Psyllid ID: psy7773

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280-
TPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKEYHRNNTARTQKLNKAIINYHINAEKEQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKEHKEEQQKKMREEKKKKKKSIKQKILDGNMDKLDLDESSQLEDLRITVKETNSDNKLRGEDAPPAKQIKEWLASHPGWEVVMEDSEDEGSEDEEMKEKKEEPSKAVGEKKTEDDEYKDAGEEATYYSIAHTYHEKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTLSNWVLEFEKWAPSANVVAYKGSPLARRALQGRMKNSKFNVLLTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERHEFLQTILHQDDEEEEENEVPDDETVNQLIARTEDELTLFQKMDAERRKGETKPRLVEIKELPDWMVKDDDEVENSMYEEEREREKEEALMGRGSRQRKQVDYTDSLTDQEWLKAIEDDGADDYEEEEEEVKPVTKKRGSGKKGKKSYVEETAPEDEEEEKPVKKRRRRKKVQISDEDEDEEDESPKKKKRKSTKTPAKDKHKEDDEEKHVVSKRKKKVVEEEEEVEEAEGEEEEEDDKASKPRKS
ccccccHHHHHHHHHcccccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHcccccccEEEEEEcccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccHHHHHHccHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHccccccEEEccccccHHHHHHHHHHHccccccccEEEEcccccccccccccccEEEEccccccHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccccccccccHHHHHHccHHHccccccccEEEEcccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHccccccEEEcHHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHHHHccccEEEcccccccccHHHHHHHHHcccccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHcccccccEEEEEEcccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccHHHHHHccHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHccccccEEEccccccHHHHHHHHHHHccccccccEEEEcccccccccccccccEEEEEcccccHHHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHHHHHccHHHHHccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHccccccHHHHHHHccccccccccccccccccccccccccHHHHcHHHHHHHHccccccccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
cccHccHHHHHHHHHHHcHHHccccccHHHHHccccccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHcccEEEccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHccHHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHccccccEEEEEEEccccccccccccccEEEEEccccccHHHHHHHHHHHHccccccEEEEEEEEcccHHHHHHHHHHHHccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHHcccHcEcccccHHHccccccccHHHHHHHHHHccccccccccccccccccHHHHcccccccccccccHccccccHHHHHHHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHccccEEEEEEHHHHHHcHHHHHHccEEEEEEcccccccccccHHHHHHHHHcccccEEEEcccHcHccHHHHHHHHHHHcHHHccccccHHHHHccccccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHcccEEEccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcHccccccccccccHHHHHHcHHHHHHHHHHHHHccccEEEEHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHccccccEEEEEEEEcccccccccccccEEEEEccccccHHHHHHHHHHHHccccccEEEEEEEEcccHHHHHHHHHHHHccccHHEEEcccccccccHHHHHHHHHHHHHHcHHHHcccccccHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccccHHHHccccHHHHHHHHHHHHHcHHHHccccccccEEEEEccccccHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccc
TPLQNKLPELWALLNFLLPSIFKSCSTFEqwfnapfattgekvelneEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNrgilltdgsekgktgeggaRALKNTIVQLRKLCNHPFMFQNIEEKYCQhigqnntvvsgpdiyrtsgkfellDRILPKFKETKHRVLMFCQMTQLMTILEDYFiwrdfsylrldgttksedRGELLRKFNEPESKYFIFLLSTRagglglnlqaadtviifdsdwnphqdlqaQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMdekeyhrnnTARTQKLNKAIINYHINAEKEQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKEHKEEQQKKMREEKKKKKKSIKQKILdgnmdkldldessqleDLRITVKetnsdnklrgedappaKQIKEWLashpgwevvmedsedegsedeemkekkeepskavgekkteddeykdageeatYYSIAHTYHEKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLngilademglgktVQTIALLTYLMEKKknlgpylvivpLSTLSNWVLEFekwapsanvvaykgsplARRALQGRMKNSKFNVLLTTYEFIIKDKSVLSKIQWKCMIideghrmknhhcklTQTLNTFYNSSHRvlltgtplqnkLPELWALLNFLLPSIFKSCSTFEqwfnapfattgekvelneEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNrgilltdgsekgktgeggaRALKNTIVQLRKLCNHPFMFQNIEEKYCQhigqnntvvsgpdiyrtsgkfellDRILPKFKETKHRVLMFCQMTQLMTILEDYFiwrdfsylrldgttksedRGELLRKFNEPESKYFIFLLSTRagglglnlqaadtviifdsdwnphqdlqaQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKVIqagmfdqkstgseRHEFLQTILhqddeeeeenevpddetVNQLIARTEDELTLFQKMDAErrkgetkprlveikelpdwmvkdddeveNSMYEEEREREKEEALMgrgsrqrkqvdytdsltDQEWLKAIEddgaddyeeeeeevkpvtkkrgsgkkgkksyveetapedeeeekpvkkrrrrkkvqisdededeedespkkkkrkstktpakdkhkeddeekHVVSKRKKKVVEEEEeveeaegeeeeeddkaskprks
TPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNApfattgekveLNEEETILIIRRLHKVLRPFLLRRlkkevesqlpeKVEYIIKCDMSGLQKLLYQHLHNRGILltdgsekgktgeGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRahrigqknevrvlrlitvnsveeRILAAARyklnmdekeyhrnntartqkLNKAIINYHinaekeqkkeqERIEKERMrrlmaedeegyrklidqkkdKRLAFLLSQTDEYISNLTQMVKEHKEEQQKkmreekkkkkksikqkildgnmdkldldessqledlritvketnsdnklrgedappakQIKEWLASHPGWEVVMEDSedegsedeemkekkeepskavgekkteddeykdaGEEATYYSIAHTYHEKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTLSNWVLEFEKWAPSANVVAYKGSPLARRalqgrmknskfNVLLTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNApfattgekveLNEEETILIIRRLHKVLRPFLLRRlkkevesqlpeKVEYIIKCDMSGLQKLLYQHLHNRGILltdgsekgktgeGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRahrigqknevrvlrlitvnsveERILAAARYKLNMDEKVIQAGMFDQKSTGSERHEFLQTILHqddeeeeenevpddetvnqliartedeltlfqkmdaerrkgetkprlveikelpdwmvkdddeVENSMyeeererekeealmgrgsrqrkqvdytdsltdqeWLKAIEddgaddyeeeeeevkpvtkkrgsgkkgkksyveetapedeeeekpvkkrrrrkkvqisdededeedespkkkkrkstktpakdkhkeddeekhvvskrkkkvveeeeeveeaegeeeeeddkaskprks
TPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKEYHRNNTARTQKLNKAIINYHINAekeqkkeqeriekermrrLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVkehkeeqqkkmreekkkkkksikqkILDGNMdkldldessqledlRITVKETNSDNKLRGEDAPPAKQIKEWLASHPGWevvmedsedegsedeemkekkeePSKAVGEKKTEDDEYKDAGEEATYYSIAHTYHEKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTLSNWVLEFEKWAPSANVVAYKGSPLARRALQGRMKNSKFNVLLTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERHEFLQTILHQddeeeeenevpddeTVNQLIARTEDELTLFQKMDAERRKGETKPRLVEIKELPDWMVKDDDEVENSMYeeererekeeALMGRGSRQRKQVDYTDSLTDQEWLKAIeddgaddyeeeeeeVKPVTkkrgsgkkgkksYVEETApedeeeekpvkkrrrrkkvQISdededeedespkkkkrkstktpakdkhkeddeekhvvskrkkkvveeeeeveeaegeeeeeDDKASKPRKS
*******PELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTD***********ARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTT*******LLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKEYH******TQKLNKAIINYHI***************************************RLAFLLSQTDEYI******************************************************************************WL*****W********************************************ATYYSIAHTYHEKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTLSNWVLEFEKWAPSANVVAYKGSPLARRALQGRMKNSKFNVLLTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTD***********ARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTT*******LLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKVIQAGMF***************************************************************************************************************************************************************************************************************************************************************
TPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTG****LNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILL****************LKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMD*****************************************************RKLIDQKKDKRLAFLLSQTDEYISNLTQMVKEHKEEQQKKMREEKKKKKKSIKQKILDGNMDKLDLDESSQLEDLRITVKETNSDNKLRGEDAPPAKQIKEWLASHPGWEVVMEDSEDEGSEDEEMKEKKEEPSKAVGEKKT************TYYSIAHTYHEKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTLSNWVLEFEKWAPSANVVAYKGSPLARRA*QGRMKNSKFNVLLTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTG*****NEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILL*****************KNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKVI*************************************ETVNQLIARTEDELTLFQ***************VEIKELPDWMVKDDDEVENSMYE**********************DYTDSLTDQEW**************************************************************************************************************************************
TPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKEYHRNNTARTQKLNKAIINYHINAE**********EKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMV***********************QKILDGNMDKLDLDESSQLEDLRITVKETNSDNKLRGEDAPPAKQIKEWLASHPGWEVVM************************************AGEEATYYSIAHTYHEKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTLSNWVLEFEKWAPSANVVAYKGSPLARRALQGRMKNSKFNVLLTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERHEFLQTILHQ*************ETVNQLIARTEDELTLFQKMDA********PRLVEIKELPDWMVKDDDEV*****************************YTDSLTDQEWLKAIEDDGA*****************************************************************************************************************************
TPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEK***GEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKEYHRNNTARTQKLNKAIINYHINAEKEQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKEHKEEQQKKMREEKKKKKKSI**********KLDLDESSQLEDLRITVKETNSDNKLRGEDAPPAKQIKEWLASHPGWEVV*****************************************ATYYSIAHTYHEKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTLSNWVLEFEKWAPSANVVAYKGSPLARRALQGRMKNSKFNVLLTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEK***GEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERHEFLQTILHQDDEE***NEVPDDETVNQLIARTEDELTLFQKMDAERRKGETKPRLVEIKELPDWMVKDDDEVENSMYEEEREREKEEALMGRGSRQRKQVDYTDSLTDQEWLKAIEDD**************************************************************************************DEEKHVVSKRKKKVVEEEEE*********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKEYHRNNTARTQKLNKAIINYxxxxxxxxxxxxxxxxxxxxxxxxxxDEEGYRKLIDQKKDKRLAFLLSQTDEYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxILDGNMDKLDLDESSQLEDLRITVKETNSDNKLRGEDAPPAKQIKEWLASHPGWEVVMEDSEDEGSEDEEMKEKKEEPSKAVGEKKTEDDEYKDAGEEATYYSIAHTYHEKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTLSNWVLEFEKWAPSANVVAYKGSPLARRALQGRMKNSKFNVLLTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERHEFLQTILHQDDEEEEENEVPDDETVNQLIARTEDELTLFQKMDAERRKGETKPRLVEIKELPDWMVxxxxxxxxxxxxxxxxxxxxxALMGRGSRQRKQVDYTDSLTDQEWLKAIEDDGADDYEEEEEEVKPVTKKRGSGKKGKKSYVEETAPEDEEEEKPVKKRRRRKKVQISDEDEDEEDESPKKKKRKSTKTPAKDKHKEDDEEKHVxxxxxxxxxxxxxxxxxxxxxxxxxxxxASKPRKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1281
FB|FBgn0000212 1638 brm "brahma" [Drosophila melan 0.658 0.514 0.642 2.4e-289
ZFIN|ZDB-GENE-030605-1 1627 smarca4 "SWI/SNF related, matr 0.499 0.393 0.693 2e-278
ZFIN|ZDB-GENE-030131-5964 1568 smarca2 "SWI/SNF related, matr 0.499 0.408 0.693 4.6e-276
UNIPROTKB|E1C2F7 1546 E1C2F7 "Uncharacterized protei 0.499 0.413 0.693 5.3e-275
UNIPROTKB|P51532 1647 SMARCA4 "Transcription activat 0.420 0.327 0.746 6.2e-275
UNIPROTKB|A5PKK5 1554 SMARCA2 "SMARCA2 protein" [Bos 0.499 0.411 0.690 8.6e-275
UNIPROTKB|P51531 1590 SMARCA2 "Probable global trans 0.499 0.402 0.690 8.6e-275
MGI|MGI:99603 1577 Smarca2 "SWI/SNF related, matr 0.499 0.405 0.690 8.6e-275
UNIPROTKB|D4A4J21506 Smarca2 "Protein Smarca2" [Rat 0.499 0.424 0.690 8.6e-275
UNIPROTKB|E9PTG1 1597 Smarca2 "Protein Smarca2" [Rat 0.499 0.400 0.690 8.6e-275
FB|FBgn0000212 brm "brahma" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 2759 (976.3 bits), Expect = 2.4e-289, Sum P(2) = 2.4e-289
 Identities = 555/864 (64%), Positives = 638/864 (73%)

Query:   306 AARYKLNMDEKEYHRNNTARTQKLNKAIINYHINAXXXXXXXXXXXXXXXXXXLMAEDEE 365
             AA  +   D +E+HRNN A+  ++NKA++N+H NA                  LMAEDEE
Sbjct:   518 AAVLQHGKDLREFHRNNKAQLARMNKAVMNHHANAEREQKKEQERIEKERMRRLMAEDEE 577

Query:   366 GYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVXXXXXXXXXXXXXXXXXXXXXXXXXILD 425
             GYRKLIDQKKDKRLAFLLSQTDEYISNLTQMV                         ++ 
Sbjct:   578 GYRKLIDQKKDKRLAFLLSQTDEYISNLTQMVKQHKDDQMKKKEEEGKRLIQFKKELLMS 637

Query:   426 GNMXXXXXXXXXXXXXXRITVKETNSDNKLRGEDAPPAKQIKEWLASHPGWXXXXXXXXX 485
             G                R+ V E  +  KL G+DAP  K +  WL  HPGW         
Sbjct:   638 GEYIGIDEGSIVADM--RVHVVEQCTGKKLTGDDAPMLKHLHRWLNMHPGWDWIDDEEDS 695

Query:   486 XXXXXXXXXXXXXXPSK---AVGEKKT--EDDEYKDA------------GEEATYYSIAH 528
                           P+    A  + +    D++ KD              EE TYYSIAH
Sbjct:   696 CGSNDDHKPKVEEQPTATEDATDKAQATGNDEDAKDLITKAKVEDDEYRTEEQTYYSIAH 755

Query:   529 TYHEKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYL 588
             T HEKV EQASIMVNG LKEYQIKGLEW+VSLYNNNLNGILADEMGLGKT+QTI+L+TYL
Sbjct:   756 TIHEKVVEQASIMVNGTLKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYL 815

Query:   589 MEKKKNLGPYLVIVPLSTLSNWVLEFEKWAPSANVVAYKGSPLARRALQGRMKNSKFNVL 648
             M++KK +GPYL+IVPLSTL NWVLEFEKWAP+  VV+YKGSP  RR LQ +M+ +KFNVL
Sbjct:   816 MDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQMRATKFNVL 875

Query:   649 LTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQN 708
             LTTYE++IKDK+VL+KIQWK MIIDEGHRMKNHHCKLTQ LNT Y + +R+LLTGTPLQN
Sbjct:   876 LTTYEYVIKDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQN 935

Query:   709 KLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFL 768
             KLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFL
Sbjct:   936 KLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFL 995

Query:   769 LRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALK 828
             LRRLKKEVE QLP+KVEYIIKCDMS LQ++LY+H+ ++G+LLTDGSEKGK G+GGA+AL 
Sbjct:   996 LRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALM 1055

Query:   829 NTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETK 888
             NTIVQLRKLCNHPFMFQ+IEEKYC H G +  VVSGPD+YR SGKFELLDRILPK K T 
Sbjct:  1056 NTIVQLRKLCNHPFMFQHIEEKYCDHTGGHG-VVSGPDLYRVSGKFELLDRILPKLKATN 1114

Query:   889 HRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLST 948
             HRVL+FCQMTQ MTI+EDY  WR F YLRLDGTTK+EDRGELLRKFN   S  F+FLLST
Sbjct:  1115 HRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLST 1174

Query:   949 RAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILA 1008
             RAGGLGLNLQ ADTV+IFDSDWNPHQDLQAQDRAHRIGQ+NEVRVLRL+TVNSVEERILA
Sbjct:  1175 RAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILA 1234

Query:  1009 AARYKLNMDEKVIQAGMFDQKSTGSERHEFLQTILHQXXXXXXXXXXX-XXXTVNQLIAR 1067
             AARYKLNMDEKVIQAGMFDQKSTGSER +FLQTILHQ                +N +IAR
Sbjct:  1235 AARYKLNMDEKVIQAGMFDQKSTGSERQQFLQTILHQDDNEEEEENEVPDDEMINMMIAR 1294

Query:  1068 TEDELTLFQKMDAERRKGETKPRLVEIKELPDWMVKDDDEVENSMYXXXXXXXXXXALMG 1127
             +E+E+ +F++MDAER+K + +      + + +  + D    ++              ++G
Sbjct:  1295 SEEEIEIFKRMDAERKKEDEEIHPGRERLIDESELPDWLTKDDDEVERFHYQYDEDTILG 1354

Query:  1128 RGSRQRKQVDYTDSLTDQEWLKAI 1151
             RGSRQRK+VDYTDSLT++EWLKAI
Sbjct:  1355 RGSRQRKEVDYTDSLTEKEWLKAI 1378
GO:0043044 "ATP-dependent chromatin remodeling" evidence=ISS;IDA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=ISS;IDA
GO:0016887 "ATPase activity" evidence=ISS
GO:0008094 "DNA-dependent ATPase activity" evidence=NAS
GO:0003713 "transcription coactivator activity" evidence=ISS;NAS
GO:0005634 "nucleus" evidence=IDA;NAS
GO:0048096 "chromatin-mediated maintenance of transcription" evidence=NAS
GO:0005515 "protein binding" evidence=IPI
GO:0035060 "brahma complex" evidence=IDA;TAS
GO:0048477 "oogenesis" evidence=TAS
GO:0045749 "negative regulation of S phase of mitotic cell cycle" evidence=IGI
GO:0035172 "hemocyte proliferation" evidence=TAS
GO:0003677 "DNA binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0007474 "imaginal disc-derived wing vein specification" evidence=IMP
GO:0048666 "neuron development" evidence=IMP
GO:0007517 "muscle organ development" evidence=IMP
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0007409 "axonogenesis" evidence=IMP
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IGI
GO:0008586 "imaginal disc-derived wing vein morphogenesis" evidence=IMP
GO:0008587 "imaginal disc-derived wing margin morphogenesis" evidence=IMP
GO:0045742 "positive regulation of epidermal growth factor receptor signaling pathway" evidence=IMP
GO:0070983 "dendrite guidance" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
GO:0043974 "histone H3-K27 acetylation" evidence=IMP
ZFIN|ZDB-GENE-030605-1 smarca4 "SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5964 smarca2 "SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2F7 E1C2F7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P51532 SMARCA4 "Transcription activator BRG1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A5PKK5 SMARCA2 "SMARCA2 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P51531 SMARCA2 "Probable global transcription activator SNF2L2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:99603 Smarca2 "SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4A4J2 Smarca2 "Protein Smarca2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PTG1 Smarca2 "Protein Smarca2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.120.914
3rd Layer3.6.40.921

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1281
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 1e-154
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 1e-121
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 2e-95
PLN031421033 PLN03142, PLN03142, Probable chromatin-remodeling 3e-90
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 1e-52
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 7e-50
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-29
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 6e-29
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 6e-29
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-26
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 4e-24
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 4e-24
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-23
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-23
smart0057373 smart00573, HSA, domain in helicases and associate 4e-09
pfam0753345 pfam07533, BRK, BRK domain 2e-07
PLN02967 581 PLN02967, PLN02967, kinase 2e-07
pfam0752973 pfam07529, HSA, HSA 5e-07
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-07
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 7e-07
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-06
pfam11496279 pfam11496, HDA2-3, Class II histone deacetylase co 1e-06
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-06
pfam11496279 pfam11496, HDA2-3, Class II histone deacetylase co 9e-06
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-05
smart0059245 smart00592, BRK, domain in transcription and CHROM 1e-05
pfam08597 242 pfam08597, eIF3_subunit, Translation initiation fa 2e-05
pfam05793 528 pfam05793, TFIIF_alpha, Transcription initiation f 2e-05
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 3e-05
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 4e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-04
pfam05793 528 pfam05793, TFIIF_alpha, Transcription initiation f 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-04
PRK05771 646 PRK05771, PRK05771, V-type ATP synthase subunit I; 3e-04
pfam02029 431 pfam02029, Caldesmon, Caldesmon 4e-04
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 4e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 5e-04
pfam04006 613 pfam04006, Mpp10, Mpp10 protein 7e-04
PLN032371465 PLN03237, PLN03237, DNA topoisomerase 2; Provision 0.001
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 0.001
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.002
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.002
pfam11705221 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym 0.002
pfam04615 728 pfam04615, Utp14, Utp14 protein 0.002
PHA03169 413 PHA03169, PHA03169, hypothetical protein; Provisio 0.003
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.004
pfam04615 728 pfam04615, Utp14, Utp14 protein 0.004
pfam03344 715 pfam03344, Daxx, Daxx Family 0.004
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information 
 Score =  492 bits (1267), Expect = e-154
 Identities = 254/596 (42%), Positives = 363/596 (60%), Gaps = 36/596 (6%)

Query: 488  SEDEEMKEKKEEPSKAVGEKKTEDDEYKDAGEEATYYSIAHTYHEKVTEQASIMVNGKLK 547
              D+    KK +       K TE++E ++  +E             + + + I   GK++
Sbjct: 114  KGDQSASAKKAKGRGRHASKLTEEEEDEEYLKEEEDGLGGSGGTRLLVQPSCI--KGKMR 171

Query: 548  EYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTL 607
            +YQ+ GL W++ LY N +NGILADEMGLGKT+QTI+LL YL E +   GP++V+ P STL
Sbjct: 172  DYQLAGLNWLIRLYENGINGILADEMGLGKTLQTISLLGYLHEYRGITGPHMVVAPKSTL 231

Query: 608  SNWVLEFEKWAPSANVVAYKGSPLARRALQGR-MKNSKFNVLLTTYEFIIKDKSVLSKIQ 666
             NW+ E  ++ P    V + G+P  R   +   +   KF+V +T++E  IK+K+ L +  
Sbjct: 232  GNWMNEIRRFCPVLRAVKFHGNPEERAHQREELLVAGKFDVCVTSFEMAIKEKTALKRFS 291

Query: 667  WKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLLPSIFK 726
            W+ +IIDE HR+KN +  L++T+  F ++++R+L+TGTPLQN L ELWALLNFLLP IF 
Sbjct: 292  WRYIIIDEAHRIKNENSLLSKTMRLF-STNYRLLITGTPLQNNLHELWALLNFLLPEIFS 350

Query: 727  SCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEY 786
            S  TF++WF      +GE       +   ++++LHKVLRPFLLRRLK +VE  LP K E 
Sbjct: 351  SAETFDEWF----QISGE------NDQQEVVQQLHKVLRPFLLRRLKSDVEKGLPPKKET 400

Query: 787  IIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARA-LKNTIVQLRKLCNHPFMFQ 845
            I+K  MS +QK  Y+ L  + + + +         GG R  L N  +QLRK CNHP++FQ
Sbjct: 401  ILKVGMSQMQKQYYKALLQKDLDVVNA--------GGERKRLLNIAMQLRKCCNHPYLFQ 452

Query: 846  NIEEKYCQHIGQNNTVVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILE 905
              E              +G  +   SGK  LLD++LPK KE   RVL+F QMT+L+ ILE
Sbjct: 453  GAEP--------GPPYTTGEHLVENSGKMVLLDKLLPKLKERDSRVLIFSQMTRLLDILE 504

Query: 906  DYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVII 965
            DY ++R + Y R+DG T  EDR   +  FN+P S+ F+FLLSTRAGGLG+NL  AD VI+
Sbjct: 505  DYLMYRGYQYCRIDGNTGGEDRDASIDAFNKPGSEKFVFLLSTRAGGLGINLATADIVIL 564

Query: 966  FDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKVIQAG- 1024
            +DSDWNP  DLQAQDRAHRIGQK EV+V R  T  ++EE+++  A  KL +D  VIQ G 
Sbjct: 565  YDSDWNPQVDLQAQDRAHRIGQKKEVQVFRFCTEYTIEEKVIERAYKKLALDALVIQQGR 624

Query: 1025 MFDQKSTGSERHEFLQTILHQDDEE-EEENEVPDDETVNQLIARTEDELT-LFQKM 1078
            + +QK+   +  E LQ + +  +     ++    DE ++++IA+ E+    L  KM
Sbjct: 625  LAEQKTVNKD--ELLQMVRYGAEMVFSSKDSTITDEDIDRIIAKGEEATAELDAKM 678

Length = 1033
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|214727 smart00573, HSA, domain in helicases and associated with SANT domains Back     alignment and domain information
>gnl|CDD|203672 pfam07533, BRK, BRK domain Back     alignment and domain information
>gnl|CDD|215521 PLN02967, PLN02967, kinase Back     alignment and domain information
>gnl|CDD|219455 pfam07529, HSA, HSA Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|221124 pfam11496, HDA2-3, Class II histone deacetylase complex subunits 2 and 3 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|221124 pfam11496, HDA2-3, Class II histone deacetylase complex subunits 2 and 3 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|197800 smart00592, BRK, domain in transcription and CHROMO domain helicases Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein Back     alignment and domain information
>gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|223003 PHA03169, PHA03169, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|218177 pfam04615, Utp14, Utp14 protein Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1281
KOG0386|consensus1157 100.0
KOG0385|consensus971 100.0
KOG0384|consensus 1373 100.0
KOG0391|consensus 1958 100.0
KOG0388|consensus1185 100.0
KOG0389|consensus941 100.0
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 100.0
KOG0387|consensus923 100.0
KOG0392|consensus1549 100.0
KOG0390|consensus776 100.0
KOG1015|consensus1567 100.0
KOG1002|consensus791 100.0
KOG4439|consensus901 100.0
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 100.0
KOG1016|consensus 1387 100.0
KOG0385|consensus971 100.0
PRK04914956 ATP-dependent helicase HepA; Validated 100.0
KOG0384|consensus1373 100.0
KOG1000|consensus689 100.0
KOG0386|consensus1157 100.0
KOG0387|consensus923 100.0
KOG0383|consensus696 100.0
KOG0392|consensus1549 100.0
KOG0389|consensus941 100.0
PLN031421033 Probable chromatin-remodeling complex ATPase chain 100.0
KOG1001|consensus674 100.0
KOG0388|consensus1185 100.0
KOG0391|consensus1958 100.0
KOG0390|consensus776 100.0
KOG1015|consensus1567 100.0
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
KOG1002|consensus791 100.0
KOG4439|consensus901 100.0
PRK13766773 Hef nuclease; Provisional 100.0
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
KOG1016|consensus1387 100.0
KOG0298|consensus 1394 99.98
PRK04914956 ATP-dependent helicase HepA; Validated 99.97
KOG1000|consensus689 99.97
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.97
PHA02558501 uvsW UvsW helicase; Provisional 99.97
KOG1001|consensus674 99.96
PTZ00110545 helicase; Provisional 99.95
KOG0354|consensus746 99.95
KOG0331|consensus519 99.95
KOG0330|consensus476 99.95
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.94
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.94
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.94
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.94
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.93
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 99.93
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.93
KOG1123|consensus776 99.93
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.93
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.93
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.93
KOG0338|consensus691 99.93
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.93
PTZ00424401 helicase 45; Provisional 99.92
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.92
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.92
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.91
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.91
KOG0383|consensus696 99.91
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.9
KOG0342|consensus543 99.9
PRK106891147 transcription-repair coupling factor; Provisional 99.9
KOG0343|consensus758 99.9
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 99.9
PRK13767 876 ATP-dependent helicase; Provisional 99.89
KOG0345|consensus567 99.89
KOG0340|consensus442 99.89
KOG0333|consensus673 99.88
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.88
KOG0350|consensus620 99.88
KOG0328|consensus400 99.87
PRK02362737 ski2-like helicase; Provisional 99.86
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.85
KOG0348|consensus708 99.85
PRK00254720 ski2-like helicase; Provisional 99.84
KOG0347|consensus731 99.84
KOG0335|consensus482 99.84
PRK01172674 ski2-like helicase; Provisional 99.84
KOG0336|consensus629 99.82
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.82
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.82
KOG4284|consensus 980 99.82
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.82
KOG0339|consensus731 99.82
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.81
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.81
KOG0326|consensus459 99.8
KOG0341|consensus610 99.8
KOG0332|consensus477 99.8
PRK09401 1176 reverse gyrase; Reviewed 99.79
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.79
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.79
PHA02653675 RNA helicase NPH-II; Provisional 99.78
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.78
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.78
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.77
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.75
COG4096875 HsdR Type I site-specific restriction-modification 99.75
KOG0346|consensus569 99.72
KOG0344|consensus593 99.72
PRK05580679 primosome assembly protein PriA; Validated 99.72
KOG0334|consensus997 99.72
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.72
COG1205 851 Distinct helicase family with a unique C-terminal 99.7
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.69
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.69
KOG0327|consensus397 99.68
COG1204766 Superfamily II helicase [General function predicti 99.67
PRK14701 1638 reverse gyrase; Provisional 99.67
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.66
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.66
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.65
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.65
COG1202830 Superfamily II helicase, archaea-specific [General 99.64
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.64
KOG0337|consensus529 99.63
COG4889 1518 Predicted helicase [General function prediction on 99.63
PRK09694878 helicase Cas3; Provisional 99.62
PRK13766773 Hef nuclease; Provisional 99.6
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.6
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.59
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.59
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.57
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.56
KOG0351|consensus941 99.55
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.54
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.54
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.54
PRK05298652 excinuclease ABC subunit B; Provisional 99.53
KOG0352|consensus641 99.53
KOG0353|consensus695 99.52
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.51
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.5
smart00487201 DEXDc DEAD-like helicases superfamily. 99.49
KOG0952|consensus 1230 99.49
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.47
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.44
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.43
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.4
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.4
smart0049082 HELICc helicase superfamily c-terminal domain. 99.39
KOG0328|consensus400 99.36
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.36
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.35
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 99.34
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.34
PTZ00110545 helicase; Provisional 99.34
KOG0331|consensus519 99.33
KOG0298|consensus1394 99.3
KOG0951|consensus 1674 99.29
smart0049082 HELICc helicase superfamily c-terminal domain. 99.29
KOG0333|consensus673 99.29
KOG0330|consensus476 99.28
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.26
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.26
KOG0329|consensus387 99.24
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.21
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.21
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.21
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.19
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.18
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.18
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.17
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.15
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.15
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.15
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.15
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 99.14
PHA02558501 uvsW UvsW helicase; Provisional 99.13
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.12
PF11496297 HDA2-3: Class II histone deacetylase complex subun 99.1
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.09
COG0610962 Type I site-specific restriction-modification syst 99.09
KOG0332|consensus477 99.08
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.07
KOG0947|consensus 1248 99.06
PF11496297 HDA2-3: Class II histone deacetylase complex subun 99.05
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.05
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 99.03
PTZ00424401 helicase 45; Provisional 99.03
KOG0341|consensus610 99.03
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.03
KOG0326|consensus459 98.98
TIGR00596814 rad1 DNA repair protein (rad1). This family is bas 98.95
KOG0349|consensus725 98.94
KOG0340|consensus442 98.94
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.93
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 98.93
KOG0336|consensus629 98.91
KOG0342|consensus543 98.9
PRK09200790 preprotein translocase subunit SecA; Reviewed 98.89
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 98.88
PRK05298652 excinuclease ABC subunit B; Provisional 98.85
COG1198730 PriA Primosomal protein N' (replication factor Y) 98.85
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 98.85
KOG0335|consensus482 98.85
KOG0345|consensus567 98.85
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 98.84
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 98.81
KOG0949|consensus1330 98.81
PRK13767876 ATP-dependent helicase; Provisional 98.79
KOG0327|consensus397 98.79
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.78
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 98.77
KOG4284|consensus980 98.77
KOG0338|consensus691 98.76
CHL00122870 secA preprotein translocase subunit SecA; Validate 98.76
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 98.75
KOG0343|consensus758 98.74
PF1461974 SnAC: Snf2-ATP coupling, chromatin remodelling com 98.72
KOG0948|consensus 1041 98.72
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.71
KOG1123|consensus776 98.68
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 98.66
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.66
KOG0950|consensus1008 98.66
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 98.66
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.65
KOG0344|consensus593 98.64
KOG0348|consensus708 98.63
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 98.62
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 98.61
KOG0347|consensus731 98.61
TIGR02621844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.6
KOG0339|consensus731 98.59
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 98.59
TIGR00643630 recG ATP-dependent DNA helicase RecG. 98.57
PRK106891147 transcription-repair coupling factor; Provisional 98.56
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 98.56
KOG0354|consensus746 98.55
KOG1513|consensus1300 98.54
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.54
KOG0922|consensus674 98.53
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.53
KOG0346|consensus569 98.48
KOG0350|consensus620 98.48
KOG0334|consensus997 98.47
KOG0926|consensus 1172 98.46
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 98.44
PRK15483 986 type III restriction-modification system StyLTI en 98.43
PRK02362737 ski2-like helicase; Provisional 98.43
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.42
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.42
KOG0920|consensus924 98.39
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.38
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.37
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.37
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.36
KOG0924|consensus1042 98.34
PRK12904830 preprotein translocase subunit SecA; Reviewed 98.33
PHA02653675 RNA helicase NPH-II; Provisional 98.31
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 98.3
PRK01172674 ski2-like helicase; Provisional 98.29
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 98.25
COG1202830 Superfamily II helicase, archaea-specific [General 98.23
PRK13107908 preprotein translocase subunit SecA; Reviewed 98.23
PRK00254720 ski2-like helicase; Provisional 98.17
KOG0349|consensus725 98.15
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.13
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.13
KOG0923|consensus902 98.08
PF13871278 Helicase_C_4: Helicase_C-like 98.07
KOG0337|consensus529 98.06
KOG0953|consensus700 98.02
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 97.97
PRK111311294 ATP-dependent RNA helicase HrpA; Provisional 97.93
KOG0953|consensus700 97.91
PRK09694878 helicase Cas3; Provisional 97.9
TIGR019671283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 97.89
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 97.88
COG1201814 Lhr Lhr-like helicases [General function predictio 97.87
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.85
KOG0351|consensus941 97.79
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 97.78
KOG0352|consensus641 97.76
PF13871278 Helicase_C_4: Helicase_C-like 97.75
TIGR00596814 rad1 DNA repair protein (rad1). This family is bas 97.7
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 97.5
TIGR00595505 priA primosomal protein N'. All proteins in this f 97.49
COG0556663 UvrB Helicase subunit of the DNA excision repair c 97.44
PRK094011176 reverse gyrase; Reviewed 97.37
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 97.34
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.34
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.27
KOG0925|consensus699 97.23
PRK05580679 primosome assembly protein PriA; Validated 97.18
TIGR010541171 rgy reverse gyrase. Generally, these gyrases are e 97.18
PRK10536262 hypothetical protein; Provisional 97.17
KOG4150|consensus 1034 97.15
PRK14701 1638 reverse gyrase; Provisional 97.07
COG1200677 RecG RecG-like helicase [DNA replication, recombin 97.06
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 97.01
PRK14873665 primosome assembly protein PriA; Provisional 96.96
PRK12326764 preprotein translocase subunit SecA; Reviewed 96.9
COG1205851 Distinct helicase family with a unique C-terminal 96.83
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.8
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.78
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 96.77
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 96.65
KOG1803|consensus649 96.6
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 96.55
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.52
TIGR00376637 DNA helicase, putative. The gene product may repre 96.46
KOG1802|consensus935 96.36
KOG1132|consensus945 96.29
COG4098441 comFA Superfamily II DNA/RNA helicase required for 96.25
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 96.24
COG11971139 Mfd Transcription-repair coupling factor (superfam 96.18
COG1204766 Superfamily II helicase [General function predicti 96.15
CHL00122870 secA preprotein translocase subunit SecA; Validate 96.15
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 96.08
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.05
COG4096875 HsdR Type I site-specific restriction-modification 95.92
KOG1131|consensus755 95.88
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 95.81
KOG4150|consensus1034 95.79
KOG0951|consensus1674 95.71
KOG0952|consensus1230 95.49
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 95.41
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 95.39
KOG0353|consensus695 95.38
PRK04296190 thymidine kinase; Provisional 95.35
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 95.31
smart0059245 BRK domain in transcription and CHROMO domain heli 95.24
KOG0329|consensus387 95.15
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.1
PLN03025319 replication factor C subunit; Provisional 95.04
PF0646566 DUF1087: Domain of Unknown Function (DUF1087); Int 94.88
PRK06526254 transposase; Provisional 94.85
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.79
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 94.74
smart00382148 AAA ATPases associated with a variety of cellular 94.73
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 94.7
KOG0991|consensus333 94.66
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 94.63
PRK10875615 recD exonuclease V subunit alpha; Provisional 94.6
PRK11773721 uvrD DNA-dependent helicase II; Provisional 94.49
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.3
PRK09112351 DNA polymerase III subunit delta'; Validated 94.23
COG3421812 Uncharacterized protein conserved in bacteria [Fun 93.73
PF0753346 BRK: BRK domain; InterPro: IPR006576 BRK is a doma 93.5
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 93.41
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 93.35
PRK08181269 transposase; Validated 93.29
PF1324576 AAA_19: Part of AAA domain 93.16
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 93.1
PRK08084235 DNA replication initiation factor; Provisional 92.95
PRK06835329 DNA replication protein DnaC; Validated 92.95
PRK08116268 hypothetical protein; Validated 92.93
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 92.92
COG1484254 DnaC DNA replication protein [DNA replication, rec 92.84
CHL00181287 cbbX CbbX; Provisional 92.83
COG48891518 Predicted helicase [General function prediction on 92.81
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 92.67
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 92.65
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 92.65
PRK08727233 hypothetical protein; Validated 92.63
PHA03333752 putative ATPase subunit of terminase; Provisional 92.55
PRK12402337 replication factor C small subunit 2; Reviewed 92.52
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 92.42
PRK06921266 hypothetical protein; Provisional 92.38
KOG1805|consensus1100 92.25
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 92.2
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 92.15
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 92.04
PRK07952244 DNA replication protein DnaC; Validated 91.94
PTZ001121164 origin recognition complex 1 protein; Provisional 91.91
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 91.78
smart00491142 HELICc2 helicase superfamily c-terminal domain. 91.67
TIGR01073726 pcrA ATP-dependent DNA helicase PcrA. Designed to 91.67
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 91.64
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 91.4
PRK05642234 DNA replication initiation factor; Validated 91.38
KOG0989|consensus346 91.29
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 91.12
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 91.03
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 91.02
PRK00149450 dnaA chromosomal replication initiation protein; R 91.0
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 90.8
PRK14974336 cell division protein FtsY; Provisional 90.78
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 90.73
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 90.71
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 90.64
TIGR00362405 DnaA chromosomal replication initiator protein Dna 90.53
PRK05707328 DNA polymerase III subunit delta'; Validated 90.42
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 90.33
PRK07940394 DNA polymerase III subunit delta'; Validated 90.3
PRK06893229 DNA replication initiation factor; Validated 90.29
cd01124187 KaiC KaiC is a circadian clock protein primarily f 90.21
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 90.12
PHA02533534 17 large terminase protein; Provisional 90.08
COG0593408 DnaA ATPase involved in DNA replication initiation 90.01
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 90.01
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 89.93
TIGR02928365 orc1/cdc6 family replication initiation protein. M 89.8
PRK14087450 dnaA chromosomal replication initiation protein; P 89.8
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 89.79
smart0057373 HSA domain in helicases and associated with SANT d 89.7
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 89.68
PRK07471365 DNA polymerase III subunit delta'; Validated 89.67
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 89.61
PF13173128 AAA_14: AAA domain 89.54
smart00492141 HELICc3 helicase superfamily c-terminal domain. 89.53
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 89.52
PRK08769319 DNA polymerase III subunit delta'; Validated 89.5
PF13892139 DBINO: DNA-binding domain 89.47
PRK14088440 dnaA chromosomal replication initiation protein; P 89.44
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 89.44
PRK08903227 DnaA regulatory inactivator Hda; Validated 89.43
PRK13889988 conjugal transfer relaxase TraA; Provisional 89.43
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 89.33
PHA02544316 44 clamp loader, small subunit; Provisional 89.09
PRK08058329 DNA polymerase III subunit delta'; Validated 89.08
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 89.06
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 89.05
KOG0949|consensus1330 89.01
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 88.94
KOG0922|consensus674 88.88
PF02399824 Herpes_ori_bp: Origin of replication binding prote 88.6
PHA03368738 DNA packaging terminase subunit 1; Provisional 88.58
smart00491142 HELICc2 helicase superfamily c-terminal domain. 88.54
PRK12422445 chromosomal replication initiation protein; Provis 88.5
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 88.4
PRK12377248 putative replication protein; Provisional 88.34
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 88.32
KOG1513|consensus1300 88.28
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 88.24
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 88.19
PRK00440319 rfc replication factor C small subunit; Reviewed 88.12
PF0752973 HSA: HSA; InterPro: IPR006562 This domain of unkno 87.88
PRK00771437 signal recognition particle protein Srp54; Provisi 87.79
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 87.72
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 87.6
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 87.55
COG0470325 HolB ATPase involved in DNA replication [DNA repli 87.5
PRK06871325 DNA polymerase III subunit delta'; Validated 87.45
PRK14086617 dnaA chromosomal replication initiation protein; P 87.39
PRK07993334 DNA polymerase III subunit delta'; Validated 87.32
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 87.22
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 87.18
PRK04195482 replication factor C large subunit; Provisional 87.06
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 86.85
PRK00411394 cdc6 cell division control protein 6; Reviewed 86.7
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 86.64
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 86.63
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 86.55
PF00004132 AAA: ATPase family associated with various cellula 86.53
PTZ00293211 thymidine kinase; Provisional 86.48
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 86.47
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 86.47
PRK06090319 DNA polymerase III subunit delta'; Validated 86.38
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 86.28
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 86.26
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 86.23
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 86.18
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 86.11
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 86.04
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 85.61
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 85.54
PHA03372668 DNA packaging terminase subunit 1; Provisional 85.34
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 85.34
KOG0950|consensus1008 85.22
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 85.01
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 84.8
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 84.6
PRK04132846 replication factor C small subunit; Provisional 83.8
TIGR02688449 conserved hypothetical protein TIGR02688. Members 83.73
COG4626546 Phage terminase-like protein, large subunit [Gener 83.55
COG2256436 MGS1 ATPase related to the helicase subunit of the 83.25
PRK13342413 recombination factor protein RarA; Reviewed 83.07
KOG0921|consensus 1282 82.81
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 82.8
PRK10865857 protein disaggregation chaperone; Provisional 82.78
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 82.73
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 82.73
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 82.53
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 82.14
smart00492141 HELICc3 helicase superfamily c-terminal domain. 81.75
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 81.68
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 81.23
PRK09183259 transposase/IS protein; Provisional 81.14
PRK08533230 flagellar accessory protein FlaH; Reviewed 81.1
PHA02244383 ATPase-like protein 81.06
PRK138261102 Dtr system oriT relaxase; Provisional 80.95
KOG0442|consensus 892 80.85
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 80.81
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 80.65
KOG0737|consensus386 80.34
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 80.09
>KOG0386|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.2e-149  Score=1313.55  Aligned_cols=744  Identities=63%  Similarity=0.991  Sum_probs=679.6

Q ss_pred             hccccchhhhhccchhhhhhhhHHHHhhhhhhhHHHhhhHHHHHHHHHHHHHhhCHHHHHHHHhhHhHHHHHHHHHhhHH
Q psy7773         309 YKLNMDEKEYHRNNTARTQKLNKAIINYHINAEKEQKKEQERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAFLLSQTDE  388 (1281)
Q Consensus       309 ~K~~l~~~~~~~~~~~k~~kl~k~v~~~~~~~ekEe~k~~er~ekerl~~L~~~dee~y~kll~~~k~~rl~~ll~qtd~  388 (1281)
                      ..|...+..++.....+..++++++..+|.+.++++++++++++++|+++|+++|+|||++|++++||+|+++||+|||+
T Consensus       247 ~~h~~e~~~~~q~~~~r~~k~~~~v~~~h~~~er~~~r~~~r~ek~r~~~Lk~~DeE~Y~kl~dq~Kd~Rl~~LL~qt~~  326 (1157)
T KOG0386|consen  247 LIHPKEFPEAQQLVNNRGNKQNKAVQQWHANQERERERRIDRIEKERASALKHNDEEGYRKLQDQKKDNRLSQLLSQTDS  326 (1157)
T ss_pred             HHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhhHHHHHHHHHhhHHHHHHHHhhccccHHHHhhhhhhH
Confidence            34566777888888889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhcCCCCcCCcccccccccccceeecccccccCCCCCCCchhhHhh
Q psy7773         389 YISNLTQMVKEHKEEQQKKMREEKKKKKKSIKQKILDGNMDKLDLDESSQLEDLRITVKETNSDNKLRGEDAPPAKQIKE  468 (1281)
Q Consensus       389 ~~~~l~~~v~~~~~~~~~~~~~~~~~k~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  468 (1281)
                      |+.+|+.+|++|+.+                        .    .+.++.   ..+                   +    
T Consensus       327 yl~sL~s~Vk~qk~~------------------------~----~~~~~~---~d~-------------------~----  352 (1157)
T KOG0386|consen  327 YLPSLSSVVKGQKSE------------------------N----PDANSA---SDI-------------------S----  352 (1157)
T ss_pred             HHHHHHHHHHHhhcc------------------------c----cccchh---hhh-------------------h----
Confidence            999999999987531                        0    000000   000                   0    


Q ss_pred             hhhcCCCCccccCCCccCCCchhHhhhhccCCcccccCCccCCchhhccccccccccccccccccccccCcccccCcccH
Q psy7773         469 WLASHPGWEVVMEDSEDEGSEDEEMKEKKEEPSKAVGEKKTEDDEYKDAGEEATYYSIAHTYHEKVTEQASIMVNGKLKE  548 (1281)
Q Consensus       469 ~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~L~~  548 (1281)
                               ...                        ...+.+.+  +...+..+||.++|++.+.+..||+++.||+|++
T Consensus       353 ---------~i~------------------------~~ak~~~~--d~~~s~~~Yys~AH~I~E~v~~Qps~l~GG~Lk~  397 (1157)
T KOG0386|consen  353 ---------GIS------------------------GSAKADVD--DHAESNGSYYSTAHPIKENVAKQPSSLQGGELKE  397 (1157)
T ss_pred             ---------hhh------------------------hhhcchhh--hhhhcchhHHHhcchhhhccccCcchhcCCCCch
Confidence                     000                        00000000  0224567899999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhcCCCCeEEecCCCCCHHHHHHHHHHHHHHhcCCCCCEEEEeCCccHHHHHHHHHHHCCCCcEEEEeC
Q psy7773         549 YQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTLSNWVLEFEKWAPSANVVAYKG  628 (1281)
Q Consensus       549 yQ~~gv~~l~~~~~~~~~gILademGlGKTi~ai~ll~~l~~~~~~~~~~LIV~P~s~l~~W~~E~~~~~p~~~~~~~~g  628 (1281)
                      ||+.||+||+++|+|++|||||||||||||+|+|++|+||++.++..||+|||||+++|.||..||.+|+|++..+.|.|
T Consensus       398 YQl~GLqWmVSLyNNnLNGILADEMGLGKTIQtIsLitYLmE~K~~~GP~LvivPlstL~NW~~Ef~kWaPSv~~i~YkG  477 (1157)
T KOG0386|consen  398 YQLHGLQWMVSLYNNNLNGILADEMGLGKTIQTISLITYLMEHKQMQGPFLIIVPLSTLVNWSSEFPKWAPSVQKIQYKG  477 (1157)
T ss_pred             hhhhhhHHHhhccCCCcccccchhcccchHHHHHHHHHHHHHHcccCCCeEEeccccccCCchhhccccccceeeeeeeC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHhhhccCCccEEEechHHHhhcccccccCceeEEEEeCCccccccchHHHHHHHhhhccCcEEEeecCCCCC
Q psy7773         629 SPLARRALQGRMKNSKFNVLLTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQN  708 (1281)
Q Consensus       629 ~~~~r~~~~~~~~~~~~~vvItTye~l~~~~~~l~~~~w~~vIvDEaHr~kn~~s~~~~~l~~~~~~~~rllLTgTPl~n  708 (1281)
                      ++..|..+......++|+|++|||+++++++..|.++.|.|+||||+|||||..|+++..+...|.+++|+||||||+||
T Consensus       478 tp~~R~~l~~qir~gKFnVLlTtyEyiikdk~lLsKI~W~yMIIDEGHRmKNa~~KLt~~L~t~y~~q~RLLLTGTPLQN  557 (1157)
T KOG0386|consen  478 TPQQRSGLTKQQRHGKFNVLLTTYEYIIKDKALLSKISWKYMIIDEGHRMKNAICKLTDTLNTHYRAQRRLLLTGTPLQN  557 (1157)
T ss_pred             CHHHHhhHHHHHhcccceeeeeeHHHhcCCHHHHhccCCcceeecccccccchhhHHHHHhhccccchhhhhhcCChhhh
Confidence            99999999998888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ChhHHHHHHhhhcCCCCCChhHHHHHhcccccCCcccccCCHHHHHHHHHHHHHhhhHHHHHHhHHHHhhcCCCceEEEE
Q psy7773         709 KLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYII  788 (1281)
Q Consensus       709 ~~~el~~ll~fl~p~~~~~~~~f~~~f~~~~~~~~~~~~~~~~~~~~~~~~L~~~l~~~~lRR~k~~v~~~lP~k~~~~v  788 (1281)
                      ++.|||+||||+.|.+|+++..|.+||+.||+++|+++++++++...++++||+||+||+|||.|++|+..||++++.++
T Consensus       558 ~LpELWaLLNFlLP~IFnS~~~FeqWFN~PFantGek~eLteEEtlLIIrRLHkVLRPFlLRRlKkeVE~~LPdKve~vi  637 (1157)
T KOG0386|consen  558 NLPELWALLNFLLPNIFNSCKAFEQWFNQPFANTGEKVELTEEETLLIIRRLHKVLRPFLLRRLKKEVEQELPDKVEDVI  637 (1157)
T ss_pred             ccHHHHHHHHHhccchhhhHhHHHHHhhhhhhhcCCcccccchHHHHHHHHHHHhhhHHHHHhhhHHHhhhCchhhhHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EcCCCHHHHHHHHHHHhcccccccCCccCCCCCCchHHHHHHHHHHHHhcCCccchhhhHHHHHhhhcCCCccccCCccc
Q psy7773         789 KCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNTVVSGPDIY  868 (1281)
Q Consensus       789 ~~~ls~~q~~lY~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~Lrk~~~hp~l~~~~~~~~~~~~~~~~~~~~~~~~~  868 (1281)
                      +|.||+.|+.+|.++.+......+.    ..+.++...++|.+|+||+||||||+|..++..++.+...       .+++
T Consensus       638 KC~mSalQq~lY~~m~~~g~l~~d~----~~g~~g~k~L~N~imqLRKiCNHP~lf~~ve~~~~~~~~~-------~dL~  706 (1157)
T KOG0386|consen  638 KCDMSALQQSLYKQMQNKGQLLKDT----AKGKKGYKPLFNTIMQLRKLCNHPYLFANVENSYTLHYDI-------KDLV  706 (1157)
T ss_pred             heehhhhhHhhhHHHHhCCCCCcCc----hhccccchhhhhHhHHHHHhcCCchhhhhhccccccccCh-------hHHH
Confidence            9999999999999999888777665    4466778899999999999999999999887766555432       6899


Q ss_pred             cccchHHHHHHHhhhhhhcCCeEEEEechHHHHHHHHHHHHHCCCcEEEEeCCCChHHHHHHHHhhcCCCCCeEEEEEec
Q psy7773         869 RTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDRGELLRKFNEPESKYFIFLLST  948 (1281)
Q Consensus       869 ~~s~K~~~L~~lL~~~~~~~~kvLIFsq~~~~ld~L~~~L~~~g~~~~~l~G~~~~~~R~~~i~~Fn~~~~~~~v~LlsT  948 (1281)
                      +.|||+++|+++|++|++.|||||+||||+.++++|++||..++++|+|+||+|+.++|..++..||.|+++||+||+||
T Consensus       707 R~sGKfELLDRiLPKLkatgHRVLlF~qMTrlmdimEdyL~~~~~kYlRLDG~TK~~eRg~ll~~FN~Pds~yf~Fllst  786 (1157)
T KOG0386|consen  707 RVSGKFELLDRILPKLKATGHRVLLFSQMTRLMDILEDYLQIREYKYLRLDGQTKVEERGDLLEIFNAPDSPYFIFLLST  786 (1157)
T ss_pred             HhccHHHHHHhhhHHHHhcCcchhhHHHHHHHHHHHHHHHhhhhhheeeecCCcchhhHHHHHHHhcCCCCceeeeeeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCcccCCEEEEeCCCCChhhhhhHhHhHHhhCCCCceEEEEEEeCCCHHHHHHHHHHHHHHHHHHHHhcCcCCC
Q psy7773         949 RAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKVIQAGMFDQ 1028 (1281)
Q Consensus       949 ~agg~GlNL~~ad~VI~~D~~wnp~~~~Qa~gR~~RiGQ~k~V~V~rli~~~tiEe~I~~~~~~K~~l~~~vi~~g~~~~ 1028 (1281)
                      +|||+|||||+||+||+||++|||+++.||.+|||||||+++|+|+||++.+|+||+|+..+.+|++++.+||++|+|++
T Consensus       787 ragglglNlQtadtviifdsdwnp~~d~qaqdrahrigq~~evRv~rl~tv~sveE~il~~a~~Kl~~d~kviqag~fdn  866 (1157)
T KOG0386|consen  787 RAGGLGLNLQTADTVIIFDSDWNPHQDLQAQDRAHRIGQKKEVRVLRLITVNSVEEKILAEAFYKLDVDGKVIQAGKFDN  866 (1157)
T ss_pred             cccccccchhhcceEEEecCCCCchhHHHHHHHHHHhhchhheeeeeeehhhHHHHHHHHHHHHhcCchHhhhhcccccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhhHHHHHHHHhccCCchhhcCCCCCHHHHHHHHhhCHHHHHHHHHhhHHHhcCCC----CcccccccCCCcccccC
Q psy7773        1029 KSTGSERHEFLQTILHQDDEEEEENEVPDDETVNQLIARTEDELTLFQKMDAERRKGET----KPRLVEIKELPDWMVKD 1104 (1281)
Q Consensus      1029 ~~~~~~~~~~l~~il~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~ 1104 (1281)
                      ++++.+++.+|+.|+....++++ +++++++.||.||+|+++|+++|.+||.++.+.+.    .|||+++.++|+|+.+.
T Consensus       867 ~st~~eR~~~Le~~l~~~~~~~~-~~v~~~~~ln~~larseeE~~~f~~md~~r~~~e~~~~~k~rl~ee~e~p~~i~~~  945 (1157)
T KOG0386|consen  867 KSTAEEREMFLEQLLEMEGDEEE-EEVPDDEVLNSMLARSEEEFELFHKMDEERRATENQQEKKPRLVEEAELPADIYKR  945 (1157)
T ss_pred             CCcHHHHHHHHHHHHhCCCcccc-ccCCcHHHHHHHHhcchHHHHHHHHhhHHHHhhhhhccccchhhhhhhcHHHHHhc
Confidence            99999999999999988765444 78999999999999999999999999999987433    68999999999999988


Q ss_pred             chHHhhhhHHHHHHHHHHHHhcccccccccccccCCCcCHHHHHHHhhhcCCCC
Q psy7773        1105 DDEVENSMYEEEREREKEEALMGRGSRQRKQVDYTDSLTDQEWLKAIEDDGADD 1158 (1281)
Q Consensus      1105 ~~~~~~~~~~~~~~~~~~~~~~~~~~r~r~~~~~~~~~~~~~~~~~~~~~~~~~ 1158 (1281)
                      +..+.....+.+     ....+|+|+|+||.|.|+|++++.+|+++++++.+++
T Consensus       946 ~~~~~~~~~~~~-----~~~~~~rg~r~Rkev~y~d~~te~q~~k~~e~~~~~~  994 (1157)
T KOG0386|consen  946 DQGVERLSEEEE-----EEKILGRGRRARKEVVYSDRLTEMQWLKENESVNKED  994 (1157)
T ss_pred             chhhhhhhhhhh-----hhccccccccccceeecccccchhhhhhhcccccccc
Confidence            776555444332     2334899999999999999999999999988765433

>KOG0385|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PF14619 SnAC: Snf2-ATP coupling, chromatin remodelling complex Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>smart00592 BRK domain in transcription and CHROMO domain helicases Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF06465 DUF1087: Domain of Unknown Function (DUF1087); InterPro: IPR009463 This is a group of proteins of unknown function Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07533 BRK: BRK domain; InterPro: IPR006576 BRK is a domain of unknown function found only in the metazoa and in association with CHROMO domain (IPR000953 from INTERPRO) and DEAD/DEAH box helicase domain (IPR011545 from INTERPRO) Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00573 HSA domain in helicases and associated with SANT domains Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13892 DBINO: DNA-binding domain Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF07529 HSA: HSA; InterPro: IPR006562 This domain of unknown function is found in helicases and other DNA-binding proteins of eukaryotes [] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>KOG0442|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1281
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 0.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 1e-149
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 0.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 1e-142
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 1e-127
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 2e-70
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 6e-81
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 7e-41
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 3e-63
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 9e-63
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 2e-61
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 4e-60
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 2e-21
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-17
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
2v0f_A87 Chromodomain-helicase-DNA-binding protein 7; nucle 1e-08
2ckc_A80 Chromodomain-helicase-DNA-binding protein 7; prote 1e-08
2dl6_A83 Chromodomain-helicase-DNA-binding protein 8; BRK, 2e-08
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-08
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-05
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 4e-08
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 2e-07
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 5e-07
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 4e-05
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 4e-05
2cka_A95 Chromodomain-helicase-DNA-binding protein 8; BRK d 5e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-04
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 1e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-05
2i7x_A717 Protein CFT2; polyadenylation, metallo-B-lactamase 2e-05
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 3e-05
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 1e-04
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 3e-04
1y8q_B640 Anthracycline-, ubiquitin-like 2 activating enzyme 3e-04
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
 Score =  808 bits (2089), Expect = 0.0
 Identities = 245/775 (31%), Positives = 394/775 (50%), Gaps = 47/775 (6%)

Query: 335  NYHINAEKEQKKEQERIEKERMRRLMAEDE--EGYRKLIDQKKDKRLAFLLSQTDEYISN 392
                N + E     + +   R++  + E +  E     ++  K+     +    + ++ N
Sbjct: 27   EASANPQPEDFHGIDIVINHRLKTSLEEGKVLEKTVPDLNNCKENYEFLIKWTDESHLHN 86

Query: 393  LTQMVKEHKEEQQKKMREEKKKKKKSIKQKILDGNMDKLDLDE--SSQLEDLRITVKETN 450
              +  +   + +  K  +   K+     Q++        +  E    + E      +E +
Sbjct: 87   TWETYESIGQVRGLKRLDNYCKQFIIEDQQVRLDPYVTAEDIEIMDMERERRLDEFEEFH 146

Query: 451  SDNKLRGEDAPPAKQIKEWLASHPGWEVVMEDSEDEGSEDEEMKEKKEEPSKAVGEKKTE 510
               ++        +     L     W      + DE + +      K  P +    +  E
Sbjct: 147  VPERIIDSQRASLEDGTSQLQYLVKWR---RLNYDEATWENATDIVKLAPEQVKHFQNRE 203

Query: 511  DDEYKDAGEEATYYSIAHTYHEKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLNGILA 570
            + +     + ++ Y+      EK++ Q   +  G+L+++Q+ G+ WM  L++   NGILA
Sbjct: 204  NSKILP--QYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILA 261

Query: 571  DEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTLSNWVLEFEKWAPSANVVAYKGSP 630
            DEMGLGKTVQT+A +++L+  ++  GP++++VPLST+  W+  FEKWAP  N + Y G+ 
Sbjct: 262  DEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQ 321

Query: 631  LARRALQ----------GRMKNSKFNVLLTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKN 680
             +R  ++             K  KFNVLLTTYE+I+KD++ L  I+W+ M +DE HR+KN
Sbjct: 322  KSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKN 381

Query: 681  HHCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFA 740
                L ++LN+F   ++R+L+TGTPLQN + EL AL+NFL+P  F      +        
Sbjct: 382  AESSLYESLNSF-KVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQ---- 436

Query: 741  TTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLY 800
                     +EE    I  LH+ ++PF+LRRLKK+VE  LP K E I++ ++S +Q   Y
Sbjct: 437  ---------DEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYY 487

Query: 801  QHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQHIGQNNT 860
            ++     IL  + S      +GG  +L N + +L+K  NHP++F N EE+  Q  G    
Sbjct: 488  KN-----ILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLFDNAEERVLQKFGDGKM 542

Query: 861  V--VSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRL 918
                    +  +SGK  LLD++L + K+  HRVL+F QM +++ IL DY   +  ++ RL
Sbjct: 543  TRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRL 602

Query: 919  DGTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQA 978
            DGT  S  R   +  FN P+S  F+FLLSTRAGGLG+NL  ADTV+IFDSDWNP  DLQA
Sbjct: 603  DGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQA 662

Query: 979  QDRAHRIGQKNEVRVLRLITVNSVEERILAAARYKLNMDEKVIQAGMFDQKSTGSERH-- 1036
              RAHRIGQKN V V RL++ ++VEE +L  AR K+ ++  +I  G+ D      +    
Sbjct: 663  MARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPN 722

Query: 1037 -EFLQTILHQDDE----EEEENEVPDDETVNQLIARTEDELTLFQKMDAERRKGE 1086
               L  IL           +  +  +D  ++ ++   ED +T     ++     E
Sbjct: 723  AGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHAEDHVTTPDLGESHLGGEE 777
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2v0f_A Chromodomain-helicase-DNA-binding protein 7; nucleotide-binding, chromatin regulator, charge syndrome, phosphorylation, disease mutation; NMR {Homo sapiens} SCOP: d.76.2.1 Length = 87 Back     alignment and structure
>2dl6_A Chromodomain-helicase-DNA-binding protein 8; BRK, CHD8, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.76.2.1 Length = 83 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Length = 717 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1281
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 100.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 100.0
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
3h1t_A590 Type I site-specific restriction-modification syst 99.98
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.97
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.97
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.97
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.97
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.97
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 99.96
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.96
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.96
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.96
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.96
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.96
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.95
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.95
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.95
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.94
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.94
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.94
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.94
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.93
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.93
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.92
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.92
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.91
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.91
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.9
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.89
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.89
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 99.89
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.89
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.89
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.85
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.8
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.79
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.79
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.79
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.77
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.77
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.77
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.76
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.76
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.76
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.75
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.74
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.73
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.73
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.73
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.73
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.72
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.72
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.71
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.71
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.7
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.7
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.7
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.68
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.68
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.68
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.67
3jux_A822 Protein translocase subunit SECA; protein transloc 99.67
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.66
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.65
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.46
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.64
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.63
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.63
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.62
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.61
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.59
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.59
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.58
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.58
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.58
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.58
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.57
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.57
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.57
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.57
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.56
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.32
3bor_A237 Human initiation factor 4A-II; translation initiat 99.54
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.53
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.52
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.52
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.51
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.51
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.48
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.45
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.44
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.42
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.41
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.38
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.37
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.35
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.35
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.34
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.32
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.3
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.3
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.29
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.29
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.29
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.28
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.27
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.26
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.25
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.24
3h1t_A590 Type I site-specific restriction-modification syst 99.19
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.17
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.16
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.15
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.14
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.02
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 98.97
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.95
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 98.92
2xgj_A1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 98.92
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 98.92
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.92
3jux_A822 Protein translocase subunit SECA; protein transloc 98.89
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.88
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.84
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 98.82
3l9o_A1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 98.81
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 98.81
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 98.78
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.78
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 98.78
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 98.74
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 98.73
1yks_A440 Genome polyprotein [contains: flavivirin protease 98.67
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.66
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 98.66
4a4z_A997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 98.63
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 98.62
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 98.59
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.59
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 98.51
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 98.51
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.47
1gku_B1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 98.43
4ddu_A1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.33
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.25
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 97.63
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.4
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.31
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.22
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.09
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.02
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.02
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.51
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.47
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.0
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.57
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.52
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 95.4
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.26
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 95.23
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 95.2
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 94.79
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 94.68
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.59
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.52
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.01
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 93.95
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 93.56
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.33
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 92.97
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 92.44
2chg_A226 Replication factor C small subunit; DNA-binding pr 92.21
3bos_A242 Putative DNA replication factor; P-loop containing 92.06
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 91.94
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 91.9
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 91.46
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 91.3
2gno_A305 DNA polymerase III, gamma subunit-related protein; 91.0
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 90.77
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 90.67
3co5_A143 Putative two-component system transcriptional RES 90.53
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 90.04
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 89.95
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 89.73
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 89.66
2v1u_A387 Cell division control protein 6 homolog; DNA repli 89.62
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 89.45
2v0f_A87 Chromodomain-helicase-DNA-binding protein 7; nucle 89.19
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 89.16
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 89.03
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 88.86
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 88.38
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 88.12
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 87.2
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 86.99
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 86.97
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 86.79
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 86.59
2kjq_A149 DNAA-related protein; solution structure, NESG, st 86.47
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 86.19
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 85.35
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 85.15
1ojl_A304 Transcriptional regulatory protein ZRAR; response 84.59
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 84.49
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 84.46
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 84.2
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 84.08
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 83.99
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 83.8
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 83.73
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 83.42
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 83.08
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 82.89
2r6a_A454 DNAB helicase, replicative helicase; replication, 82.47
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 82.1
2cka_A95 Chromodomain-helicase-DNA-binding protein 8; BRK d 81.96
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 81.95
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 81.51
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 81.3
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 81.25
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 81.11
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 80.6
2chq_A319 Replication factor C small subunit; DNA-binding pr 80.46
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 80.34
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=3.3e-79  Score=790.56  Aligned_cols=519  Identities=42%  Similarity=0.729  Sum_probs=422.6

Q ss_pred             ccccccCcccccCcccHHHHHHHHHHHHhhcCCCCeEEecCCCCCHHHHHHHHHHHHHHhcCCCCCEEEEeCCccHHHHH
Q psy7773         532 EKVTEQASIMVNGKLKEYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVIVPLSTLSNWV  611 (1281)
Q Consensus       532 ~~~~~~p~~~~~~~L~~yQ~~gv~~l~~~~~~~~~gILademGlGKTi~ai~ll~~l~~~~~~~~~~LIV~P~s~l~~W~  611 (1281)
                      ..+..+|+...+++|||||++||+||+..+.++.||||||+||+|||+|+|+++.+++......+|+|||||.+++.||.
T Consensus       223 ~~~~~~p~~~~~~~Lr~yQ~egv~~l~~~~~~~~~~ILademGlGKT~~ai~~i~~l~~~~~~~~~~LIV~P~sll~qW~  302 (800)
T 3mwy_W          223 EKLSVQPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWL  302 (800)
T ss_dssp             CCCSSCCTTCCSSCCCTHHHHHHHHHHHHHTTTCCEEECCCTTSSTTHHHHHHHHHHHHHHSCCSCEEEECCTTTHHHHH
T ss_pred             cccccCCCccCCCCcCHHHHHHHHHHHHHhhcCCCEEEEeCCCcchHHHHHHHHHHHHHhcCCCCCEEEEECchHHHHHH
Confidence            44567888888999999999999999999999999999999999999999999999987778889999999999999999


Q ss_pred             HHHHHHCCCCcEEEEeCCHHHHHHHHhh----------hccCCccEEEechHHHhhcccccccCceeEEEEeCCcccccc
Q psy7773         612 LEFEKWAPSANVVAYKGSPLARRALQGR----------MKNSKFNVLLTTYEFIIKDKSVLSKIQWKCMIIDEGHRMKNH  681 (1281)
Q Consensus       612 ~E~~~~~p~~~~~~~~g~~~~r~~~~~~----------~~~~~~~vvItTye~l~~~~~~l~~~~w~~vIvDEaHr~kn~  681 (1281)
                      .||.+|+|++.+++|+|....+..+...          .....++|+||||+++.++...+..+.|++|||||||++||.
T Consensus       303 ~E~~~~~p~~~v~~~~g~~~~r~~~~~~~~~~~~~~~~~~~~~~dvvitTy~~l~~~~~~l~~~~w~~vIvDEaH~lkn~  382 (800)
T 3mwy_W          303 DTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNA  382 (800)
T ss_dssp             HHHHHHSTTCCEEECCCSSHHHHHHHHHHSCSCC-----CCCCCSEEEECTTHHHHTHHHHHTSEEEEEEETTGGGGCCS
T ss_pred             HHHHHHCCCceEEEEeCCHHHHHHHHHHHhhccccccccccccCCEEEecHHHHHhhHHHHhcCCcceeehhhhhhhcCc
Confidence            9999999999999999998877665432          234678999999999999999999999999999999999999


Q ss_pred             chHHHHHHHhhhccCcEEEeecCCCCCChhHHHHHHhhhcCCCCCChhHHHHHhcccccCCcccccCCHHHHHHHHHHHH
Q psy7773         682 HCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLH  761 (1281)
Q Consensus       682 ~s~~~~~l~~~~~~~~rllLTgTPl~n~~~el~~ll~fl~p~~~~~~~~f~~~f~~~~~~~~~~~~~~~~~~~~~~~~L~  761 (1281)
                      .++.++++..+ ++.+||+|||||++|++.|||++++||.|+.|.....|.-..             ........+..|+
T Consensus       383 ~s~~~~~l~~l-~~~~rl~LTgTPiqN~l~el~~ll~fL~p~~~~~~~~~~~~~-------------~~~~~~~~~~~L~  448 (800)
T 3mwy_W          383 ESSLYESLNSF-KVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFEN-------------QDEEQEEYIHDLH  448 (800)
T ss_dssp             SSHHHHHHTTS-EEEEEEEECSCCCSSCSHHHHHHHHHHCSCCC---------C-------------CTTHHHHHHHHHH
T ss_pred             hhHHHHHHHHh-hhccEEEeeCCcCCCCHHHHHHHHHHhCccccCchhhhcccc-------------cchhHHHHHHHHH
Confidence            99999999876 899999999999999999999999999999998766553111             1112334578899


Q ss_pred             HhhhHHHHHHhHHHHhhcCCCceEEEEEcCCCHHHHHHHHHHHhcccccccCCccCCCCCCchHHHHHHHHHHHHhcCCc
Q psy7773         762 KVLRPFLLRRLKKEVESQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHP  841 (1281)
Q Consensus       762 ~~l~~~~lRR~k~~v~~~lP~k~~~~v~~~ls~~q~~lY~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~Lrk~~~hp  841 (1281)
                      .+++|+++||++.++...||++.+.++.|+|++.|+.+|..+...........     .......+++.++.||++|+||
T Consensus       449 ~~l~p~~lRR~k~dv~~~LP~k~~~~v~v~ls~~q~~~Y~~i~~~~~~~l~~~-----~~~~~~~~l~~l~~Lrk~~~hp  523 (800)
T 3mwy_W          449 RRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAG-----AKGGHFSLLNIMNELKKASNHP  523 (800)
T ss_dssp             HTTGGGEEECCGGGGTTTSCCEEEEEEEECCCHHHHHHHHHHHHHCCC---------------CTHHHHHHHHHHHHHCG
T ss_pred             HHHhHHHhhhhHHhhhhccCCcEEEEEEeCCCHHHHHHHHHHHHHHHHHHhhc-----cccchhhHHHHHHHHHHHhcCh
Confidence            99999999999999999999999999999999999999999887654433221     1123345889999999999999


Q ss_pred             cchhhhHHHHHhhhcCCCc--cccCCccccccchHHHHHHHhhhhhhcCCeEEEEechHHHHHHHHHHHHHCCCcEEEEe
Q psy7773         842 FMFQNIEEKYCQHIGQNNT--VVSGPDIYRTSGKFELLDRILPKFKETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLD  919 (1281)
Q Consensus       842 ~l~~~~~~~~~~~~~~~~~--~~~~~~~~~~s~K~~~L~~lL~~~~~~~~kvLIFsq~~~~ld~L~~~L~~~g~~~~~l~  919 (1281)
                      +++..........++....  ......++..|+|+.+|..+|..+...|+||||||+++.++++|+.+|...|+++++++
T Consensus       524 ~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~s~K~~~L~~lL~~~~~~g~kvLIFsq~~~~ld~L~~~L~~~g~~~~~i~  603 (800)
T 3mwy_W          524 YLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLD  603 (800)
T ss_dssp             GGSSSHHHHHCCCC----CCSHHHHHHHHHTCHHHHHHHHHHHHHTTTTCCEEEEESCHHHHHHHHHHHHHHTCCCEEES
T ss_pred             hhhcchHHHHHHhcccccccHHHHHHHhhhcChHHHHHHHHHHHHhhCCCeEEEEechHHHHHHHHHHHHhCCCCEEEEe
Confidence            9998766544322211100  00012345679999999999999999999999999999999999999999999999999


Q ss_pred             CCCChHHHHHHHHhhcCCCCCeEEEEEeccccccccCcccCCEEEEeCCCCChhhhhhHhHhHHhhCCCCceEEEEEEeC
Q psy7773         920 GTTKSEDRGELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITV  999 (1281)
Q Consensus       920 G~~~~~~R~~~i~~Fn~~~~~~~v~LlsT~agg~GlNL~~ad~VI~~D~~wnp~~~~Qa~gR~~RiGQ~k~V~V~rli~~  999 (1281)
                      |+++..+|+.+++.|++++++++|||+||++||+||||+.||+||+||++|||..+.||+||+||+||+++|+||+|++.
T Consensus       604 G~~~~~eR~~~i~~F~~~~~~~~v~LlSt~agg~GlNL~~a~~VI~~D~~wnp~~~~Qa~gR~~RiGQ~k~V~Vyrlv~~  683 (800)
T 3mwy_W          604 GTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSK  683 (800)
T ss_dssp             TTSCHHHHHHHHHTTSSTTCSCCCEEEEHHHHTTTCCCTTCCEEEESSCCSCSHHHHHHHTTTSCSSCCSCEEEEEEEET
T ss_pred             CCCCHHHHHHHHHHhhCCCCCceEEEEecccccCCCCccccceEEEecCCCChhhHHHHHHHHHhcCCCceEEEEEEecC
Confidence            99999999999999999888888999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHhcCcCCCCCC---hhhHHHHHHHHhccCCchh----hcCCCCCHHHHHHHHhhCH
Q psy7773        1000 NSVEERILAAARYKLNMDEKVIQAGMFDQKST---GSERHEFLQTILHQDDEEE----EENEVPDDETVNQLIARTE 1069 (1281)
Q Consensus      1000 ~tiEe~I~~~~~~K~~l~~~vi~~g~~~~~~~---~~~~~~~l~~il~~~~~~~----~~~~~~~~~~~~~~~~~~~ 1069 (1281)
                      +|+|++|++++..|+.+.+.+++.|..+....   .......+.+||..+....    +......+++|+.+|++++
T Consensus       684 ~TiEe~i~~~~~~K~~l~~~vi~~~~~~~~~~~~~~~~~~~el~~ll~~g~~~~~~~~~~~~~~~~~~~~~~l~~~~  760 (800)
T 3mwy_W          684 DTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDNQKKLEDLNLDDVLNHAE  760 (800)
T ss_dssp             TSHHHHHHHHHHHHTTSCC----------------CCCCHHHHHHHHSSCSSSSCCSHHHHHHHHTCCHHHHHHHCE
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHccCcccccccccccCCCHHHHHHHHHcchHhhhhccCccccccccCHHHHHHhhh
Confidence            99999999999999999999999887664321   1223456778887665211    1111122345777777665
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2v0f_A Chromodomain-helicase-DNA-binding protein 7; nucleotide-binding, chromatin regulator, charge syndrome, phosphorylation, disease mutation; NMR {Homo sapiens} SCOP: d.76.2.1 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1281
d1z63a1230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 2e-43
d1z63a1230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 5e-09
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 2e-40
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 2e-37
d1z3ix2298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 2e-39
d1z3ix2298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 3e-09
d1z5za1244 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h 3e-25
d1z5za1244 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h 2e-23
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-20
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-20
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-12
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-12
d2v0fa187 d.76.2.1 (A:2629-2715) Chromodomain-helicase-DNA-b 1e-10
d2ckca160 d.76.2.1 (A:2563-2622) Chromodomain-helicase-DNA-b 7e-09
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 9e-09
d2ckaa158 d.76.2.1 (A:2028-2085) Chromodomain-helicase-dna-b 4e-08
d1rifa_282 c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 5e-04
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 7e-04
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 9e-04
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 7e-04
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 0.004
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Helicase of the SNF2/Rad54 hamily
species: Sulfolobus solfataricus [TaxId: 2287]

 Score =  155 bits (393), Expect = 2e-43
 Identities = 78/242 (32%), Positives = 126/242 (52%), Gaps = 22/242 (9%)

Query: 542 VNGKLKEYQIKGLEWMVSLYNNNLNGILADEMGLGKTVQTIALLTYLMEKKKNLGPYLVI 601
           +   L+ YQIKG  WM  +        LAD+MGLGKT+QTIA+ +   ++ +   P LVI
Sbjct: 9   IKANLRPYQIKGFSWMRFMNKLGFGICLADDMGLGKTLQTIAVFSDAKKENEL-TPSLVI 67

Query: 602 VPLSTLSNWVLEFEKWAPSANVVAYKGSPLARRALQGRMKNSKFNVLLTTYEFIIKDKSV 661
            PLS L NW  E  K+AP      +          + ++K   ++++LTTY  +++D   
Sbjct: 68  CPLSVLKNWEEELSKFAPHLRFAVFHED-------RSKIKLEDYDIILTTYAVLLRDTR- 119

Query: 662 LSKIQWKCMIIDEGHRMKNHHCKLTQTLNTFYNSSHRVLLTGTPLQNKLPELWALLNFLL 721
           L +++WK ++IDE   +KN   K+ + +     S +R+ LTGTP++NK+ +LW+++ FL 
Sbjct: 120 LKEVEWKYIVIDEAQNIKNPQTKIFKAVK-ELKSKYRIALTGTPIENKVDDLWSIMTFLN 178

Query: 722 PSIFKSCSTFEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKE--VESQ 779
           P +  S S F+  F  P                     L  ++ PF+LRR K +  + + 
Sbjct: 179 PGLLGSYSEFKSKFATPIKKGDNMA----------KEELKAIISPFILRRTKYDKAIIND 228

Query: 780 LP 781
           LP
Sbjct: 229 LP 230
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d2v0fa1 d.76.2.1 (A:2629-2715) Chromodomain-helicase-DNA-binding protein 7, CHD7 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2ckca1 d.76.2.1 (A:2563-2622) Chromodomain-helicase-DNA-binding protein 7, CHD7 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d2ckaa1 d.76.2.1 (A:2028-2085) Chromodomain-helicase-dna-binding protein 8, CHD8 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Length = 282 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1281
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.85
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.85
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.8
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.79
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.79
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.79
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.77
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.76
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.75
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.74
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.74
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.74
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.72
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.72
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.71
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.71
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.71
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.69
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.69
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.65
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.64
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.6
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.58
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.57
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.5
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.48
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.47
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.44
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.4
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.4
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.39
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.38
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.31
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.28
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.25
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.23
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.23
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.23
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.17
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.16
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.13
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.12
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.11
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.06
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.05
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.01
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 98.99
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 98.96
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.92
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 98.89
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 98.78
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 98.77
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 98.68
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.5
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 98.43
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.26
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.24
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 97.99
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 97.99
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 97.91
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.84
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.23
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.22
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 96.99
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.48
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.08
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 95.93
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.75
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.61
d2v0fa187 Chromodomain-helicase-DNA-binding protein 7, CHD7 95.6
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.35
d2ckaa158 Chromodomain-helicase-dna-binding protein 8, CHD8 94.78
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 94.73
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.62
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.35
d2ckca160 Chromodomain-helicase-DNA-binding protein 7, CHD7 94.17
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.49
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.4
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 91.94
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 91.68
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.41
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 89.97
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 89.78
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.27
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.92
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 86.84
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 86.76
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 86.08
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 84.83
d2qy9a2211 GTPase domain of the signal recognition particle r 83.84
d1okkd2207 GTPase domain of the signal recognition particle r 83.38
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 82.73
d1ls1a2207 GTPase domain of the signal sequence recognition p 80.49
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

Probab=100.00  E-value=1.4e-41  Score=388.83  Aligned_cols=264  Identities=30%  Similarity=0.465  Sum_probs=212.8

Q ss_pred             HHh-hcCCCceEEEEEcCCCHHHHHHHHHHHhcccccccCCccCCCCCCchHHHHHHHHHHHHhcCCccchhhhHHHHHh
Q psy7773         775 EVE-SQLPEKVEYIIKCDMSGLQKLLYQHLHNRGILLTDGSEKGKTGEGGARALKNTIVQLRKLCNHPFMFQNIEEKYCQ  853 (1281)
Q Consensus       775 ~v~-~~lP~k~~~~v~~~ls~~q~~lY~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~Lrk~~~hp~l~~~~~~~~~~  853 (1281)
                      +|. +.||++++++++|+||+.|+.+|+.+..........     .........++.++.||++||||+|+.........
T Consensus         3 ~vl~k~LP~K~e~vv~v~LS~~Q~~lY~~~l~~~~~~~~~-----~~~~~~~~~L~~l~~LRkiCnHP~L~~~~~~~~~~   77 (346)
T d1z3ix1           3 DILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQAKPVESL-----QTGKISVSSLSSITSLKKLCNHPALIYEKCLTGEE   77 (346)
T ss_dssp             GGGGGTSCCEEEEEEEECCCHHHHHHHHHHHHHHCGGGSS-----CTTCCCHHHHHHHHHHHHHHHCTHHHHHHHHHTCT
T ss_pred             hhhhccCCCCEEEEEEeCCCHHHHHHHHHHHHHHHHHHhh-----hcCCchHHHHHHHHHHHHHhCCHHHhhhhhccccc
Confidence            444 589999999999999999999999987654332211     11122346788999999999999987543221111


Q ss_pred             hhcC-----CCccccCCccccccchHHHHHHHhhhhh-hcCCeEEEEechHHHHHHHHHHHHHCCCcEEEEeCCCChHHH
Q psy7773         854 HIGQ-----NNTVVSGPDIYRTSGKFELLDRILPKFK-ETKHRVLMFCQMTQLMTILEDYFIWRDFSYLRLDGTTKSEDR  927 (1281)
Q Consensus       854 ~~~~-----~~~~~~~~~~~~~s~K~~~L~~lL~~~~-~~~~kvLIFsq~~~~ld~L~~~L~~~g~~~~~l~G~~~~~~R  927 (1281)
                      ....     .............|+|+.+|..+|..+. ..|+||||||+|+.++++|+.+|...|++|++++|+++..+|
T Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~S~Kl~~L~~ll~~~~~~~g~KvlIFs~~~~~ld~l~~~l~~~g~~~~~l~G~~~~~~R  157 (346)
T d1z3ix1          78 GFDGALDLFPQNYSTKAVEPQLSGKMLVLDYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKR  157 (346)
T ss_dssp             TCTTGGGTSCSSCCSSSCCGGGSHHHHHHHHHHHHHHHHCCCEEEEEESCHHHHHHHHHHHHHHTCCEEEECSSCCHHHH
T ss_pred             cccchhhhccccccccccccccCHHHHHHHHHHHHHHHhcCCceeEEeehhhhhHHHHHHHhhhhccccccccchhHHHH
Confidence            0000     0011122234567999999999998875 578999999999999999999999999999999999999999


Q ss_pred             HHHHHhhcCCCCCeEEEEEeccccccccCcccCCEEEEeCCCCChhhhhhHhHhHHhhCCCCceEEEEEEeCCCHHHHHH
Q psy7773         928 GELLRKFNEPESKYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQKNEVRVLRLITVNSVEERIL 1007 (1281)
Q Consensus       928 ~~~i~~Fn~~~~~~~v~LlsT~agg~GlNL~~ad~VI~~D~~wnp~~~~Qa~gR~~RiGQ~k~V~V~rli~~~tiEe~I~ 1007 (1281)
                      ..+++.||+++++.+|||+||.+||+||||+.|++||+||++|||..+.||+||+||+||+++|+||||++.||||++|+
T Consensus       158 ~~~i~~F~~~~~~~~vlLls~~agg~GlnL~~a~~vi~~d~~wnp~~~~Qa~~R~~R~GQ~~~V~v~rli~~~TiEe~i~  237 (346)
T d1z3ix1         158 AKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKIL  237 (346)
T ss_dssp             HHHHHHHHSTTCCCCEEEEEGGGSCTTCCCTTEEEEEECSCCSSHHHHHHHHTTSSSTTCCSCEEEEEEEETTSHHHHHH
T ss_pred             HHHHHhhhcccccceeeeecchhhhhccccccceEEEEecCCCccchHhHhhhcccccCCCCceEEEEEEeCCCHHHHHH
Confidence            99999999988888899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhcCcCCCCCChhhHHHHHHHHhccC
Q psy7773        1008 AAARYKLNMDEKVIQAGMFDQKSTGSERHEFLQTILHQD 1046 (1281)
Q Consensus      1008 ~~~~~K~~l~~~vi~~g~~~~~~~~~~~~~~l~~il~~~ 1046 (1281)
                      +++..|+.+++.|++.+......   ...+.|..++...
T Consensus       238 ~~~~~K~~l~~~v~~~~~~~~~~---~~~~~l~~lf~~~  273 (346)
T d1z3ix1         238 QRQAHKKALSSCVVDEEQDVERH---FSLGELRELFSLN  273 (346)
T ss_dssp             HHHHHHHHTSCCCCSCSSSCCCS---SCHHHHHHHTCCC
T ss_pred             HHHHHHHHHHHHHhCCchhhhhc---CCHHHHHHHhcCC
Confidence            99999999999999765432221   1223455665544
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2v0fa1 d.76.2.1 (A:2629-2715) Chromodomain-helicase-DNA-binding protein 7, CHD7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2ckaa1 d.76.2.1 (A:2028-2085) Chromodomain-helicase-dna-binding protein 8, CHD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ckca1 d.76.2.1 (A:2563-2622) Chromodomain-helicase-DNA-binding protein 7, CHD7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure