYSIRTLTTERLNTSAAELGAPVSNGMGKPVLL   79 (110)
Q Consensus         2 ~~ls~e~~~~~~~~~L~~~fg~~~~~~~~~~~--~~~~W~~dp~~~G~ys~~~~g~~~~~~~~~~l~~p~~~~~~~~rl~   79 (110)
                      +.|+++++++.++++|+++||  +++..+..+  +.++|.+|||++|+|++++||+...  ..+.|++|++      |||
T Consensus        52 ~~l~~~e~~~~~l~~L~~~~g--~~~~~~~~~~~~~~~W~~dp~~~Ga~s~~~pg~~~~--~~~~l~~p~g------rl~  121 (181)
T 2e1m_C           52 DSFDDAERYGYALENLQSVHG--RRIEVFYTGAGQTQSWLRDPYACGEAAVYTPHQMTA--FHLDVVRPEG------PVY  121 (181)
T ss_dssp             TTSCTTTTHHHHHHHHHHHHC--GGGGGTEEEEEEEEESSSCTTTSSSEECCCTTHHHH--HHHHHHSCBT------TEE
T ss_pred             HcCCHHHHHHHHHHHHHHHhC--CCcHhhccCcceecccCCCCCCCCcccCcCCCchHH--HHHHHhCCCC------cEE
Confidence            578999999999999999997  455333477  9999999999999999999998753  5678999984      899


Q ss_pred             EcccccccccccchhHHHHHHHHHHHHHHc
Q psy7655          80 FAGEATSEDQYATVNGAIETGWREADRILK  109 (110)
Q Consensus        80 FAGe~ts~~~~g~~~GA~~SG~raA~~i~~  109 (110)
                      ||||||+. ++||||||++||+|+|++|++
T Consensus       122 FAGe~ts~-~~g~~eGAl~SG~raA~~i~~  150 (181)
T 2e1m_C          122 FAGEHVSL-KHAWIEGAVETAVRAAIAVNE  150 (181)
T ss_dssp             ECSGGGTT-STTSHHHHHHHHHHHHHHHHT
T ss_pred             EEEHHHcC-CccCHHHHHHHHHHHHHHHHH
Confidence            99999996 999999999999999999985
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 110
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 1e-11
d2dw4a3109 d.16.1.5 (A:655-763) Lysine-specific histone demet 2e-08
d1b5qa2112 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea 6e-08
d2v5za2112 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (H 6e-07
d2iida2113 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan 5e-05
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 4e-04
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 57.6 bits (137), Expect = 1e-11
 Identities = 20/82 (24%), Positives = 29/82 (35%), Gaps = 1/82 (1%)

Query: 29  EPARILTTSWGSNKHFRGSY-SIRTLTTERLNTSAAELGAPVSNGMGKPVLLFAGEATSE 87
                    W ++   R           + +        +        P L FAGE T  
Sbjct: 364 VQFVPPLPEWKTSAVQRMVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIR 423

Query: 88  DQYATVNGAIETGWREADRILK 109
           +  ATV+GA+ +G REA RI  
Sbjct: 424 NYPATVHGALLSGLREAGRIAD 445
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 112 Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 113 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 99.45
d2dw4a3109 Lysine-specific histone demethylase 1, LSD1 {Human 99.44
d2v5za2112 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.41
d1b5qa2112 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.37
d2iida2113 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.09
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.5
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.07
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.91
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.82
d2ivda2108 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.35
d1seza2112 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.84
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 91.41
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 88.11
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.45  E-value=1.1e-14  Score=99.26  Aligned_cols=71  Identities=31%  Similarity=0.327  Sum_probs=49.4

Q ss_pred             ceeeccccCCCCCCCcccCCCC---------CCcccccccHHHhcCccCCCCCCCcEEEcccccccccccchhHHHHHHH
Q psy7655          31 ARILTTSWGSNKHFRGSYSIRT---------LTTERLNTSAAELGAPVSNGMGKPVLLFAGEATSEDQYATVNGAIETGW  101 (110)
Q Consensus        31 ~~~~~~~W~~dp~~~G~ys~~~---------~g~~~~~~~~~~l~~p~~~~~~~~rl~FAGe~ts~~~~g~~~GA~~SG~  101 (110)
                      .....++|..+++.++.+....         |....  ...+.+++|++      +||||||+|+..++||||||+.||+
T Consensus       366 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~--~~~~~~~~~~~------~l~fAGe~t~~~~~g~~~GA~~SG~  437 (449)
T d2dw4a2         366 FVPPLPEWKTSAVQRMVAAGSSGNDYDLMAQPITPG--PSIPGAPQPIP------RLFFAGEHTIRNYPATVHGALLSGL  437 (449)
T ss_dssp             EESCCCHHHHHHHHHSCBTTCCHHHHHHHHCCBCC-----------CCC------CEEECSGGGCTTSCSSHHHHHHHHH
T ss_pred             cCcccccchhhhhhcccccccccchhhhhcCCcccc--ccchhhcCCCC------CEEEEcCCcCCCCceehHHHHHHHH
Confidence            3445678999999877765332         22211  13455666774      8999999999999999999999999


Q ss_pred             HHHHHHHc
Q psy7655         102 READRILK  109 (110)
Q Consensus       102 raA~~i~~  109 (110)
                      |||++|++
T Consensus       438 ~aA~~Il~  445 (449)
T d2dw4a2         438 REAGRIAD  445 (449)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
Confidence            99999985
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure