Psyllid ID: psy7726

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLLKATLIAVRYSTVRKQFGEDREGRETSVIEYQTQIPR
ccccEEEEccccHHcccccccccccEEEcccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEcccccccccEEEEEccccccc
ccccccEccHHHHHHHcccccccccEEcccccHcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccc
mmfshywvprcsllarfssvspqgdysslipdpglrfassliplflgRWCVLGCTWGNLLKATLIAVRYSTVRKqfgedregreTSVIEYQTQIPR
MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLLKATLIAVRYSTVrkqfgedregretsvieyqtqipr
MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLLKATLIAVRYSTVRKQFGEDREGRETSVIEYQTQIPR
**FSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLLKATLIAVRYSTVRKQ*********************
MMFSHYWVPRCSLLARFSSVSPQGDY*********RFASSLIPLFLGRWCVLGCTWGNLLKATLIAVRYSTVR*************VIEYQTQI**
MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLLKATLIAVRYSTVRKQFGEDREGRETSVIEYQTQIPR
MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLLKATLIAVRYSTVRKQFGEDREGRETSVIEYQT****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLLKATLIAVRYSTVRKQFGEDREGRETSVIEYQTQIPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
O64894 690 Acyl-coenzyme A oxidase, N/A N/A 0.958 0.133 0.387 6e-10
O15254 700 Peroxisomal acyl-coenzyme no N/A 0.947 0.13 0.423 6e-10
O65201 692 Acyl-coenzyme A oxidase 2 yes N/A 0.958 0.132 0.376 9e-10
Q9NUZ1 547 Acyl-coenzyme A oxidase-l no N/A 0.989 0.173 0.375 2e-09
Q9DBS4 632 Acyl-coenzyme A oxidase-l yes N/A 0.979 0.148 0.381 2e-09
O65202 664 Peroxisomal acyl-coenzyme no N/A 0.937 0.135 0.357 2e-08
Q9ZQP2 664 Putative peroxisomal acyl no N/A 0.958 0.138 0.354 2e-08
Q5RAU0 700 Peroxisomal acyl-coenzyme yes N/A 0.947 0.13 0.391 3e-08
Q54GQ6 700 Peroxisomal acyl-coenzyme no N/A 0.937 0.128 0.346 2e-07
Q9EPL9 700 Peroxisomal acyl-coenzyme no N/A 0.937 0.128 0.376 3e-07
>sp|O64894|ACOX2_CUCMA Acyl-coenzyme A oxidase, peroxisomal OS=Cucurbita maxima GN=Acx PE=1 SV=1 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 36/93 (38%), Positives = 54/93 (58%), Gaps = 1/93 (1%)

Query: 1   MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLL 60
           + F    +PR +LL RF  VS  G Y S +P    RFA++L  L  GR  +   +   L 
Sbjct: 291 LRFRSVRIPRDNLLNRFGEVSRDGKYKSSLPSINKRFAATLGELVGGRVGLAYSSASVLK 350

Query: 61  KATLIAVRYSTVRKQFGEDREGRETSVIEYQTQ 93
            A+ IA+RYS +R+QFG  ++  E S+++YQ+Q
Sbjct: 351 IASTIAIRYSLLRQQFGPPKQ-PEVSILDYQSQ 382
Catalyzes the desaturation of long-chain acyl-CoAs to 2-trans-enoyl-CoAs.
Cucurbita maxima (taxid: 3661)
EC: 1EC: .EC: 3EC: .EC: 3EC: .EC: 6
>sp|O15254|ACOX3_HUMAN Peroxisomal acyl-coenzyme A oxidase 3 OS=Homo sapiens GN=ACOX3 PE=1 SV=2 Back     alignment and function description
>sp|O65201|ACOX2_ARATH Acyl-coenzyme A oxidase 2, peroxisomal OS=Arabidopsis thaliana GN=ACX2 PE=1 SV=2 Back     alignment and function description
>sp|Q9NUZ1|ACOXL_HUMAN Acyl-coenzyme A oxidase-like protein OS=Homo sapiens GN=ACOXL PE=2 SV=3 Back     alignment and function description
>sp|Q9DBS4|ACOXL_MOUSE Acyl-coenzyme A oxidase-like protein OS=Mus musculus GN=Acoxl PE=2 SV=1 Back     alignment and function description
>sp|O65202|ACOX1_ARATH Peroxisomal acyl-coenzyme A oxidase 1 OS=Arabidopsis thaliana GN=ACX1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZQP2|ACO12_ARATH Putative peroxisomal acyl-coenzyme A oxidase 1.2 OS=Arabidopsis thaliana GN=ACX1.2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RAU0|ACOX3_PONAB Peroxisomal acyl-coenzyme A oxidase 3 OS=Pongo abelii GN=ACOX3 PE=2 SV=1 Back     alignment and function description
>sp|Q54GQ6|ACOX1_DICDI Peroxisomal acyl-coenzyme A oxidase 1 OS=Dictyostelium discoideum GN=acox1 PE=3 SV=1 Back     alignment and function description
>sp|Q9EPL9|ACOX3_MOUSE Peroxisomal acyl-coenzyme A oxidase 3 OS=Mus musculus GN=Acox3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
242013527 686 Acyl-coenzyme A oxidase 3, peroxisomal, 0.937 0.131 0.489 1e-14
312372728 798 hypothetical protein AND_19780 [Anophele 0.947 0.114 0.439 4e-14
158297173 706 AGAP008016-PA [Anopheles gambiae str. PE 0.947 0.128 0.439 7e-14
195432840 695 GK23839 [Drosophila willistoni] gi|19416 0.947 0.130 0.417 1e-13
195398099 695 GJ17979 [Drosophila virilis] gi|19414131 0.947 0.130 0.417 1e-13
194879616 693 GG21636 [Drosophila erecta] gi|190657453 0.947 0.131 0.417 1e-13
195484433 693 GE12655 [Drosophila yakuba] gi|194176793 0.947 0.131 0.417 1e-13
194759294 691 GF15197 [Drosophila ananassae] gi|190615 0.947 0.131 0.417 1e-13
195164646 697 GL21109 [Drosophila persimilis] gi|19847 0.947 0.130 0.417 2e-13
195345075 693 GM17014 [Drosophila sechellia] gi|194134 0.947 0.131 0.417 2e-13
>gi|242013527|ref|XP_002427456.1| Acyl-coenzyme A oxidase 3, peroxisomal, putative [Pediculus humanus corporis] gi|212511842|gb|EEB14718.1| Acyl-coenzyme A oxidase 3, peroxisomal, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 83.6 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 45/92 (48%), Positives = 58/92 (63%), Gaps = 2/92 (2%)

Query: 2   MFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLLK 61
           +F++Y +P+ SLL +   VS  G Y S I DP  RF +SL  L  GR  ++    GNL+K
Sbjct: 261 IFNNYRIPKDSLLDKNGKVSSSGKYISCIKDPRKRFGASLGSLVAGRMAIVNICTGNLVK 320

Query: 62  ATLIAVRYSTVRKQFGEDREGRETSVIEYQTQ 93
           A  IA+RYS+VRKQFG D +  E  VIEYQ Q
Sbjct: 321 AISIAIRYSSVRKQFGPDED--ELPVIEYQLQ 350

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|312372728|gb|EFR20624.1| hypothetical protein AND_19780 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158297173|ref|XP_317446.4| AGAP008016-PA [Anopheles gambiae str. PEST] gi|157015067|gb|EAA12406.4| AGAP008016-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195432840|ref|XP_002064424.1| GK23839 [Drosophila willistoni] gi|194160509|gb|EDW75410.1| GK23839 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195398099|ref|XP_002057662.1| GJ17979 [Drosophila virilis] gi|194141316|gb|EDW57735.1| GJ17979 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194879616|ref|XP_001974266.1| GG21636 [Drosophila erecta] gi|190657453|gb|EDV54666.1| GG21636 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195484433|ref|XP_002090692.1| GE12655 [Drosophila yakuba] gi|194176793|gb|EDW90404.1| GE12655 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194759294|ref|XP_001961884.1| GF15197 [Drosophila ananassae] gi|190615581|gb|EDV31105.1| GF15197 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195164646|ref|XP_002023157.1| GL21109 [Drosophila persimilis] gi|198473366|ref|XP_001356272.2| GA14550 [Drosophila pseudoobscura pseudoobscura] gi|194105242|gb|EDW27285.1| GL21109 [Drosophila persimilis] gi|198139423|gb|EAL33335.2| GA14550 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195345075|ref|XP_002039101.1| GM17014 [Drosophila sechellia] gi|194134231|gb|EDW55747.1| GM17014 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
FB|FBgn0032775 693 CG17544 [Drosophila melanogast 0.947 0.131 0.417 2.4e-13
FB|FBgn0031813 724 CG9527 [Drosophila melanogaste 0.968 0.128 0.397 1.7e-11
UNIPROTKB|F1MQG3 633 ACOX3 "Acyl-coenzyme A oxidase 0.937 0.142 0.408 9.4e-10
ZFIN|ZDB-GENE-040426-2163 692 acox3 "acyl-Coenzyme A oxidase 0.947 0.131 0.402 1.8e-09
UNIPROTKB|F1N6R7 580 ACOXL "Acyl-coenzyme A oxidase 0.989 0.163 0.385 2.9e-09
UNIPROTKB|O15254 700 ACOX3 "Peroxisomal acyl-coenzy 0.947 0.13 0.423 2.9e-09
UNIPROTKB|F1S7X9 461 ACOX3 "Uncharacterized protein 0.947 0.197 0.391 3.2e-09
UNIPROTKB|E1C1E9 709 ACOX3 "Acyl-coenzyme A oxidase 0.947 0.128 0.413 3.8e-09
TAIR|locus:2171825 692 ACX2 "acyl-CoA oxidase 2" [Ara 0.958 0.132 0.376 7.7e-09
UNIPROTKB|Q9NUZ1 547 ACOXL "Acyl-coenzyme A oxidase 0.989 0.173 0.375 1.2e-08
FB|FBgn0032775 CG17544 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 185 (70.2 bits), Expect = 2.4e-13, P = 2.4e-13
 Identities = 38/91 (41%), Positives = 58/91 (63%)

Query:     1 MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLL 60
             ++F++Y +PR +LL R S V+P+G Y S+  +PG    ++L     GR  ++  +   L 
Sbjct:   261 VVFTNYRIPRDNLLNRTSDVTPEGVYESVFTEPGKVLGAALESFSAGRIGIMQESANTLC 320

Query:    61 KATLIAVRYSTVRKQFGEDREGRETSVIEYQ 91
              A +IAVRYS VRKQFG +R G E +++EYQ
Sbjct:   321 SAAVIAVRYSAVRKQFGPERHGEEMAILEYQ 351
GO:0016402 "pristanoyl-CoA oxidase activity" evidence=ISS
GO:0006635 "fatty acid beta-oxidation" evidence=IEA
GO:0005777 "peroxisome" evidence=IEA
GO:0003995 "acyl-CoA dehydrogenase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
FB|FBgn0031813 CG9527 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MQG3 ACOX3 "Acyl-coenzyme A oxidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2163 acox3 "acyl-Coenzyme A oxidase 3, pristanoyl" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N6R7 ACOXL "Acyl-coenzyme A oxidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O15254 ACOX3 "Peroxisomal acyl-coenzyme A oxidase 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7X9 ACOX3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1E9 ACOX3 "Acyl-coenzyme A oxidase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:2171825 ACX2 "acyl-CoA oxidase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NUZ1 ACOXL "Acyl-coenzyme A oxidase-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
cd01150 610 cd01150, AXO, Peroxisomal acyl-CoA oxidase 1e-24
PLN02636 686 PLN02636, PLN02636, acyl-coenzyme A oxidase 4e-15
PLN02443 664 PLN02443, PLN02443, acyl-coenzyme A oxidase 4e-12
PTZ00460 646 PTZ00460, PTZ00460, acyl-CoA dehydrogenase; Provis 7e-11
PLN02312 680 PLN02312, PLN02312, acyl-CoA oxidase 1e-08
>gnl|CDD|173839 cd01150, AXO, Peroxisomal acyl-CoA oxidase Back     alignment and domain information 
 Score = 95.5 bits (238), Expect = 1e-24
 Identities = 36/93 (38%), Positives = 50/93 (53%)

Query: 1   MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLL 60
           + F +  +PR +LL RF  VSP G Y S   DP  R+ + L     GR  ++     +L 
Sbjct: 242 LQFRNVRIPRENLLNRFGDVSPDGTYVSPFKDPNKRYGAMLGTRSGGRVGLIYDAAMSLK 301

Query: 61  KATLIAVRYSTVRKQFGEDREGRETSVIEYQTQ 93
           KA  IA+RYS VR+QFG      E  +++YQ Q
Sbjct: 302 KAATIAIRYSAVRRQFGPKPSDPEVQILDYQLQ 334

Peroxisomal acyl-CoA oxidases (AXO) catalyze the first set in the peroxisomal fatty acid beta-oxidation, the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. In a second oxidative half-reaction, the reduced FAD is reoxidized by molecular oxygen. AXO is generally a homodimer, but it has been reported to form a different type of oligomer in yeast. There are several subtypes of AXO's, based on substrate specificity. Palmitoyl-CoA oxidase acts on straight-chain fatty acids and prostanoids; whereas, the closely related Trihydroxycoprostanoly-CoA oxidase has the greatest activity for 2-methyl branched side chains of bile precursors. Pristanoyl-CoA oxidase, acts on 2-methyl branched fatty acids. AXO has an additional domain, C-terminal to the region with similarity to acyl-CoA dehydrogenases, which is included in this alignment. Length = 610
>gnl|CDD|215342 PLN02636, PLN02636, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|178062 PLN02443, PLN02443, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|185639 PTZ00460, PTZ00460, acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215178 PLN02312, PLN02312, acyl-CoA oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
KOG0135|consensus 661 99.95
PLN02312 680 acyl-CoA oxidase 99.93
PLN02636 686 acyl-coenzyme A oxidase 99.92
cd01150 610 AXO Peroxisomal acyl-CoA oxidase. Peroxisomal acyl 99.91
PTZ00460 646 acyl-CoA dehydrogenase; Provisional 99.87
KOG0139|consensus398 99.83
PLN02443 664 acyl-coenzyme A oxidase 99.82
KOG0140|consensus408 99.81
KOG0136|consensus 670 99.78
TIGR03203378 pimD_small pimeloyl-CoA dehydrogenase, small subun 99.7
KOG0141|consensus421 99.67
PRK09463 777 fadE acyl-CoA dehydrogenase; Reviewed 99.63
PRK13026 774 acyl-CoA dehydrogenase; Reviewed 99.63
COG1960393 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] 99.55
TIGR03207372 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogen 99.55
cd01157378 MCAD Medium chain acyl-CoA dehydrogenase. MCADs ar 99.52
PRK03354380 crotonobetainyl-CoA dehydrogenase; Validated 99.52
TIGR03204 395 pimC_large pimeloyl-CoA dehydrogenase, large subun 99.51
cd01162375 IBD Isobutyryl-CoA dehydrogenase. Isobutyryl-CoA d 99.51
PRK12341381 putative acyl-CoA dehydrogenase; Provisional 99.51
cd01155394 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE 99.5
cd01160372 LCAD Long chain acyl-CoA dehydrogenase. LCAD is an 99.5
cd01161409 VLCAD Very long chain acyl-CoA dehydrogenase. VLCA 99.49
PLN02876 822 acyl-CoA dehydrogenase 99.49
PTZ00461410 isovaleryl-CoA dehydrogenase; Provisional 99.49
cd01156376 IVD Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA d 99.48
cd01151386 GCD Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehyd 99.45
PLN02519404 isovaleryl-CoA dehydrogenase 99.44
PLN02526 412 acyl-coenzyme A oxidase 99.41
cd01158373 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and 99.39
KOG0138|consensus 432 99.39
cd00567327 ACAD Acyl-CoA dehydrogenase. Both mitochondrial ac 99.36
KOG0137|consensus 634 99.36
PRK11561 538 isovaleryl CoA dehydrogenase; Provisional 99.31
cd01153 407 ACAD_fadE5 Putative acyl-CoA dehydrogenases simila 99.26
cd01154 418 AidB Proteins involved in DNA damage response, sim 99.23
cd01159 370 NcnH Naphthocyclinone hydroxylase. Naphthocyclinon 99.1
cd01163 377 DszC Dibenzothiophene (DBT) desulfurization enzyme 99.07
PTZ00456 622 acyl-CoA dehydrogenase; Provisional 99.03
cd01152 380 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases 99.03
PF00441150 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal 98.94
KOG1469|consensus 392 98.94
PTZ00457 520 acyl-CoA dehydrogenase; Provisional 98.64
TIGR02309 477 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxy 98.51
PF08028134 Acyl-CoA_dh_2: Acyl-CoA dehydrogenase, C-terminal 95.7
>KOG0135|consensus Back     alignment and domain information 
Probab=99.95  E-value=1.4e-29  Score=190.84  Aligned_cols=96  Identities=41%  Similarity=0.658  Sum_probs=93.9

Q ss_pred             CcccceeeCcccccCccCCCCCCCccccCCCChhhHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcCCCC
Q psy7726           1 MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLLKATLIAVRYSTVRKQFGEDR   80 (96)
Q Consensus         1 l~F~~vrVP~~~lLg~~~~v~~~G~~~~~~~~~~~~f~~~~~~l~~~R~~~aa~a~g~~~~a~~~a~~ya~~R~qfg~~~   80 (96)
                      ++|+|||||+||||++.++|++||+|.+++++++++|..+++.|..||++++..+++.+.-+++||+||+..|+|||++.
T Consensus       264 l~F~nvRIPRenLLNr~gDVtpDG~YvSs~k~~~qrfgA~L~~Ls~GRvgIa~~ai~~lkla~tIAIRYS~sRRQFGP~~  343 (661)
T KOG0135|consen  264 LWFDNVRIPRENLLNRFGDVTPDGKYVSSFKDPSQRFGASLGSLSSGRVGIASSAIGALKLALTIAIRYSLSRRQFGPTK  343 (661)
T ss_pred             EEEecccCchHHHhhhccCcCCCCeeeccCCChhhhhchhhcccccchhHHHHHHHHHHHHHHHHhhhhHHhHhhhCCCC
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCcccchhhhhccccC
Q psy7726          81 EGRETSVIEYQTQIPR   96 (96)
Q Consensus        81 ~~~e~~i~~~q~~q~~   96 (96)
                      .++|+||+|||+||+|
T Consensus       344 ~geEv~iLeYp~qQ~R  359 (661)
T KOG0135|consen  344 NGEEVPILEYPSQQYR  359 (661)
T ss_pred             CCCcceeeechhHHHH
Confidence            8899999999999986

>PLN02312 acyl-CoA oxidase Back     alignment and domain information
>PLN02636 acyl-coenzyme A oxidase Back     alignment and domain information
>cd01150 AXO Peroxisomal acyl-CoA oxidase Back     alignment and domain information
>PTZ00460 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>KOG0139|consensus Back     alignment and domain information
>PLN02443 acyl-coenzyme A oxidase Back     alignment and domain information
>KOG0140|consensus Back     alignment and domain information
>KOG0136|consensus Back     alignment and domain information
>TIGR03203 pimD_small pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>KOG0141|consensus Back     alignment and domain information
>PRK09463 fadE acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>PRK13026 acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>COG1960 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>TIGR03207 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>cd01157 MCAD Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>PRK03354 crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03204 pimC_large pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>cd01162 IBD Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK12341 putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01155 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>cd01160 LCAD Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>cd01161 VLCAD Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PTZ00461 isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01156 IVD Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>cd01151 GCD Glutaryl-CoA dehydrogenase Back     alignment and domain information
>PLN02519 isovaleryl-CoA dehydrogenase Back     alignment and domain information
>PLN02526 acyl-coenzyme A oxidase Back     alignment and domain information
>cd01158 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>KOG0138|consensus Back     alignment and domain information
>cd00567 ACAD Acyl-CoA dehydrogenase Back     alignment and domain information
>KOG0137|consensus Back     alignment and domain information
>PRK11561 isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01153 ACAD_fadE5 Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>cd01154 AidB Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>cd01159 NcnH Naphthocyclinone hydroxylase Back     alignment and domain information
>cd01163 DszC Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>PTZ00456 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01152 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>PF00441 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR006090 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>KOG1469|consensus Back     alignment and domain information
>PTZ00457 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>TIGR02309 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component Back     alignment and domain information
>PF08028 Acyl-CoA_dh_2: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR013107 Acyl Co-A dehydrogenases (1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1w07_A 659 Arabidopsis Thaliana Acyl-Coa Oxidase 1 Length = 65 1e-09
2fon_A 683 X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxid 1e-08
1is2_A 661 Crystal Structure Of Peroxisomal Acyl-coa Oxidase-i 2e-05
>pdb|1W07|A Chain A, Arabidopsis Thaliana Acyl-Coa Oxidase 1 Length = 659 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 35/98 (35%), Positives = 52/98 (53%), Gaps = 8/98 (8%)
Query: 1   MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPD--PGLRFASSLIPLFLGRWCVLGCTWGN 58
           +MF H  +PR  +L R S V+ +G+Y   +P   P      +++ +   R  ++      
Sbjct: 242 LMFDHVRIPRDQMLMRLSKVTREGEY---VPSDVPKQLVYGTMVYV---RQTIVADASNA 295
Query: 59  LLKATLIAVRYSTVRKQFGEDREGRETSVIEYQTQIPR 96
           L +A  IA RYS VR+QFG    G ET VI+Y+TQ  R
Sbjct: 296 LSRAVCIATRYSAVRRQFGAHNGGIETQVIDYKTQQNR 333
>pdb|2FON|A Chain A, X-Ray Crystal Structure Of Leacx1, An Acyl-Coa Oxidase From Lycopersicon Esculentum (Tomato) Length = 683 Back     alignment and structure
>pdb|1IS2|A Chain A, Crystal Structure Of Peroxisomal Acyl-coa Oxidase-ii From Rat Liver Length = 661 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 5e-23
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 2e-21
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Length = 659 Back     alignment and structure
 Score = 90.4 bits (224), Expect = 5e-23
 Identities = 33/93 (35%), Positives = 48/93 (51%), Gaps = 4/93 (4%)

Query: 1   MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLL 60
           +MF H  +PR  +L R S V+ +G+Y        L + +    +   R  ++      L 
Sbjct: 242 LMFDHVRIPRDQMLMRLSKVTREGEYVPSDVPKQLVYGT----MVYVRQTIVADASNALS 297

Query: 61  KATLIAVRYSTVRKQFGEDREGRETSVIEYQTQ 93
           +A  IA RYS VR+QFG    G ET VI+Y+TQ
Sbjct: 298 RAVCIATRYSAVRRQFGAHNGGIETQVIDYKTQ 330
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Length = 661 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 99.72
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 99.69
2jif_A404 Short/branched chain specific acyl-COA dehydrogen; 99.63
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 99.63
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 99.62
3mkh_A 438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 99.62
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSF 99.62
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 99.62
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSF 99.62
2pg0_A385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 99.61
2wbi_A 428 Acyl-COA dehydrogenase family member 11; human, ph 99.61
4hr3_A 415 Putative acyl-COA dehydrogenase; ssgcid, seattle s 99.61
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondr 99.61
3r7k_A403 Probable acyl COA dehydrogenase; ssgcid, structura 99.61
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, 99.61
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structura 99.6
2vig_A 391 Short-chain specific acyl-COA dehydrogenase,; fatt 99.6
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seatt 99.6
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 99.6
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomic 99.6
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 99.6
3swo_A 399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 99.58
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acy 99.58
3mpi_A 397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 99.58
2ix5_A 436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 99.57
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus therm 99.57
3sf6_A403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 99.57
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 99.55
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 99.55
1siq_A 392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 99.54
2c12_A 439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 99.52
2or0_A 414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 99.44
2rfq_A 394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 99.44
2jbr_A 422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 99.4
3djl_A 541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 99.16
3mxl_A 395 Nitrososynthase; flavin monooxygenase, acyl-COA de 99.11
3m9v_A 439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 99.03
2yyk_A 481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 98.74
1u8v_A 490 Gamma-aminobutyrate metabolism dehydratase/isomera 98.43
4g5e_A 517 2,4,6-trichlorophenol 4-monooxygenase; oxidoreduct 98.34
3hwc_A 515 Chlorophenol-4-monooxygenase component 2; beta bar 98.32
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Back     alignment and structure
Probab=99.72  E-value=3.2e-18  Score=132.37  Aligned_cols=91  Identities=27%  Similarity=0.461  Sum_probs=73.9

Q ss_pred             CcccceeeCcccccCccCCCCCCCccccCCCChhhHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcCCCC
Q psy7726           1 MMFSHYWVPRCSLLARFSSVSPQGDYSSLIPDPGLRFASSLIPLFLGRWCVLGCTWGNLLKATLIAVRYSTVRKQFGEDR   80 (96)
Q Consensus         1 l~F~~vrVP~~~lLg~~~~v~~~G~~~~~~~~~~~~f~~~~~~l~~~R~~~aa~a~g~~~~a~~~a~~ya~~R~qfg~~~   80 (96)
                      |.||||+||++++||++++|+++|.+.+++     .+...+..|..+|+.+++.++|.++.|+++|++|+..|+|||++.
T Consensus       240 v~Fd~VrVP~~~lLg~~~~v~~~G~~~~~~-----~~~~~~~~l~~~R~~iaa~~~G~a~~al~~a~~ya~~R~qfg~~~  314 (661)
T 2ddh_A          240 LKMDNYRIPRENMLMKYAQVKPDGTYVKPL-----SNKLTYGTMVFVRSFLVGNAAQSLSKACTIAIRYSAVRRQSEIKQ  314 (661)
T ss_dssp             EEESSEEEEGGGBCCSSCEECTTCCEECCC-------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCBCSCSST
T ss_pred             EEeccEEECHHHhcCcccccCCCCceeccc-----hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCcccCCCC
Confidence            479999999999999987777678765432     244677889999999999999999999999999999999999866


Q ss_pred             CCcccchhhhhccccC
Q psy7726          81 EGRETSVIEYQTQIPR   96 (96)
Q Consensus        81 ~~~e~~i~~~q~~q~~   96 (96)
                      +++|.||++||.+|++
T Consensus       315 ~~~e~~i~~~q~vq~r  330 (661)
T 2ddh_A          315 SEPEPQILDFQTQQYK  330 (661)
T ss_dssp             TSCCCBGGGSHHHHHH
T ss_pred             CCccccccccHHHHHH
Confidence            6788999999999974
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Back     alignment and structure
>4hr3_A Putative acyl-COA dehydrogenase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: FAD; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>4g5e_A 2,4,6-trichlorophenol 4-monooxygenase; oxidoreductase; 2.50A {Cupriavidus necator JMP134} Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d2ddha1 183 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase- 2e-06
d1w07a1 189 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, do 0.003
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 183 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Acyl-CoA dehydrogenase C-terminal domain-like
family: acyl-CoA oxidase C-terminal domains
domain: Peroxisomal acyl-CoA oxidase-II, domains 3 and 4
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 41.4 bits (96), Expect = 2e-06
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 48 RWCVLGCTWGNLLKATLIAVRYSTVRKQFGEDREGRETSVIEYQTQ 93
          R  ++G    +L KA  IA+RYS VR+Q    +   E  ++++QTQ
Sbjct: 5  RSFLVGNAAQSLSKACTIAIRYSAVRRQSEIKQSEPEPQILDFQTQ 50
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 189 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d1w07a1 189 Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale 99.55
d2ddha1 183 Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 { 99.44
d1rx0a1153 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 99.42
d1jqia1153 Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus n 99.41
d1ivha1151 Isovaleryl-CoA dehydrogenase, C-domain {Human (Hom 99.4
d3mdea1154 Medium chain acyl-CoA dehydrogenase, C-domain {Pig 99.4
d2d29a1153 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 99.39
d1buca1151 Butyryl-CoA dehydrogenase, C-domain {Megasphaera e 99.32
d1siqa1 154 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 99.32
d2c12a1 170 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 99.28
d1r2ja1153 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 99.28
d1ukwa1152 Medium chain acyl-CoA dehydrogenase, C-domain {The 99.27
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Acyl-CoA dehydrogenase C-terminal domain-like
family: acyl-CoA oxidase C-terminal domains
domain: Acyl-coenzyme A oxidase 1, domains 3 and 4
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.55  E-value=6.4e-16  Score=101.24  Aligned_cols=58  Identities=38%  Similarity=0.486  Sum_probs=51.7

Q ss_pred             HHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcCCCCCCcccchhhhhccccC
Q psy7726          39 SSLIPLFLGRWCVLGCTWGNLLKATLIAVRYSTVRKQFGEDREGRETSVIEYQTQIPR   96 (96)
Q Consensus        39 ~~~~~l~~~R~~~aa~a~g~~~~a~~~a~~ya~~R~qfg~~~~~~e~~i~~~q~~q~~   96 (96)
                      +++.+|+.+|+.+++.++|.+++|+++|++|+.+|+|||.+++++|.||++||.+|++
T Consensus         4 ~~~~~m~~~R~~ia~~a~g~~~~al~iA~~Ya~~R~qfG~~~~~~~~pI~~~q~vq~~   61 (189)
T d1w07a1           4 LVYGTMVYVRQTIVADASNALSRAVCIATRYSAVRRQFGAHNGGIETQVIDYKTQQNR   61 (189)
T ss_dssp             GCTTTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHCBCSCC---CCCCBGGGSHHHHHH
T ss_pred             hHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhccccCCCccchHHHHHHHHHH
Confidence            4678899999999999999999999999999999999998777888999999999974
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure