Psyllid ID: psy7788

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELESETEKFLDLGGDERGCAYCGGLGHRITACPKLEAVQTKAASSIGRRDYLNSNQADY
cccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccc
ccHHHHHHHHEccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHcccccccc
msqmmntmfpmigrtgrsgktglaTTFINKSNDESVLLDLKHLLLEARQRIPPFLAELESETEKFLDlggdergcaycgglghritacpkLEAVQTKAAssigrrdylnsnqady
MSQMMNTMFpmigrtgrsgKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELESETEKFLDLGGDERGCAYCGGLGHRITACPKLEAVQTKaassigrrdylnsnqady
MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELESETEKFLDLGGDERGCAYCGGLGHRITACPKLEAVQTKAASSIGRRDYLNSNQADY
*********************GLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELESETEKFLDLGGDERGCAYCGGLGHRITACPKLEAVQ********************
MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPF*************************************************************
MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELESETEKFLDLGGDERGCAYCGGLGHRITACPKLEAVQTKAASSIGRRDYLNSNQADY
MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELESE***********RGCAYCGGLGHRITACPKLEAVQTKAAS***************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELESETEKFLDLGGDERGCAYCGGLGHRITACPKLEAVQTKAASSIGRRDYLNSNQADY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query115 2.2.26 [Sep-21-2011]
Q91VN6622 Probable ATP-dependent RN yes N/A 0.991 0.183 0.626 4e-36
Q9UJV9622 Probable ATP-dependent RN yes N/A 0.991 0.183 0.626 5e-36
Q9V3C0619 ATP-dependent RNA helicas yes N/A 0.895 0.166 0.695 7e-36
Q9SZB4542 Putative DEAD-box ATP-dep no N/A 0.852 0.180 0.611 9e-28
Q9LU46591 DEAD-box ATP-dependent RN yes N/A 0.843 0.164 0.627 9e-28
Q0E3X4627 DEAD-box ATP-dependent RN no N/A 0.756 0.138 0.640 3e-26
Q5Z6G5619 DEAD-box ATP-dependent RN no N/A 0.834 0.155 0.53 3e-23
Q54KG1671 Probable ATP-dependent RN yes N/A 0.852 0.146 0.456 4e-15
Q75B50623 ATP-dependent RNA helicas yes N/A 0.426 0.078 0.5 8e-07
A7TKR8650 ATP-dependent RNA helicas N/A N/A 0.434 0.076 0.490 1e-06
>sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 Back     alignment and function desciption
 Score =  149 bits (376), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 72/115 (62%), Positives = 87/115 (75%), Gaps = 1/115 (0%)

Query: 1   MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELES 60
           M + +      IGRTGRSG TG+ATTFINK+ DESVL+DLK LLLEA+Q++PP L  L  
Sbjct: 509 MPEEIENYVHRIGRTGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHC 568

Query: 61  ETEKFLDLGGDERGCAYCGGLGHRITACPKLEAVQTKAASSIGRRDYLNSNQADY 115
             E  LD+GG ERGCA+CGGLGHRIT CPKLEA+QTK  S+IGR+DYL  +  D+
Sbjct: 569 GDESMLDIGG-ERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF 622
Probable ATP-dependent RNA helicase. Is required during post-transcriptional gene expression. May be involved in pre-mRNA splicing.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 Back     alignment and function description
>sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 Back     alignment and function description
>sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 Back     alignment and function description
>sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 Back     alignment and function description
>sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 Back     alignment and function description
>sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 Back     alignment and function description
>sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 Back     alignment and function description
>sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 Back     alignment and function description
>sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
332024917 625 ATP-dependent RNA helicase abstrakt [Acr 0.895 0.164 0.807 1e-43
322784405 626 hypothetical protein SINV_10914 [Solenop 0.895 0.164 0.807 2e-43
307203840 624 ATP-dependent RNA helicase abstrakt [Har 0.895 0.165 0.807 2e-43
307174080 620 ATP-dependent RNA helicase abstrakt [Cam 0.895 0.166 0.807 2e-43
328783258 621 PREDICTED: ATP-dependent RNA helicase ab 0.895 0.165 0.798 2e-43
380024659 621 PREDICTED: ATP-dependent RNA helicase ab 0.895 0.165 0.798 2e-43
340725455 625 PREDICTED: ATP-dependent RNA helicase ab 0.895 0.164 0.798 2e-43
383858565 625 PREDICTED: ATP-dependent RNA helicase ab 0.895 0.164 0.798 2e-43
350415294 625 PREDICTED: ATP-dependent RNA helicase ab 0.895 0.164 0.798 2e-43
193683780 615 PREDICTED: ATP-dependent RNA helicase ab 0.895 0.167 0.807 2e-43
>gi|332024917|gb|EGI65105.1| ATP-dependent RNA helicase abstrakt [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/104 (80%), Positives = 95/104 (91%), Gaps = 1/104 (0%)

Query: 12  IGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELESETEKFLDLGGD 71
           IGRTGRSG+TG+ATTFINK+NDESVLLDLKHLL+EA+Q++PPFL EL SE EK+L+L GD
Sbjct: 523 IGRTGRSGRTGIATTFINKANDESVLLDLKHLLMEAKQKVPPFLLELCSENEKYLNL-GD 581

Query: 72  ERGCAYCGGLGHRITACPKLEAVQTKAASSIGRRDYLNSNQADY 115
           ERGC+YCGGLGHRIT CPKLEAVQ K AS+IGRRDYL SN ADY
Sbjct: 582 ERGCSYCGGLGHRITECPKLEAVQNKQASNIGRRDYLASNAADY 625

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322784405|gb|EFZ11376.1| hypothetical protein SINV_10914 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307203840|gb|EFN82776.1| ATP-dependent RNA helicase abstrakt [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307174080|gb|EFN64767.1| ATP-dependent RNA helicase abstrakt [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328783258|ref|XP_392069.4| PREDICTED: ATP-dependent RNA helicase abstrakt isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380024659|ref|XP_003696110.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Apis florea] Back     alignment and taxonomy information
>gi|340725455|ref|XP_003401085.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383858565|ref|XP_003704771.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350415294|ref|XP_003490595.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|193683780|ref|XP_001952119.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
ZFIN|ZDB-GENE-030131-1927473 ddx41 "DEAD (Asp-Glu-Ala-Asp) 0.895 0.217 0.663 1.2e-33
FB|FBgn0015331619 abs "abstrakt" [Drosophila mel 0.895 0.166 0.695 1.6e-33
UNIPROTKB|E2R052622 DDX41 "Uncharacterized protein 0.895 0.165 0.682 2.1e-33
UNIPROTKB|Q9UJV9622 DDX41 "Probable ATP-dependent 0.895 0.165 0.682 2.1e-33
MGI|MGI:1920185622 Ddx41 "DEAD (Asp-Glu-Ala-Asp) 0.895 0.165 0.682 2.1e-33
RGD|1311758622 Ddx41 "DEAD (Asp-Glu-Ala-Asp) 0.895 0.165 0.682 2.1e-33
UNIPROTKB|J3KNN5640 DDX41 "Probable ATP-dependent 0.895 0.160 0.682 2.4e-33
UNIPROTKB|J9NZF6649 DDX41 "Uncharacterized protein 0.895 0.158 0.682 2.6e-33
UNIPROTKB|A3KN07622 DDX41 "Uncharacterized protein 0.895 0.165 0.673 5.9e-33
RGD|1559513621 RGD1559513 "similar to DEAD (A 0.895 0.165 0.663 2.1e-32
ZFIN|ZDB-GENE-030131-1927 ddx41 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 366 (133.9 bits), Expect = 1.2e-33, P = 1.2e-33
 Identities = 69/104 (66%), Positives = 85/104 (81%)

Query:    12 IGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELESETEKFLDLGGD 71
             IGRTGRSGKTG+ATTFINK  DESVL+DLK LL+EA+Q++PP L  L +  E  LD+GG 
Sbjct:   371 IGRTGRSGKTGIATTFINKGCDESVLMDLKALLVEAKQKVPPVLQVLHTGDETMLDIGG- 429

Query:    72 ERGCAYCGGLGHRITACPKLEAVQTKAASSIGRRDYLNSNQADY 115
             ERGC +CGGLGHRIT CPKLEA+QTK  ++IGR+DYL ++  D+
Sbjct:   430 ERGCTFCGGLGHRITDCPKLEAMQTKQVTNIGRKDYLANSSMDF 473
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
FB|FBgn0015331 abs "abstrakt" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2R052 DDX41 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UJV9 DDX41 "Probable ATP-dependent RNA helicase DDX41" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1920185 Ddx41 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311758 Ddx41 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNN5 DDX41 "Probable ATP-dependent RNA helicase DDX41" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZF6 DDX41 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A3KN07 DDX41 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1559513 RGD1559513 "similar to DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6CLR3DED1_KLULA3, ., 6, ., 4, ., 1, 30.520.42600.0781yesN/A
Q9LU46RH35_ARATH3, ., 6, ., 4, ., 1, 30.62740.84340.1641yesN/A
Q91VN6DDX41_MOUSE3, ., 6, ., 4, ., 1, 30.62600.99130.1832yesN/A
Q9V3C0DDX41_DROME3, ., 6, ., 4, ., 1, 30.69520.89560.1663yesN/A
Q9UJV9DDX41_HUMAN3, ., 6, ., 4, ., 1, 30.62600.99130.1832yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 3e-06
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 1e-05
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score = 44.0 bits (104), Expect = 3e-06
 Identities = 15/59 (25%), Positives = 27/59 (45%), Gaps = 3/59 (5%)

Query: 12  IGRTGRSGKTGLATTFINKSNDESVLLDLKHLL---LEARQRIPPFLAELESETEKFLD 67
           IGRTGR+G+ G+A +F+ +  +   L  ++  L   L +   +P    E     +    
Sbjct: 361 IGRTGRAGRKGVAISFVTEEEEVKKLKRIEKRLERKLPSAVLLPLDEPEDAKLLKTTRP 419

Length = 513
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 115
KOG0341|consensus610 99.97
KOG0336|consensus629 99.6
KOG0339|consensus731 99.54
KOG0335|consensus482 99.53
KOG0331|consensus519 99.51
PTZ00110545 helicase; Provisional 99.45
KOG0334|consensus 997 99.39
KOG0333|consensus673 99.33
KOG0328|consensus400 99.29
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.25
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.19
KOG0340|consensus442 99.11
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.1
KOG0330|consensus476 99.06
KOG0326|consensus459 99.03
KOG0344|consensus593 99.02
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 98.95
KOG0346|consensus569 98.95
KOG0327|consensus397 98.95
KOG0338|consensus691 98.93
KOG0332|consensus477 98.9
KOG0342|consensus543 98.86
KOG0350|consensus620 98.74
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 98.72
KOG0329|consensus387 98.69
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.68
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 98.66
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 98.63
KOG0348|consensus708 98.58
PTZ00424401 helicase 45; Provisional 98.58
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 98.56
KOG0349|consensus725 98.52
KOG0347|consensus731 98.42
KOG0345|consensus 567 98.4
KOG0343|consensus 758 98.35
KOG4284|consensus 980 98.31
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 98.15
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 98.13
PRK05298652 excinuclease ABC subunit B; Provisional 97.95
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 97.94
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 97.91
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 97.87
KOG0337|consensus529 97.85
PRK09200 790 preprotein translocase subunit SecA; Reviewed 97.81
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 97.55
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 97.52
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 97.26
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 97.12
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 96.97
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 96.92
PRK04914 956 ATP-dependent helicase HepA; Validated 96.91
PHA02653675 RNA helicase NPH-II; Provisional 96.87
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 96.74
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 96.48
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 96.26
PRK02362 737 ski2-like helicase; Provisional 96.05
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 95.66
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 95.63
PRK13767 876 ATP-dependent helicase; Provisional 95.6
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 95.31
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 95.27
TIGR00643630 recG ATP-dependent DNA helicase RecG. 95.11
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 94.74
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 94.6
PRK10689 1147 transcription-repair coupling factor; Provisional 94.49
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 94.48
PRK01172 674 ski2-like helicase; Provisional 94.42
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 93.75
PRK00254 720 ski2-like helicase; Provisional 92.85
PRK13766 773 Hef nuclease; Provisional 92.65
KOG0351|consensus 941 92.23
PHA02558501 uvsW UvsW helicase; Provisional 91.21
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 90.32
KOG0950|consensus 1008 84.95
PRK05580679 primosome assembly protein PriA; Validated 83.89
TIGR00595505 priA primosomal protein N'. All proteins in this f 80.4
>KOG0341|consensus Back     alignment and domain information 
Probab=99.97  E-value=2.5e-32  Score=220.86  Aligned_cols=111  Identities=65%  Similarity=1.052  Sum_probs=102.6

Q ss_pred             CCCCcccceeeccccccCCCCcceEEeecCCcchHHHHHHHHHHHHhCCCCChHHHHhHHhhhh--hccCCCCCCCCCCC
Q psy7788           1 MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELESETEK--FLDLGGDERGCAYC   78 (115)
Q Consensus         1 lP~~~e~YVHRIGRTGR~G~~G~aitf~~~~~d~~~~~~l~~~l~~~~q~vp~~l~~~~~~~~~--~~~~g~~~~g~~~~   78 (115)
                      ||.++|+||||||||||.|++|+|+||+++.++...+.+|..+|.+++|++|++|.+++...+.  ..+.+ +.+||.||
T Consensus       498 MP~eIENYVHRIGRTGRsg~~GiATTfINK~~~esvLlDLK~LL~EakQ~vP~~L~~L~~~~E~~~~a~~~-~~kGCayC  576 (610)
T KOG0341|consen  498 MPEEIENYVHRIGRTGRSGKTGIATTFINKNQEESVLLDLKHLLQEAKQEVPPVLAELAGPMEEETIADAG-GEKGCAYC  576 (610)
T ss_pred             ChHHHHHHHHHhcccCCCCCcceeeeeecccchHHHHHHHHHHHHHhhccCCHHHHHhCCCccccccccCC-Cccccccc
Confidence            7999999999999999999999999999999899999999999999999999999999987664  33444 67999999


Q ss_pred             CCCCcccCCcchHHHHHhhhhccCCCCcccCCCC
Q psy7788          79 GGLGHRITACPKLEAVQTKAASSIGRRDYLNSNQ  112 (115)
Q Consensus        79 gG~G~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~  112 (115)
                      ||+||||++||||++++.|+.|+.+++||+++++
T Consensus       577 gGLGHRItdCPKle~~~~k~~sn~gRkdy~~~~~  610 (610)
T KOG0341|consen  577 GGLGHRITDCPKLEAQQNKQISNIGRKDYLGSGG  610 (610)
T ss_pred             cCCCcccccCchhhhhcchhhhhhccccccCCCC
Confidence            9999999999999999999999999999998763

>KOG0336|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 6e-14
2jgn_A185 Ddx3 Helicase Domain Length = 185 2e-06
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 3e-06
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 3e-04
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure 
Iteration: 1

 Score = 72.4 bits (176), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%)
Query: 1   MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAEL 58
           M + +      IGRTG SG TG+ATTFINK+ DESVL+DLK LLLEA+Q++PP L  L
Sbjct: 131 MPEEIENYVHRIGRTGCSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVL 188
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 8e-22
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 6e-19
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 6e-17
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-16
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 6e-06
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 7e-06
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-05
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 4e-05
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 4e-05
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 5e-05
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 8e-05
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 9e-05
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 1e-04
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-04
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-04
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 1e-04
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 2e-04
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 2e-04
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 3e-04
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 3e-04
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 3e-04
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 4e-04
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 5e-04
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 8e-04
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
 Score = 83.8 bits (208), Expect = 8e-22
 Identities = 34/49 (69%), Positives = 40/49 (81%)

Query: 12  IGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELES 60
           IGRTG SG TG+ATTFINK+ DESVL+DLK LLLEA+Q++PP L  L  
Sbjct: 142 IGRTGCSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHC 190
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.32
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.24
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.18
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.0
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 98.94
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 98.83
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 98.78
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 98.78
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.73
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 98.72
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 98.63
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.62
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 97.98
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 98.52
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.47
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.43
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 98.38
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.35
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.35
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.35
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 98.31
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.29
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 98.14
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 98.12
1yks_A440 Genome polyprotein [contains: flavivirin protease 98.11
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.08
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 98.07
3jux_A 822 Protein translocase subunit SECA; protein transloc 98.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 97.98
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 97.92
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 97.81
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 97.81
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 97.8
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 97.8
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 97.79
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 97.74
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 97.74
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.72
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.66
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.56
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 97.56
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 97.55
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 97.47
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 97.17
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 96.86
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 96.64
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 96.56
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 96.47
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 96.44
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 96.38
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 96.23
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 96.17
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 96.03
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 96.03
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 95.98
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 95.84
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 95.83
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 95.46
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 95.38
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 95.08
4gl2_A699 Interferon-induced helicase C domain-containing P; 95.05
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 94.24
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 93.06
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 92.98
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 91.4
3h1t_A590 Type I site-specific restriction-modification syst 90.71
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 90.54
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 90.22
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 84.64
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=99.32  E-value=3.1e-13  Score=107.64  Aligned_cols=58  Identities=34%  Similarity=0.586  Sum_probs=52.9

Q ss_pred             CCCCcccceeeccccccCCCCcceEEeecCCcchHHHHHHHHHHHHhCCCCChHHHHh
Q psy7788           1 MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAEL   58 (115)
Q Consensus         1 lP~~~e~YVHRIGRTGR~G~~G~aitf~~~~~d~~~~~~l~~~l~~~~q~vp~~l~~~   58 (115)
                      +|.++++|+||||||||+|+.|.|++|+++.++..++.+|+++|..+.|++|+||.+|
T Consensus       377 ~p~~~~~y~qriGR~gR~g~~G~a~~~~~~~~~~~~~~~l~~~l~~~~~~vp~~l~~~  434 (434)
T 2db3_A          377 MPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRTC  434 (434)
T ss_dssp             CCSSHHHHHHHHTTSSCTTCCEEEEEEECTTTCGGGHHHHHHHHHHTTCCCCGGGC--
T ss_pred             CCCCHHHHHHHhcccccCCCCCEEEEEEeccccHHHHHHHHHHHHHcCCCCCHHHHhC
Confidence            5889999999999999999999999999976588899999999999999999998764
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 115
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-06
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 5e-06
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-05
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 2e-04
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Spliceosome RNA helicase BAT1 (UAP56)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 42.4 bits (98), Expect = 1e-06
 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 1/64 (1%)

Query: 1   MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAELES 60
           M +  +T    + R GR G  GLA TF++  ND  +L D++         +P  + ++ S
Sbjct: 104 MPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEI-DISS 162

Query: 61  ETEK 64
             E+
Sbjct: 163 YIEQ 166
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.36
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.26
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.2
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.16
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.05
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.01
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 98.8
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 97.73
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 97.44
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 97.25
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.13
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.76
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 96.35
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 96.11
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.36  E-value=4e-14  Score=99.05  Aligned_cols=57  Identities=25%  Similarity=0.471  Sum_probs=48.3

Q ss_pred             CCCCcccceeeccccccCCCCcceEEeecCCcchHHHHHHHHHHHHhCCCCChHHHHh
Q psy7788           1 MSQMMNTMFPMIGRTGRSGKTGLATTFINKSNDESVLLDLKHLLLEARQRIPPFLAEL   58 (115)
Q Consensus         1 lP~~~e~YVHRIGRTGR~G~~G~aitf~~~~~d~~~~~~l~~~l~~~~q~vp~~l~~~   58 (115)
                      +|.++++|+||+|||||+|..|.|++|+++. |...+..|++.++...+++|+.+.++
T Consensus       104 ~P~~~~~yihR~GR~gR~g~~g~~i~~~~~~-d~~~~~~i~~~~~~~~~~ip~~~~~l  160 (162)
T d1fuka_         104 LPANKENYIHRIGRGGRFGRKGVAINFVTNE-DVGAMRELEKFYSTQIEELPSDIATL  160 (162)
T ss_dssp             CCSSGGGGGGSSCSCC-----CEEEEEEETT-THHHHHHHHHHSSCCCEECCSCCTTT
T ss_pred             cchhHHHHHhhccccccCCCccEEEEEcCHH-HHHHHHHHHHHHcCcCCCCChHHHHh
Confidence            6999999999999999999999999999999 99999999999999999999877665
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure