Psyllid ID: psy7810

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48

MSEQKNGSSPGNMARKWNHLRKVLERPGPFCTSPSSEALSFLQTSCKVLIIGAGGLGCELLKDIALMGFNEIHVIDMDTIDLSNLNRQFLFRQKDIGSSKAEVAAKFINSRIPGVKVIPHFCKIQDYDSDFYQQFHIIVCGLDSIVARRWINGMLLSLLQYEEDGQVDQSTIIPMVDGGTEGFKGNARVILPGMTACIDCTLDLFPPQVTYPLCTIASTPRLPEHCIEYVKVTYPLCTIASTPRLPEHCDLPPRLPEHCIEYVKVIQWSKENPFDCPIDGDDPNHINWIYEKASERASQFNIVGVTYRLVQGVIKNIIPAVASTNAVIAATCATEVFKLATGCATSLNNYMVFNDVAGIYTYTYEAERKSNCLACGPANQPKYLDIESLDMKLSELIELLCQHPSYQMKSPGLTTMQDGRNRTLYMSTVRSIEEATRENLKRSLVELGLRDEGIVNVADSTTPNTLEITLRVTAKMAE

ccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHcccEEEEcccHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEcccccccHHHHccccEEEEccccHHHHHHHHHHHHHcccccccccccccccccEEEccccccccEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHcccccccccccEEEEEccccEEEEEccccHHHHHHHHcccccccccccccccEEEEEEcccccEEEEEEEEEEcccc

ccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEcccEEEccccccEEEcHHHccccHHHHHHHHHHHHccccEEEEcccccccccHHHHHHccEEEEccccHHHHHHHHHHHHHHHHHcccccccccccEEEEccccccccccEEEEEcccccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHccccccccccHcccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccccEEEEEEEcccccccccccccccEEEEEEccccccHHHHHHHHHcccccccccccEEEEccccccEEEEcccHHHHHHHHHHHcccHHHcccccccEEEEEccccccEEEEEEEEEccccc

mseqkngsspgnmaRKWNHLRKVlerpgpfctspsseaLSFLQTSCKVLIIGAGGLGCELLKDIALMGfneihvidmdtidlsnlnrqflfrqkdigsSKAEVAAKFInsripgvkviphfckiqdydsdfyQQFHIIVCGLDSIVARRWINGMLLSLLQyeedgqvdqstiipmvdggtegfkgnarVILPGMtacidctldlfppqvtyplctiastprlpehcIEYVKVtyplctiastprlpehcdlpprlpehCIEYVKVIQWskenpfdcpidgddpnhINWIYEKASERASQFNIVGVTYRLVQGVIKNIIPAVASTNAVIAATCATEVFKLATGCATSLNNYMVFNDVAGIYTYTYEAErksnclacgpanqpkyldiESLDMKLSELIELLcqhpsyqmkspglttmqdgrnrtLYMSTVRSIEEATRENLKRSLVELglrdegivnvadsttpntLEITLRVTAKMAE

mseqkngsspgnmaRKWNHLRKVLERPGPFCTSPSSEALSFLQTSCKVLIIGAGGLGCELLKDIALMGFNEIHVIDMDTIDLSNLNRQFLFRQKDIGSSKAEVAAKFinsripgvkviPHFCKIQDYDSDFYQQFHIIVCGLDSIVARRWINGMLLSLLQYEEDGQVDQSTIIPMVDGGTEGFKGNARVILPGMTACIDCTLDLFPPQVTYPLCTIASTPRLPEHCIEYVKVTYPLCTIASTPRLPEHCDLPPRLPEHCIEYVKVIQWSKENPFDCPIDGDDPNHINWIYEKASERASQFNIVGVTYRLVQGVIKNIIPAVASTNAVIAATCATEVFKLATGCATSLNNYMVFNDVAGIYTYTYEAERKSNCLACGPANQPKYLDIESLDMKLSELIELLCQHpsyqmkspglttmqdgrNRTLYMSTVRSIEEATRENLKRSLVelglrdegivnvadsttpntleiTLRVTAKMAE

**********************VL*****FC*****EALSFLQTSCKVLIIGAGGLGCELLKDIALMGFNEIHVIDMDTIDLSNLNRQFLFRQKDIGSSKAEVAAKFINSRIPGVKVIPHFCKIQDYDSDFYQQFHIIVCGLDSIVARRWINGMLLSLLQYEEDGQVDQSTIIPMVDGGTEGFKGNARVILPGMTACIDCTLDLFPPQVTYPLCTIASTPRLPEHCIEYVKVTYPLCTIASTPRLPEHCDLPPRLPEHCIEYVKVIQWSKENPFDCPIDGDDPNHINWIYEKASERASQFNIVGVTYRLVQGVIKNIIPAVASTNAVIAATCATEVFKLATGCATSLNNYMVFNDVAGIYTYTYEAERKSNCLACGPANQPKYLDIESLDMKLSELIELLCQHPSY*****************LYM***************RSLVELGLRDEGIVNVADSTT*NTLEITL********

**************RKWNHLRKVLERPGP**********SFLQTSCKVLIIGAGGLGCELLKDIALMGFNEIHVIDMDTIDLSNLNRQFLFRQKDIGSSKAEVAAKFINSRIPGVKVIPHFCKIQDYDSDFYQQFHIIVCGLDSIVARRWINGMLLSLLQYEEDGQVDQSTIIPMVDGGTEGFKGNARVILPGMTACIDCTLDLFPPQVTYPLCTIASTPRLPEHCIEYVKVTYPLCTIASTPRLPEHCDLPPRLPEHCIEYVKVIQWSKENPFDCPIDGDDPNHINWIYEKASERASQFNIVGVTYRLVQGVIKNIIPAVASTNAVIAATCATEVFKLATGCATSLNNYMVFNDVAGIYTYTYEAERKSNCLACGPANQPKYLDIESLDMKLSELIELLCQHPSYQMKSPGLTTMQDGRNRTLYMSTVRSIEEATRENLKRSLVELGLRDEGIVNVADSTTPNTLEITLRVTAK***

************MARKWNHLRKVLERPGPFCTSPSSEALSFLQTSCKVLIIGAGGLGCELLKDIALMGFNEIHVIDMDTIDLSNLNRQFLFRQKDIGSSKAEVAAKFINSRIPGVKVIPHFCKIQDYDSDFYQQFHIIVCGLDSIVARRWINGMLLSLLQYEEDGQVDQSTIIPMVDGGTEGFKGNARVILPGMTACIDCTLDLFPPQVTYPLCTIASTPRLPEHCIEYVKVTYPLCTIASTPRLPEHCDLPPRLPEHCIEYVKVIQWSKENPFDCPIDGDDPNHINWIYEKASERASQFNIVGVTYRLVQGVIKNIIPAVASTNAVIAATCATEVFKLATGCATSLNNYMVFNDVAGIYTYTYEAERKSNCLACGPANQPKYLDIESLDMKLSELIELLCQHPSYQMKSPGLTTMQDGRNRTLYMSTVRSIEEATRENLKRSLVELGLRDEGIVNVADSTTPNTLEITLRVTAKMAE

***********NMARKWNHLRKVLERPGPFCTSPSSEALSFLQTSCKVLIIGAGGLGCELLKDIALMGFNEIHVIDMDTIDLSNLNRQFLFRQKDIGSSKAEVAAKFINSRIPGVKVIPHFCKIQDYDSDFYQQFHIIVCGLDSIVARRWINGMLLSLLQYEEDGQVDQSTIIPMVDGGTEGFKGNARVILPGMTACIDCTLDLFPPQVTYPLCTIASTPRLPEHCIEYVKVTYPLCTIASTPRLPEHCDLPPRLPEHCIEYVKVIQWSKENPFDCPIDGDDPNHINWIYEKASERASQFNIVGVTYRLVQGVIKNIIPAVASTNAVIAATCATEVFKLATGCATSLNNYMVFNDVAGIYTYTYEAERKSNCLACGPANQPKYLDIESLDMKLSELIELLCQHPSYQMKSPGLTTMQDGRNRTLYMSTVRSIEEATRENLKRSLVELGLRDEGIVNVADSTTPNTLEITLRVTAK***

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		478	2.2.26 [Sep-21-2011]
Q9V6U8		450	NEDD8-activating enzyme E	yes	N/A	0.899	0.955	0.636	1e-170
Q5R4A0		463	NEDD8-activating enzyme E	yes	N/A	0.893	0.922	0.601	1e-161
Q8TBC4		463	NEDD8-activating enzyme E	yes	N/A	0.893	0.922	0.603	1e-161
Q99MI7		462	NEDD8-activating enzyme E	yes	N/A	0.891	0.922	0.602	1e-160
Q8C878		462	NEDD8-activating enzyme E	yes	N/A	0.891	0.922	0.602	1e-160
Q7ZVX6		462	NEDD8-activating enzyme E	yes	N/A	0.874	0.904	0.601	1e-159
Q54QG9		442	NEDD8-activating enzyme E	yes	N/A	0.874	0.945	0.470	1e-120
Q19360		430	NEDD8-activating enzyme E	yes	N/A	0.851	0.946	0.477	1e-112
O65041		454	NEDD8-activating enzyme E	yes	N/A	0.815	0.859	0.443	3e-99
Q09765		444	NEDD8-activating enzyme E	yes	N/A	0.851	0.916	0.395	6e-90

>sp\|Q9V6U8\|UBA3_DROME NEDD8-activating enzyme E1 catalytic subunit OS=Drosophila melanogaster GN=CG13343 PE=2 SV=1	Back alignment and function desciption

 Score =  598 bits (1543), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 299/470 (63%), Positives = 360/470 (76%), Gaps = 40/470 (8%)

Query: 14  ARKWNHLRKVLERPGPFCT---SPSSEALSFLQTSCKVLIIGAGGLGCELLKDIALMGFN 70
           ++++N LR +LER GPFC    + SSE L FLQT C+VLIIGAGGLGCELLKD+ALMGF 
Sbjct: 14  SKRFNGLRNILEREGPFCKDGFAASSENLEFLQTKCQVLIIGAGGLGCELLKDLALMGFG 73

Query: 71  EIHVIDMDTIDLSNLNRQFLFRQKDIGSSKAEVAAKFINSRIPGVKVIPHFCKIQDYDSD 130
            +HVIDMDTI+LSNLNRQFLFR+ DIG+SKAE AA+FIN+R+P  +V PHF KIQD+D  
Sbjct: 74  NLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARFINARVPTCRVTPHFKKIQDFDES 133

Query: 131 FYQQFHIIVCGLDSIVARRWINGMLLSLLQYEEDGQVDQSTIIPMVDGGTEGFKGNARVI 190
           FYQQFH++VCGLDSIVARRWINGMLLS+L+YEEDG +D S+I+PM+DGGTEGFKGNARVI
Sbjct: 134 FYQQFHLVVCGLDSIVARRWINGMLLSMLRYEEDGTIDTSSIVPMIDGGTEGFKGNARVI 193

Query: 191 LPGMTACIDCTLDLFPPQVTYPLCTIASTPRLPEHCIEYVKVTYPLCTIASTPRLPEHCD 250
           LPG TACI+CTLDLFPPQV YPL                       CTIA+TPRLPEH  
Sbjct: 194 LPGFTACIECTLDLFPPQVNYPL-----------------------CTIANTPRLPEH-- 228

Query: 251 LPPRLPEHCIEYVKVIQWSKENPFDCPIDGDDPNHINWIYEKASERASQFNIVGVTYRLV 310
                   CIEYVK+IQW K+NPF  P+DGDDP HI WIYE+A ER+++FNI GVTYRLV
Sbjct: 229 --------CIEYVKIIQWEKQNPFGVPLDGDDPQHIGWIYERALERSNEFNITGVTYRLV 280

Query: 311 QGVIKNIIPAVASTNAVIAATCATEVFKLATGCATSLNNYMVFNDVAGIYTYTYEAERKS 370
           QGV+K+IIPAVASTNA IAA CA EVFKLAT C  S+ NY+ FND+ GIYTYTYEAE+  
Sbjct: 281 QGVVKHIIPAVASTNAAIAAACALEVFKLATSCYDSMANYLNFNDLDGIYTYTYEAEKSE 340

Query: 371 NCLACGPANQPKYLDIESLD-MKLSELIELLCQHPSYQMKSPGLTT-MQDGRNRTLYMST 428
           NCLAC  +N P+ L IE  +   L ++I+LLC  P +Q+KSP LTT M+DG+ RTLYMS 
Sbjct: 341 NCLAC--SNTPQPLPIEDPNTTTLEDVIKLLCDSPRFQLKSPALTTVMKDGKRRTLYMSG 398

Query: 429 VRSIEEATRENLKRSLVELGLRDEGIVNVADSTTPNTLEITLRVTAKMAE 478
           V+SIEEATR+NL +SL ELGL D   + V D+T+P+ + + L+  +   E
Sbjct: 399 VKSIEEATRKNLTQSLGELGLHDGQQLTVTDATSPSAMTLQLKYQSNEVE 448

Catalytic subunit of the dimeric Uba3-Ula1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-Uba3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of Ubc12.
Drosophila melanogaster (taxid: 7227)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|Q5R4A0\|UBA3_PONAB NEDD8-activating enzyme E1 catalytic subunit OS=Pongo abelii GN=UBA3 PE=2 SV=2	Back alignment and function description

>sp\|Q8TBC4\|UBA3_HUMAN NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens GN=UBA3 PE=1 SV=2	Back alignment and function description

>sp\|Q99MI7\|UBA3_RAT NEDD8-activating enzyme E1 catalytic subunit OS=Rattus norvegicus GN=Uba3 PE=1 SV=1	Back alignment and function description

>sp\|Q8C878\|UBA3_MOUSE NEDD8-activating enzyme E1 catalytic subunit OS=Mus musculus GN=Uba3 PE=1 SV=2	Back alignment and function description

>sp\|Q7ZVX6\|UBA3_DANRE NEDD8-activating enzyme E1 catalytic subunit OS=Danio rerio GN=uba3 PE=2 SV=1	Back alignment and function description

>sp\|Q54QG9\|UBA3_DICDI NEDD8-activating enzyme E1 catalytic subunit OS=Dictyostelium discoideum GN=uba3 PE=1 SV=1	Back alignment and function description

>sp\|Q19360\|UBA3_CAEEL NEDD8-activating enzyme E1 catalytic subunit OS=Caenorhabditis elegans GN=uba-3 PE=2 SV=2	Back alignment and function description

>sp\|O65041\|UBA3_ARATH NEDD8-activating enzyme E1 catalytic subunit OS=Arabidopsis thaliana GN=ECR1 PE=1 SV=2	Back alignment and function description

>sp\|Q09765\|UBA3_SCHPO NEDD8-activating enzyme E1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba3 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		478
340712418		439	PREDICTED: NEDD8-activating enzyme E1 ca	0.893	0.972	0.673	0.0
380011030		439	PREDICTED: NEDD8-activating enzyme E1 ca	0.887	0.965	0.673	0.0
350399728		447	PREDICTED: NEDD8-activating enzyme E1 ca	0.893	0.955	0.673	0.0
307212334		438	NEDD8-activating enzyme E1 catalytic sub	0.880	0.961	0.676	1e-179
157132025		450	ubiquitin-activating enzyme E1c [Aedes a	0.924	0.982	0.640	1e-179
307172010		441	NEDD8-activating enzyme E1 catalytic sub	0.884	0.959	0.655	1e-178
31210023		449	AGAP005102-PA [Anopheles gambiae str. PE	0.912	0.971	0.643	1e-178
91093365		441	PREDICTED: similar to AGAP005102-PA [Tri	0.895	0.970	0.655	1e-177
312375526		636	hypothetical protein AND_14060 [Anophele	0.895	0.672	0.644	1e-176
242004947		445	NEDD8-activating enzyme E1 catalytic sub	0.912	0.979	0.632	1e-175

>gi\|340712418\|ref\|XP_003394757.1\| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit-like [Bombus terrestris]	Back alignment and taxonomy information

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/466 (67%), Positives = 368/466 (78%), Gaps = 39/466 (8%)

Query: 9   SPGNMARKWNHLRKVLERPGPFCT---SPSSEALSFLQTSCKVLIIGAGGLGCELLKDIA 65
            P +M R+W+ LRKVLER GPFC     PS E L FL  +CK+L+IGAGGLGCELLKD+ 
Sbjct: 2   GPDHMHRRWSSLRKVLERTGPFCRPDFEPSPETLQFLLDNCKILVIGAGGLGCELLKDLG 61

Query: 66  LMGFNEIHVIDMDTIDLSNLNRQFLFRQKDIGSSKAEVAAKFINSRIPGVKVIPHFCKIQ 125
           LMGF +IHV+DMDTI+LSNLNRQFLFR KDIGSSKAEVAAKF+NSRIPG  VI HFCKIQ
Sbjct: 62  LMGFRQIHVVDMDTIELSNLNRQFLFRHKDIGSSKAEVAAKFVNSRIPGCNVISHFCKIQ 121

Query: 126 DYDSDFYQQFHIIVCGLDSIVARRWINGMLLSLLQYEEDGQVDQSTIIPMVDGGTEGFKG 185
           D D++FY+QFHI++CGLDSIVARRWINGMLLSLL YE DG++D+ST+IPM+DGGTEGFKG
Sbjct: 122 DKDAEFYRQFHIVICGLDSIVARRWINGMLLSLLVYE-DGELDRSTVIPMIDGGTEGFKG 180

Query: 186 NARVILPGMTACIDCTLDLFPPQVTYPLCTIASTPRLPEHCIEYVKVTYPLCTIASTPRL 245
           NARVILPG++AC++CTLDL+PPQVTYPL                       CTIA+TPRL
Sbjct: 181 NARVILPGLSACVECTLDLYPPQVTYPL-----------------------CTIANTPRL 217

Query: 246 PEHCDLPPRLPEHCIEYVKVIQWSKENPFDCPIDGDDPNHINWIYEKASERASQFNIVGV 305
           PEH          CIEYVKVIQW KENPFDC IDGDDP HINWIYEK++ERA+QF I G+
Sbjct: 218 PEH----------CIEYVKVIQWPKENPFDCAIDGDDPQHINWIYEKSNERAAQFGIQGL 267

Query: 306 TYRLVQGVIKNIIPAVASTNAVIAATCATEVFKLATGCATSLNNYMVFNDVAGIYTYTYE 365
           TYRLVQGV+KNIIPAVASTNAVIAATCATE FKLA+ C+ SLNNYMV NDV GIYTYTYE
Sbjct: 268 TYRLVQGVVKNIIPAVASTNAVIAATCATEAFKLASSCSASLNNYMVLNDVDGIYTYTYE 327

Query: 366 AERKSNCLACGPANQPKYLDIESLDMKLSELIELLCQHPSYQMKSPGLTTMQDGRNRTLY 425
           AE+K +C+AC  +  PK ++I +   KL +LIE LC+ P  QMK+P LT   DG+N+TLY
Sbjct: 328 AEKKEDCVAC--SQIPKEIEINNPKFKLKDLIENLCERPDLQMKNPALTAYIDGKNKTLY 385

Query: 426 MSTVRSIEEATRENLKRSLVELGLRDEGIVNVADSTTPNTLEITLR 471
           M +V SIEE TRENL ++L+ELGLR    +NVAD TTPN + + L+
Sbjct: 386 MQSVTSIEERTRENLTKTLIELGLRHGSEINVADITTPNAIVLKLK 431

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|380011030\|ref\|XP_003689616.1\| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit-like [Apis florea]	Back alignment and taxonomy information

>gi\|350399728\|ref\|XP_003485620.1\| PREDICTED: NEDD8-activating enzyme E1 catalytic subunit-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|307212334\|gb\|EFN88138.1\| NEDD8-activating enzyme E1 catalytic subunit [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|157132025\|ref\|XP_001662412.1\| ubiquitin-activating enzyme E1c [Aedes aegypti] gi\|108871299\|gb\|EAT35524.1\| AAEL012306-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|307172010\|gb\|EFN63604.1\| NEDD8-activating enzyme E1 catalytic subunit [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|31210023\|ref\|XP_313978.1\| AGAP005102-PA [Anopheles gambiae str. PEST] gi\|21297280\|gb\|EAA09425.1\| AGAP005102-PA [Anopheles gambiae str. PEST]	Back alignment and taxonomy information

>gi\|91093365\|ref\|XP_969666.1\| PREDICTED: similar to AGAP005102-PA [Tribolium castaneum] gi\|270015296\|gb\|EFA11744.1\| hypothetical protein TcasGA2_TC004234 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|312375526\|gb\|EFR22884.1\| hypothetical protein AND_14060 [Anopheles darlingi]	Back alignment and taxonomy information

>gi\|242004947\|ref\|XP_002423337.1\| NEDD8-activating enzyme E1 catalytic subunit, putative [Pediculus humanus corporis] gi\|212506356\|gb\|EEB10599.1\| NEDD8-activating enzyme E1 catalytic subunit, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		478
FB\|FBgn0263697		450	Uba3 "Ubiquitin activating enz	0.468	0.497	0.746	3.7e-172
UNIPROTKB\|Q0P5I7		463	UBA3 "Ubiquitin-like modifier	0.462	0.477	0.711	4.2e-160
UNIPROTKB\|E2QZL9		449	UBA3 "Uncharacterized protein"	0.462	0.492	0.706	1.1e-159
UNIPROTKB\|E2R4G8		463	UBA3 "Uncharacterized protein"	0.462	0.477	0.706	1.1e-159
UNIPROTKB\|F6Y460		472	UBA3 "Uncharacterized protein"	0.462	0.468	0.706	1.1e-159
UNIPROTKB\|Q8TBC4		463	UBA3 "NEDD8-activating enzyme	0.462	0.477	0.711	2.9e-159
MGI\|MGI:1341217		462	Uba3 "ubiquitin-like modifier	0.462	0.478	0.706	4.7e-159
RGD\|621084		462	Uba3 "ubiquitin-like modifier	0.462	0.478	0.706	4.7e-159
UNIPROTKB\|Q99MI7		462	Uba3 "NEDD8-activating enzyme	0.462	0.478	0.706	4.7e-159
UNIPROTKB\|E1BT61		463	UBA3 "Uncharacterized protein"	0.468	0.483	0.694	2e-158

FB\|FBgn0263697 Uba3 "Ubiquitin activating enzyme 3" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 931 (332.8 bits), Expect = 3.7e-172, Sum P(2) = 3.7e-172
 Identities = 171/229 (74%), Positives = 201/229 (87%)

Query:     9 SPGNM--ARKWNHLRKVLERPGPFCT---SPSSEALSFLQTSCKVLIIGAGGLGCELLKD 63
             +PG +  ++++N LR +LER GPFC    + SSE L FLQT C+VLIIGAGGLGCELLKD
Sbjct:     7 NPGLILQSKRFNGLRNILEREGPFCKDGFAASSENLEFLQTKCQVLIIGAGGLGCELLKD 66

Query:    64 IALMGFNEIHVIDMDTIDLSNLNRQFLFRQKDIGSSKAEVAAKFINSRIPGVKVIPHFCK 123
             +ALMGF  +HVIDMDTI+LSNLNRQFLFR+ DIG+SKAE AA+FIN+R+P  +V PHF K
Sbjct:    67 LALMGFGNLHVIDMDTIELSNLNRQFLFRRTDIGASKAECAARFINARVPTCRVTPHFKK 126

Query:   124 IQDYDSDFYQQFHIIVCGLDSIVARRWINGMLLSLLQYEEDGQVDQSTIIPMVDGGTEGF 183
             IQD+D  FYQQFH++VCGLDSIVARRWINGMLLS+L+YEEDG +D S+I+PM+DGGTEGF
Sbjct:   127 IQDFDESFYQQFHLVVCGLDSIVARRWINGMLLSMLRYEEDGTIDTSSIVPMIDGGTEGF 186

Query:   184 KGNARVILPGMTACIDCTLDLFPPQVTYPLCTIASTPRLPEHCIEYVKV 232
             KGNARVILPG TACI+CTLDLFPPQV YPLCTIA+TPRLPEHCIEYVK+
Sbjct:   187 KGNARVILPGFTACIECTLDLFPPQVNYPLCTIANTPRLPEHCIEYVKI 235

GO:0005524 "ATP binding" evidence=IEA

GO:0016881 "acid-amino acid ligase activity" evidence=IEA

GO:0045116 "protein neddylation" evidence=IDA

GO:0043234 "protein complex" evidence=IPI

GO:0045879 "negative regulation of smoothened signaling pathway" evidence=IMP

GO:0019781 "NEDD8 activating enzyme activity" evidence=IDA

UNIPROTKB\|Q0P5I7 UBA3 "Ubiquitin-like modifier activating enzyme 3" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QZL9 UBA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R4G8 UBA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F6Y460 UBA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8TBC4 UBA3 "NEDD8-activating enzyme E1 catalytic subunit" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1341217 Uba3 "ubiquitin-like modifier activating enzyme 3" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|621084 Uba3 "ubiquitin-like modifier activating enzyme 3" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q99MI7 Uba3 "NEDD8-activating enzyme E1 catalytic subunit" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BT61 UBA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q99MI7	UBA3_RAT	6, ., 3, ., 2, ., -	0.6025	0.8912	0.9220	yes	N/A
Q5R4A0	UBA3_PONAB	6, ., 3, ., 2, ., -	0.6012	0.8933	0.9222	yes	N/A
Q19360	UBA3_CAEEL	6, ., 3, ., 2, ., -	0.4775	0.8514	0.9465	yes	N/A
Q9V6U8	UBA3_DROME	6, ., 3, ., 2, ., -	0.6361	0.8995	0.9555	yes	N/A
Q09765	UBA3_SCHPO	6, ., 3, ., 2, ., -	0.3952	0.8514	0.9166	yes	N/A
Q99344	UBA3_YEAST	6, ., 3, ., 2, ., -	0.3746	0.6066	0.9698	yes	N/A
Q8TBC4	UBA3_HUMAN	6, ., 3, ., 2, ., -	0.6034	0.8933	0.9222	yes	N/A
O65041	UBA3_ARATH	6, ., 3, ., 2, ., -	0.4436	0.8158	0.8590	yes	N/A
Q7ZVX6	UBA3_DANRE	6, ., 3, ., 2, ., -	0.6017	0.8744	0.9047	yes	N/A
Q54QG9	UBA3_DICDI	6, ., 3, ., 2, ., -	0.4709	0.8744	0.9457	yes	N/A
Q8C878	UBA3_MOUSE	6, ., 3, ., 2, ., -	0.6025	0.8912	0.9220	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	6.3.2	0.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		478
cd01488		291	cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1	0.0
cd01484		234	cd01484, E1-2_like, Ubiquitin activating enzyme (E	1e-110
cd01489		312	cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E	8e-74
cd01483		143	cd01483, E1_enzyme_family, Superfamily of activati	2e-43
cd01490		435	cd01490, Ube1_repeat2, Ubiquitin activating enzyme	2e-42
COG0476		254	COG0476, ThiF, Dinucleotide-utilizing enzymes invo	2e-41
pfam00899		134	pfam00899, ThiF, ThiF family	3e-38
TIGR01408		1008	TIGR01408, Ube1, ubiquitin-activating enzyme E1	3e-31
cd00757		228	cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA	5e-31
pfam02134		66	pfam02134, UBACT, Repeat in ubiquitin-activating (	9e-24
pfam08825		85	pfam08825, E2_bind, E2 binding domain	2e-21
TIGR02356		202	TIGR02356, adenyl_thiF, thiazole biosynthesis aden	1e-19
PRK05600		370	PRK05600, PRK05600, thiamine biosynthesis protein	2e-15
PRK05690		245	PRK05690, PRK05690, molybdopterin biosynthesis pro	2e-15
PRK07878		392	PRK07878, PRK07878, molybdopterin biosynthesis-lik	5e-15
PRK08762		376	PRK08762, PRK08762, molybdopterin biosynthesis pro	6e-15
cd01492		197	cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E	4e-14
cd01485		198	cd01485, E1-1_like, Ubiquitin activating enzyme (E	2e-13
TIGR02355		240	TIGR02355, moeB, molybdopterin synthase sulfurylas	3e-12
PRK08644		212	PRK08644, PRK08644, thiamine biosynthesis protein	5e-12
COG1179		263	COG1179, COG1179, Dinucleotide-utilizing enzymes i	6e-12
cd01487		174	cd01487, E1_ThiF_like, E1_ThiF_like	2e-11
pfam10585		44	pfam10585, UBA_e1_thiolCys, Ubiquitin-activating e	2e-11
cd00755		231	cd00755, YgdL_like, Family of activating enzymes (	3e-11
PRK08328		231	PRK08328, PRK08328, hypothetical protein; Provisio	3e-11
cd01491		286	cd01491, Ube1_repeat1, Ubiquitin activating enzyme	6e-11
PRK05597		355	PRK05597, PRK05597, molybdopterin biosynthesis pro	9e-11
PRK12475		338	PRK12475, PRK12475, thiamine/molybdopterin biosynt	2e-10
PRK07688		339	PRK07688, PRK07688, thiamine/molybdopterin biosynt	4e-08
PRK07411		390	PRK07411, PRK07411, hypothetical protein; Validate	1e-07
TIGR03736		244	TIGR03736, PRTRC_ThiF, PRTRC system ThiF family pr	2e-07
cd01493		425	cd01493, APPBP1_RUB, Ubiquitin activating enzyme (	1e-06
cd01486		307	cd01486, Apg7, Apg7 is an E1-like protein, that ac	2e-06
TIGR02354		200	TIGR02354, thiF_fam2, thiamine biosynthesis protei	2e-06
PRK08223		287	PRK08223, PRK08223, hypothetical protein; Validate	5e-06
TIGR01408		1008	TIGR01408, Ube1, ubiquitin-activating enzyme E1	1e-05
PRK15116		268	PRK15116, PRK15116, sulfur acceptor protein CsdL;	3e-05
TIGR01381		664	TIGR01381, E1_like_apg7, E1-like protein-activatin	8e-05
cd05237		287	cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-l	6e-04
PRK14851		679	PRK14851, PRK14851, hypothetical protein; Provisio	0.004

>gnl\|CDD\|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3	Back alignment and domain information

 Score =  543 bits (1400), Expect = 0.0
 Identities = 211/330 (63%), Positives = 247/330 (74%), Gaps = 39/330 (11%)

Query: 47  KVLIIGAGGLGCELLKDIALMGFNEIHVIDMDTIDLSNLNRQFLFRQKDIGSSKAEVAAK 106
           K+L+IGAGGLGCELLK++AL GF  IHVIDMDTID+SNLNRQFLFR+KDIG  KAEVAAK
Sbjct: 1   KILVIGAGGLGCELLKNLALSGFRNIHVIDMDTIDVSNLNRQFLFREKDIGKPKAEVAAK 60

Query: 107 FINSRIPGVKVIPHFCKIQDYDSDFYQQFHIIVCGLDSIVARRWINGMLLSLLQYEEDGQ 166
           F+N R+PGV V PHF KIQD D +FY+QF+II+CGLDSI ARRWING L+SLL YE    
Sbjct: 61  FVNDRVPGVNVTPHFGKIQDKDEEFYRQFNIIICGLDSIEARRWINGTLVSLLLYE---- 116

Query: 167 VDQSTIIPMVDGGTEGFKGNARVILPGMTACIDCTLDLFPPQVTYPLCTIASTPRLPEHC 226
            D  +IIP++DGGTEGFKG+ARVILPG+TACI+C+LDLFPPQVT+PLCTIA+T       
Sbjct: 117 -DPESIIPLIDGGTEGFKGHARVILPGITACIECSLDLFPPQVTFPLCTIANT------- 168

Query: 227 IEYVKVTYPLCTIASTPRLPEHCDLPPRLPEHCIEYVKVIQWSKENPFDCPIDGDDPNHI 286
                                     PRLPEHCIEY  +IQW KE PF  P+DGDDP HI
Sbjct: 169 --------------------------PRLPEHCIEYASLIQWPKEFPFV-PLDGDDPEHI 201

Query: 287 NWIYEKASERASQFNIVGVTYRLVQGVIKNIIPAVASTNAVIAATCATEVFKLATGCATS 346
            W+Y+KA ERA+QFNI GVTY L QGV+K IIPAVASTNA+IAA C  E  K+AT C  +
Sbjct: 202 EWLYQKALERAAQFNISGVTYSLTQGVVKRIIPAVASTNAIIAAACCLEALKIATDCYEN 261

Query: 347 LNNYMVFNDVAGIYTYTYEAERKSNCLACG 376
           LNNY+++N V G YTYT+E ERK +C  C 
Sbjct: 262 LNNYLMYNGVDGCYTYTFEHERKEDCPVCS 291

UBA3 is part of the heterodimeric activating enzyme (E1), specific for the Rub family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins. consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin(-like) by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by Rub family of ubiquitin-like proteins (Ublps) activates SCF ubiquitin ligases and is involved in cell cycle control, signaling and embryogenesis. UBA3 contains both the nucleotide-binding motif involved in adenylation and the catalytic cysteine involved in the thioester intermediate and Ublp transfer to E2. Length = 291

>gnl\|CDD\|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like	Back alignment and domain information

>gnl\|CDD\|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2	Back alignment and domain information

>gnl\|CDD\|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>gnl\|CDD\|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2	Back alignment and domain information

>gnl\|CDD\|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|216180 pfam00899, ThiF, ThiF family	Back alignment and domain information

>gnl\|CDD\|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1	Back alignment and domain information

>gnl\|CDD\|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA	Back alignment and domain information

>gnl\|CDD\|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein	Back alignment and domain information

>gnl\|CDD\|192164 pfam08825, E2_bind, E2 binding domain	Back alignment and domain information

>gnl\|CDD\|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>gnl\|CDD\|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated	Back alignment and domain information

>gnl\|CDD\|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>gnl\|CDD\|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated	Back alignment and domain information

>gnl\|CDD\|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>gnl\|CDD\|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1	Back alignment and domain information

>gnl\|CDD\|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like	Back alignment and domain information

>gnl\|CDD\|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>gnl\|CDD\|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>gnl\|CDD\|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|238764 cd01487, E1_ThiF_like, E1_ThiF_like	Back alignment and domain information

>gnl\|CDD\|192635 pfam10585, UBA_e1_thiolCys, Ubiquitin-activating enzyme active site	Back alignment and domain information

>gnl\|CDD\|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E	Back alignment and domain information

>gnl\|CDD\|169382 PRK08328, PRK08328, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1	Back alignment and domain information

>gnl\|CDD\|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>gnl\|CDD\|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>gnl\|CDD\|180967 PRK07411, PRK07411, hypothetical protein; Validated	Back alignment and domain information

>gnl\|CDD\|163448 TIGR03736, PRTRC_ThiF, PRTRC system ThiF family protein	Back alignment and domain information

>gnl\|CDD\|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1	Back alignment and domain information

>gnl\|CDD\|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively	Back alignment and domain information

>gnl\|CDD\|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>gnl\|CDD\|181302 PRK08223, PRK08223, hypothetical protein; Validated	Back alignment and domain information

>gnl\|CDD\|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1	Back alignment and domain information

>gnl\|CDD\|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>gnl\|CDD\|233388 TIGR01381, E1_like_apg7, E1-like protein-activating enzyme Gsa7p/Apg7p	Back alignment and domain information

>gnl\|CDD\|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked N-acetylglucosamine) inverting 4,6-dehydratase, extended (e) SDRs	Back alignment and domain information

>gnl\|CDD\|184853 PRK14851, PRK14851, hypothetical protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		478
KOG2015\|consensus		422		100.0
KOG2013\|consensus		603		100.0
cd01488		291	Uba3_RUB Ubiquitin activating enzyme (E1) subunit	100.0
cd01490		435	Ube1_repeat2 Ubiquitin activating enzyme (E1), rep	100.0
TIGR01408		1008	Ube1 ubiquitin-activating enzyme E1. This model re	100.0
cd01489		312	Uba2_SUMO Ubiquitin activating enzyme (E1) subunit	100.0
KOG2012\|consensus		1013		100.0
cd01484		234	E1-2_like Ubiquitin activating enzyme (E1), repeat	100.0
TIGR02355		240	moeB molybdopterin synthase sulfurylase MoeB. This	100.0
PRK07411		390	hypothetical protein; Validated	100.0
PRK05690		245	molybdopterin biosynthesis protein MoeB; Provision	100.0
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	100.0
PRK05600		370	thiamine biosynthesis protein ThiF; Validated	100.0
PRK05597		355	molybdopterin biosynthesis protein MoeB; Validated	100.0
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	100.0
PRK07878		392	molybdopterin biosynthesis-like protein MoeZ; Vali	100.0
PRK08223		287	hypothetical protein; Validated	100.0
cd01491		286	Ube1_repeat1 Ubiquitin activating enzyme (E1), rep	100.0
PRK08328		231	hypothetical protein; Provisional	100.0
cd00757		228	ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1	100.0
PRK08762		376	molybdopterin biosynthesis protein MoeB; Validated	100.0
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	100.0
cd01492		197	Aos1_SUMO Ubiquitin activating enzyme (E1) subunit	100.0
KOG2014\|consensus		331		100.0
TIGR01408		1008	Ube1 ubiquitin-activating enzyme E1. This model re	100.0
COG0476		254	ThiF Dinucleotide-utilizing enzymes involved in mo	100.0
KOG2017\|consensus		427		100.0
cd01485		198	E1-1_like Ubiquitin activating enzyme (E1), repeat	100.0
cd01493		425	APPBP1_RUB Ubiquitin activating enzyme (E1) subuni	100.0
TIGR03603		318	cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy	100.0
KOG2012\|consensus		1013		100.0
PRK14852		989	hypothetical protein; Provisional	100.0
PRK14851		679	hypothetical protein; Provisional	100.0
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	100.0
TIGR01381		664	E1_like_apg7 E1-like protein-activating enzyme Gsa	100.0
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	99.97
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	99.97
PRK07877		722	hypothetical protein; Provisional	99.97
PRK15116		268	sulfur acceptor protein CsdL; Provisional	99.97
TIGR03736		244	PRTRC_ThiF PRTRC system ThiF family protein. A nov	99.97
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	99.97
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	99.96
cd01486		307	Apg7 Apg7 is an E1-like protein, that activates tw	99.96
cd00755		231	YgdL_like Family of activating enzymes (E1) of ubi	99.96
PTZ00245		287	ubiquitin activating enzyme; Provisional	99.95
KOG2336\|consensus		422		99.95
KOG2016\|consensus		523		99.95
COG1179		263	Dinucleotide-utilizing enzymes involved in molybdo	99.94
PRK06153		393	hypothetical protein; Provisional	99.94
TIGR03693		637	ocin_ThiF_like putative thiazole-containing bacter	99.84
KOG2018\|consensus		430		99.81
PF02134		67	UBACT: Repeat in ubiquitin-activating (UBA) protei	99.71
PF08825		84	E2_bind: E2 binding domain; InterPro: IPR014929 E1	99.66
KOG2337\|consensus		669		99.57
PF14732		87	UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquiti	99.43
PF10585		45	UBA_e1_thiolCys: Ubiquitin-activating enzyme activ	99.18
PF05237		84	MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T	98.98
TIGR03882		193	cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr	98.16
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	97.99
PRK12549		284	shikimate 5-dehydrogenase; Reviewed	97.98
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	97.91
COG4015		217	Predicted dinucleotide-utilizing enzyme of the Thi	97.75
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	97.4
PRK12548		289	shikimate 5-dehydrogenase; Provisional	97.33
PF09358		125	UBA_e1_C: Ubiquitin-activating enzyme e1 C-termina	97.25
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	97.24
PRK14027		283	quinate/shikimate dehydrogenase; Provisional	97.21
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	97.21
TIGR01809		282	Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO	97.06
PRK06719		157	precorrin-2 dehydrogenase; Validated	97.06
PRK12749		288	quinate/shikimate dehydrogenase; Reviewed	96.98
PF03435		386	Saccharop_dh: Saccharopine dehydrogenase ; InterPr	96.95
COG0373		414	HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	96.89
PRK00258		278	aroE shikimate 5-dehydrogenase; Reviewed	96.88
COG1086		588	Predicted nucleoside-diphosphate sugar epimerases	96.85
COG0169		283	AroE Shikimate 5-dehydrogenase [Amino acid transpo	96.77
PRK13940		414	glutamyl-tRNA reductase; Provisional	96.75
PRK05562		223	precorrin-2 dehydrogenase; Provisional	96.65
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	96.41
cd01080		168	NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of	96.35
cd01065		155	NAD_bind_Shikimate_DH NAD(P) binding domain of Shi	96.22
PRK04148		134	hypothetical protein; Provisional	96.11
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	96.03
cd05291		306	HicDH_like L-2-hydroxyisocapronate dehydrogenases	96.0
KOG4169\|consensus		261		95.99
PF00056		141	Ldh_1_N: lactate/malate dehydrogenase, NAD binding	95.96
cd05311		226	NAD_bind_2_malic_enz NAD(P) binding domain of mali	95.92
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.91
PRK12550		272	shikimate 5-dehydrogenase; Reviewed	95.87
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	95.81
PTZ00082		321	L-lactate dehydrogenase; Provisional	95.74
cd05213		311	NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain	95.72
PLN00203		519	glutamyl-tRNA reductase	95.71
PRK00066		315	ldh L-lactate dehydrogenase; Reviewed	95.69
COG0569		225	TrkA K+ transport systems, NAD-binding component [	95.68
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	95.47
COG1648		210	CysG Siroheme synthase (precorrin-2 oxidase/ferroc	95.41
cd05290		307	LDH_3 A subgroup of L-lactate dehydrogenases. L-la	95.4
PRK00045		423	hemA glutamyl-tRNA reductase; Reviewed	95.37
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	95.36
TIGR00507		270	aroE shikimate 5-dehydrogenase. This model finds p	95.23
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	95.22
PRK06197		306	short chain dehydrogenase; Provisional	95.2
PRK05854		313	short chain dehydrogenase; Provisional	95.16
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	95.14
PF01118		121	Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi	95.13
KOG0069\|consensus		336		95.13
PRK15469		312	ghrA bifunctional glyoxylate/hydroxypyruvate reduc	95.01
PRK12480		330	D-lactate dehydrogenase; Provisional	95.0
PRK14192		283	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.94
PLN02819		1042	lysine-ketoglutarate reductase/saccharopine dehydr	94.9
PF01113		124	DapB_N: Dihydrodipicolinate reductase, N-terminus;	94.87
cd05191		86	NAD_bind_amino_acid_DH NAD(P) binding domain of am	94.73
PF11543		80	UN_NPL4: Nuclear pore localisation protein NPL4; I	94.72
PRK07062		265	short chain dehydrogenase; Provisional	94.7
PRK10637		457	cysG siroheme synthase; Provisional	94.67
PRK06141		314	ornithine cyclodeaminase; Validated	94.64
PRK07063		260	short chain dehydrogenase; Provisional	94.62
PRK13243		333	glyoxylate reductase; Reviewed	94.56
PF02719		293	Polysacc_synt_2: Polysaccharide biosynthesis prote	94.52
PLN02602		350	lactate dehydrogenase	94.49
PRK09242		257	tropinone reductase; Provisional	94.48
PRK14619		308	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	94.44
PRK05866		293	short chain dehydrogenase; Provisional	94.42
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	94.4
cd05293		312	LDH_1 A subgroup of L-lactate dehydrogenases. L-la	94.37
TIGR02992		326	ectoine_eutC ectoine utilization protein EutC. Mem	94.33
PRK08251		248	short chain dehydrogenase; Provisional	94.29
PRK07502		307	cyclohexadienyl dehydrogenase; Validated	94.27
PRK12826		251	3-ketoacyl-(acyl-carrier-protein) reductase; Revie	94.23
PRK07340		304	ornithine cyclodeaminase; Validated	94.2
PRK07831		262	short chain dehydrogenase; Provisional	94.19
PLN02928		347	oxidoreductase family protein	94.1
PRK08618		325	ornithine cyclodeaminase; Validated	94.1
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.09
PRK07523		255	gluconate 5-dehydrogenase; Provisional	93.96
PF03807		96	F420_oxidored: NADP oxidoreductase coenzyme F420-d	93.91
PRK06436		303	glycerate dehydrogenase; Provisional	93.86
PRK09599		301	6-phosphogluconate dehydrogenase-like protein; Rev	93.81
PRK09186		256	flagellin modification protein A; Provisional	93.71
PRK00094		325	gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr	93.7
TIGR03589		324	PseB UDP-N-acetylglucosamine 4,6-dehydratase. This	93.7
PRK07574		385	formate dehydrogenase; Provisional	93.67
PRK05875		276	short chain dehydrogenase; Provisional	93.63
PRK00048		257	dihydrodipicolinate reductase; Provisional	93.61
PRK08339		263	short chain dehydrogenase; Provisional	93.54
cd00300		300	LDH_like L-lactate dehydrogenase-like enzymes. Mem	93.53
PRK07634		245	pyrroline-5-carboxylate reductase; Reviewed	93.52
PRK05867		253	short chain dehydrogenase; Provisional	93.51
COG1893		307	ApbA Ketopantoate reductase [Coenzyme metabolism]	93.41
PRK08291		330	ectoine utilization protein EutC; Validated	93.36
COG0240		329	GpsA Glycerol-3-phosphate dehydrogenase [Energy pr	93.36
PRK06223		307	malate dehydrogenase; Reviewed	93.35
COG1052		324	LdhA Lactate dehydrogenase and related dehydrogena	93.34
PRK07680		273	late competence protein ComER; Validated	93.3
PRK07417		279	arogenate dehydrogenase; Reviewed	93.16
PRK06194		287	hypothetical protein; Provisional	93.11
PTZ00117		319	malate dehydrogenase; Provisional	93.08
TIGR01035		417	hemA glutamyl-tRNA reductase. This enzyme, togethe	93.06
PTZ00142		470	6-phosphogluconate dehydrogenase; Provisional	93.04
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	93.03
PRK07576		264	short chain dehydrogenase; Provisional	93.01
cd05292		308	LDH_2 A subgroup of L-lactate dehydrogenases. L-la	92.96
PF02826		178	2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy	92.93
PF00106		167	adh_short: short chain dehydrogenase alcohol dehyd	92.9
PRK10537		393	voltage-gated potassium channel; Provisional	92.87
PRK11559		296	garR tartronate semialdehyde reductase; Provisiona	92.83
PRK11199		374	tyrA bifunctional chorismate mutase/prephenate deh	92.76
TIGR01850		346	argC N-acetyl-gamma-glutamyl-phosphate reductase,	92.75
PTZ00345		365	glycerol-3-phosphate dehydrogenase; Provisional	92.73
PLN03139		386	formate dehydrogenase; Provisional	92.71
PLN02780		320	ketoreductase/ oxidoreductase	92.69
PRK14982		340	acyl-ACP reductase; Provisional	92.69
PRK06181		263	short chain dehydrogenase; Provisional	92.67
COG1063		350	Tdh Threonine dehydrogenase and related Zn-depende	92.59
PRK06928		277	pyrroline-5-carboxylate reductase; Reviewed	92.57
PRK12439		341	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	92.46
PRK08217		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	92.45
cd01339		300	LDH-like_MDH L-lactate dehydrogenase-like malate d	92.44
COG0300		265	DltE Short-chain dehydrogenases of various substra	92.43
PRK13304		265	L-aspartate dehydrogenase; Reviewed	92.37
PRK06940		275	short chain dehydrogenase; Provisional	92.35
PRK14620		326	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	92.3
PRK12384		259	sorbitol-6-phosphate dehydrogenase; Provisional	92.25
PRK06932		314	glycerate dehydrogenase; Provisional	92.2
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	92.19
PRK05565		247	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	92.13
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	92.09
PLN03209		576	translocon at the inner envelope of chloroplast su	92.06
PRK09496		453	trkA potassium transporter peripheral membrane com	92.06
PRK07453		322	protochlorophyllide oxidoreductase; Validated	92.03
cd05211		217	NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of	92.01
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	92.01
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	91.99
PRK00676		338	hemA glutamyl-tRNA reductase; Validated	91.98
PRK14175		286	bifunctional 5,10-methylene-tetrahydrofolate dehyd	91.97
PLN02350		493	phosphogluconate dehydrogenase (decarboxylating)	91.9
PF03949		255	Malic_M: Malic enzyme, NAD binding domain; InterPr	91.89
PRK11880		267	pyrroline-5-carboxylate reductase; Reviewed	91.88
COG1250		307	FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo	91.87
PRK13394		262	3-hydroxybutyrate dehydrogenase; Provisional	91.86
PRK05872		296	short chain dehydrogenase; Provisional	91.86
PRK07814		263	short chain dehydrogenase; Provisional	91.85
PRK07478		254	short chain dehydrogenase; Provisional	91.84
PRK07679		279	pyrroline-5-carboxylate reductase; Reviewed	91.82
PRK15409		323	bifunctional glyoxylate/hydroxypyruvate reductase	91.8
TIGR03376		342	glycerol3P_DH glycerol-3-phosphate dehydrogenase (	91.76
TIGR00873		467	gnd 6-phosphogluconate dehydrogenase, decarboxylat	91.76
TIGR00872		298	gnd_rel 6-phosphogluconate dehydrogenase (decarbox	91.74
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	91.73
PRK11790		409	D-3-phosphoglycerate dehydrogenase; Provisional	91.72
PRK12490		299	6-phosphogluconate dehydrogenase-like protein; Rev	91.7
PRK03562		621	glutathione-regulated potassium-efflux system prot	91.69
PLN02253		280	xanthoxin dehydrogenase	91.66
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	91.6
PRK08655		437	prephenate dehydrogenase; Provisional	91.6
PLN02427		386	UDP-apiose/xylose synthase	91.58
PRK06138		252	short chain dehydrogenase; Provisional	91.57
PRK06523		260	short chain dehydrogenase; Provisional	91.49
PRK07326		237	short chain dehydrogenase; Provisional	91.44
TIGR03026		411	NDP-sugDHase nucleotide sugar dehydrogenase. All o	91.42
cd00762		254	NAD_bind_malic_enz NAD(P) binding domain of malic	91.41
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	91.39
PRK06196		315	oxidoreductase; Provisional	91.32
PRK07666		239	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	91.24
COG0111		324	SerA Phosphoglycerate dehydrogenase and related de	91.19
cd05312		279	NAD_bind_1_malic_enz NAD(P) binding domain of mali	91.15
TIGR01202		308	bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl	91.15
PRK06172		253	short chain dehydrogenase; Provisional	91.13
PRK07024		257	short chain dehydrogenase; Provisional	91.1
PLN02688		266	pyrroline-5-carboxylate reductase	91.09
PRK06125		259	short chain dehydrogenase; Provisional	91.05
TIGR01757		387	Malate-DH_plant malate dehydrogenase, NADP-depende	90.99
PRK13403		335	ketol-acid reductoisomerase; Provisional	90.98
PRK08818		370	prephenate dehydrogenase; Provisional	90.94
PRK15461		296	NADH-dependent gamma-hydroxybutyrate dehydrogenase	90.94
PRK12939		250	short chain dehydrogenase; Provisional	90.83
PRK12829		264	short chain dehydrogenase; Provisional	90.8
PRK06567		1028	putative bifunctional glutamate synthase subunit b	90.79
PRK12491		272	pyrroline-5-carboxylate reductase; Reviewed	90.78
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	90.77
cd01076		227	NAD_bind_1_Glu_DH NAD(P) binding domain of glutama	90.71
PRK13302		271	putative L-aspartate dehydrogenase; Provisional	90.7
PRK06949		258	short chain dehydrogenase; Provisional	90.64
PRK03659		601	glutathione-regulated potassium-efflux system prot	90.61
PRK07067		257	sorbitol dehydrogenase; Provisional	90.56
PRK08374		336	homoserine dehydrogenase; Provisional	90.55
TIGR01505		291	tartro_sem_red 2-hydroxy-3-oxopropionate reductase	90.49
PRK09880		343	L-idonate 5-dehydrogenase; Provisional	90.42
PRK07792		306	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	90.4
PLN02520		529	bifunctional 3-dehydroquinate dehydratase/shikimat	90.38
PRK01710		458	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	90.38
cd00650		263	LDH_MDH_like NAD-dependent, lactate dehydrogenase-	90.38
PRK07109		334	short chain dehydrogenase; Provisional	90.36
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	90.36
TIGR01915		219	npdG NADPH-dependent F420 reductase. This model re	90.35
PRK05876		275	short chain dehydrogenase; Provisional	90.33
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	90.31
PRK11908		347	NAD-dependent epimerase/dehydratase family protein	90.28
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	90.27
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	90.25
PRK12779		944	putative bifunctional glutamate synthase subunit b	90.23
PRK07074		257	short chain dehydrogenase; Provisional	90.22
PLN02240		352	UDP-glucose 4-epimerase	90.18
PLN02989		325	cinnamyl-alcohol dehydrogenase family protein	90.1
PRK06728		347	aspartate-semialdehyde dehydrogenase; Provisional	90.1
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	90.08
PRK08306		296	dipicolinate synthase subunit A; Reviewed	90.07
PRK06476		258	pyrroline-5-carboxylate reductase; Reviewed	90.04
PTZ00431		260	pyrroline carboxylate reductase; Provisional	90.03
PRK02705		459	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	90.03
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	89.98
PRK06249		313	2-dehydropantoate 2-reductase; Provisional	89.97
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	89.96
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	89.86
PF14560		87	Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K	89.84
COG0039		313	Mdh Malate/lactate dehydrogenases [Energy producti	89.84
PRK06124		256	gluconate 5-dehydrogenase; Provisional	89.81
PRK05653		246	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	89.8
PRK05476		425	S-adenosyl-L-homocysteine hydrolase; Provisional	89.78
PLN02383		344	aspartate semialdehyde dehydrogenase	89.73
PRK09496		453	trkA potassium transporter peripheral membrane com	89.72
PRK06139		330	short chain dehydrogenase; Provisional	89.68
cd08230		355	glucose_DH Glucose dehydrogenase. Glucose dehydrog	89.68
PRK08278		273	short chain dehydrogenase; Provisional	89.67
PRK05671		336	aspartate-semialdehyde dehydrogenase; Reviewed	89.66
PRK09072		263	short chain dehydrogenase; Provisional	89.65
PRK04308		445	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	89.64
PLN02852		491	ferredoxin-NADP+ reductase	89.63
PRK00436		343	argC N-acetyl-gamma-glutamyl-phosphate reductase;	89.6
PRK06057		255	short chain dehydrogenase; Provisional	89.58
PRK05335		436	tRNA (uracil-5-)-methyltransferase Gid; Reviewed	89.58
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	89.5
PRK05855		582	short chain dehydrogenase; Validated	89.42
PRK06114		254	short chain dehydrogenase; Provisional	89.38
PRK08265		261	short chain dehydrogenase; Provisional	89.35
PRK07806		248	short chain dehydrogenase; Provisional	89.34
TIGR01296		339	asd_B aspartate-semialdehyde dehydrogenase (peptid	89.32
PRK11730		715	fadB multifunctional fatty acid oxidation complex	89.28
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	89.28
COG1712		255	Predicted dinucleotide-utilizing enzyme [General f	89.27
PRK06398		258	aldose dehydrogenase; Validated	89.26
TIGR01181		317	dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This	89.15
PRK06198		260	short chain dehydrogenase; Provisional	89.14
PRK07677		252	short chain dehydrogenase; Provisional	89.13
PRK06130		311	3-hydroxybutyryl-CoA dehydrogenase; Validated	89.11
TIGR03206		250	benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr	89.11
PRK08945		247	putative oxoacyl-(acyl carrier protein) reductase;	89.09
PRK12748		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	89.09
PRK08277		278	D-mannonate oxidoreductase; Provisional	89.08
KOG0409\|consensus		327		88.97
PRK07102		243	short chain dehydrogenase; Provisional	88.9
KOG0024\|consensus		354		88.81
PRK08040		336	putative semialdehyde dehydrogenase; Provisional	88.8
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	88.77
cd05294		309	LDH-like_MDH_nadp A lactate dehydrogenases-like st	88.73
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	88.67
PRK00811		283	spermidine synthase; Provisional	88.66
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	88.62
PRK13301		267	putative L-aspartate dehydrogenase; Provisional	88.62
PRK10669		558	putative cation:proton antiport protein; Provision	88.61
TIGR00518		370	alaDH alanine dehydrogenase. The family of known L	88.6
COG0771		448	MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas	88.6
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	88.57
PRK05479		330	ketol-acid reductoisomerase; Provisional	88.56
PRK07856		252	short chain dehydrogenase; Provisional	88.52
PRK12827		249	short chain dehydrogenase; Provisional	88.47
PRK09310		477	aroDE bifunctional 3-dehydroquinate dehydratase/sh	88.47
PLN00106		323	malate dehydrogenase	88.46
PRK15181		348	Vi polysaccharide biosynthesis protein TviC; Provi	88.41
PLN02662		322	cinnamyl-alcohol dehydrogenase family protein	88.41
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	88.4
PRK05717		255	oxidoreductase; Validated	88.38
TIGR01771		299	L-LDH-NAD L-lactate dehydrogenase. This model repr	88.34
TIGR00036		266	dapB dihydrodipicolinate reductase.	88.32
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	88.31
PRK07097		265	gluconate 5-dehydrogenase; Provisional	88.31
PRK08264		238	short chain dehydrogenase; Validated	88.31
PRK12744		257	short chain dehydrogenase; Provisional	88.29
PRK12367		245	short chain dehydrogenase; Provisional	88.28
PLN02545		295	3-hydroxybutyryl-CoA dehydrogenase	88.27
PF11976		72	Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter	88.26
PLN02657		390	3,8-divinyl protochlorophyllide a 8-vinyl reductas	88.23
PRK06046		326	alanine dehydrogenase; Validated	88.13
PRK06841		255	short chain dehydrogenase; Provisional	88.12
PRK04207		341	glyceraldehyde-3-phosphate dehydrogenase; Provisio	88.11
PLN02206		442	UDP-glucuronate decarboxylase	88.07
PRK14874		334	aspartate-semialdehyde dehydrogenase; Provisional	88.07
PF10727		127	Rossmann-like: Rossmann-like domain; InterPro: IPR	88.03
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	88.02
cd05296		419	GH4_P_beta_glucosidase Glycoside Hydrolases Family	87.97
PRK08226		263	short chain dehydrogenase; Provisional	87.97
PLN02896		353	cinnamyl-alcohol dehydrogenase	87.96
PRK13303		265	L-aspartate dehydrogenase; Provisional	87.94
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	87.93
TIGR00465		314	ilvC ketol-acid reductoisomerase. This is the seco	87.91
PRK08324		681	short chain dehydrogenase; Validated	87.88
TIGR01832		248	kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod	87.83
PRK09330		384	cell division protein FtsZ; Validated	87.83
TIGR01692		288	HIBADH 3-hydroxyisobutyrate dehydrogenase. This en	87.81
PRK06935		258	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	87.74
TIGR03466		328	HpnA hopanoid-associated sugar epimerase. The sequ	87.67
PRK07774		250	short chain dehydrogenase; Provisional	87.59
COG0281		432	SfcA Malic enzyme [Energy production and conversio	87.57
TIGR01763		305	MalateDH_bact malate dehydrogenase, NAD-dependent.	87.54
PRK09291		257	short chain dehydrogenase; Provisional	87.47
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	87.42
PRK00141		473	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	87.39
PRK08936		261	glucose-1-dehydrogenase; Provisional	87.35
PRK07825		273	short chain dehydrogenase; Provisional	87.34
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	87.31
PLN02968		381	Probable N-acetyl-gamma-glutamyl-phosphate reducta	87.31
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	87.28
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	87.25
TIGR02437		714	FadB fatty oxidation complex, alpha subunit FadB.	87.24
PRK11154		708	fadJ multifunctional fatty acid oxidation complex	87.16
COG1062		366	AdhC Zn-dependent alcohol dehydrogenases, class II	87.15
PRK07889		256	enoyl-(acyl carrier protein) reductase; Provisiona	87.12
PRK14194		301	bifunctional 5,10-methylene-tetrahydrofolate dehyd	87.11
PRK07035		252	short chain dehydrogenase; Provisional	87.1
PLN02494		477	adenosylhomocysteinase	87.09
cd05298		437	GH4_GlvA_pagL_like Glycoside Hydrolases Family 4;	87.09
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	87.04
PF00670		162	AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase	87.0
PRK12814		652	putative NADPH-dependent glutamate synthase small	86.99
cd00704		323	MDH Malate dehydrogenase. Malate dehydrogenase (MD	86.95
PRK06500		249	short chain dehydrogenase; Provisional	86.91
TIGR02632		676	RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc	86.89
PLN02650		351	dihydroflavonol-4-reductase	86.84
cd01763		87	Sumo Small ubiquitin-related modifier (SUMO). Smal	86.76
PRK08643		256	acetoin reductase; Validated	86.71
PRK14188		296	bifunctional 5,10-methylene-tetrahydrofolate dehyd	86.69
PRK08267		260	short chain dehydrogenase; Provisional	86.67
PRK09987		299	dTDP-4-dehydrorhamnose reductase; Provisional	86.66
PRK06113		255	7-alpha-hydroxysteroid dehydrogenase; Validated	86.64
COG1064		339	AdhP Zn-dependent alcohol dehydrogenases [General	86.6
PRK15438		378	erythronate-4-phosphate dehydrogenase PdxB; Provis	86.48
TIGR01772		312	MDH_euk_gproteo malate dehydrogenase, NAD-dependen	86.47
PTZ00325		321	malate dehydrogenase; Provisional	86.45
cd08281		371	liver_ADH_like1 Zinc-dependent alcohol dehydrogena	86.43
PRK08862		227	short chain dehydrogenase; Provisional	86.33
PTZ00075		476	Adenosylhomocysteinase; Provisional	86.31
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	86.31
TIGR00936		406	ahcY adenosylhomocysteinase. This enzyme hydrolyze	86.3
TIGR00065		349	ftsZ cell division protein FtsZ. This family consi	86.3
TIGR00137		433	gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo	86.28
PRK08125		660	bifunctional UDP-glucuronic acid decarboxylase/UDP	86.24
PRK13984		604	putative oxidoreductase; Provisional	86.23
PRK00257		381	erythronate-4-phosphate dehydrogenase; Validated	86.18
PRK06199		379	ornithine cyclodeaminase; Validated	86.12
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	86.12
PRK08303		305	short chain dehydrogenase; Provisional	86.12
PRK06701		290	short chain dehydrogenase; Provisional	86.1
PLN02695		370	GDP-D-mannose-3',5'-epimerase	86.08
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	86.04
PLN02166		436	dTDP-glucose 4,6-dehydratase	86.02
PRK08594		257	enoyl-(acyl carrier protein) reductase; Provisiona	85.95
smart00846		149	Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase,	85.87
PRK08703		239	short chain dehydrogenase; Provisional	85.84
cd01338		322	MDH_choloroplast_like Chloroplast-like malate dehy	85.83
PRK08589		272	short chain dehydrogenase; Validated	85.82
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	85.79
PRK07904		253	short chain dehydrogenase; Provisional	85.75
CHL00194		317	ycf39 Ycf39; Provisional	85.75
PRK06487		317	glycerate dehydrogenase; Provisional	85.71
PLN02858		1378	fructose-bisphosphate aldolase	85.7
TIGR01759		323	MalateDH-SF1 malate dehydrogenase. This model repr	85.69
PRK07060		245	short chain dehydrogenase; Provisional	85.63
TIGR03325		262	BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro	85.63
PRK13018		378	cell division protein FtsZ; Provisional	85.6
PF03447		117	NAD_binding_3: Homoserine dehydrogenase, NAD bindi	85.58
PRK06171		266	sorbitol-6-phosphate 2-dehydrogenase; Provisional	85.55
PRK08220		252	2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	85.51
PRK09135		249	pteridine reductase; Provisional	85.51
cd01337		310	MDH_glyoxysomal_mitochondrial Glyoxysomal and mito	85.5
PRK08340		259	glucose-1-dehydrogenase; Provisional	85.47
TIGR01289		314	LPOR light-dependent protochlorophyllide reductase	85.42
PRK06270		341	homoserine dehydrogenase; Provisional	85.4
PLN00016		378	RNA-binding protein; Provisional	85.33
PRK06128		300	oxidoreductase; Provisional	85.28
TIGR01317		485	GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal	85.26
PLN02740		381	Alcohol dehydrogenase-like	85.23
PRK06179		270	short chain dehydrogenase; Provisional	85.22
PRK12937		245	short chain dehydrogenase; Provisional	85.15
smart00859		122	Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin	85.11
PLN00112		444	malate dehydrogenase (NADP); Provisional	85.1
PRK10217		355	dTDP-glucose 4,6-dehydratase; Provisional	85.07
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	85.06
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	84.79
TIGR02415		254	23BDH acetoin reductases. One member of this famil	84.78
PF08659		181	KR: KR domain; InterPro: IPR013968 This domain is	84.72
PRK06720		169	hypothetical protein; Provisional	84.7
TIGR01500		256	sepiapter_red sepiapterin reductase. This model de	84.6
PLN02256		304	arogenate dehydrogenase	84.55
PF00240		69	ubiquitin: Ubiquitin family; InterPro: IPR000626 U	84.55
PRK12828		239	short chain dehydrogenase; Provisional	84.48
cd02201		304	FtsZ_type1 FtsZ is a GTPase that is similar to the	84.47
PRK05442		326	malate dehydrogenase; Provisional	84.45
TIGR01745		366	asd_gamma aspartate-semialdehyde dehydrogenase, ga	84.38
PTZ00188		506	adrenodoxin reductase; Provisional	84.38
PRK12831		464	putative oxidoreductase; Provisional	84.36
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	84.32
PRK08628		258	short chain dehydrogenase; Provisional	84.31
PRK07531		495	bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe	84.31
TIGR01758		324	MDH_euk_cyt malate dehydrogenase, NAD-dependent. T	84.24
TIGR02441		737	fa_ox_alpha_mit fatty acid oxidation complex, alph	84.24
TIGR02622		349	CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member	84.18
PRK10538		248	malonic semialdehyde reductase; Provisional	84.16
PRK09126		392	hypothetical protein; Provisional	84.1
PRK08507		275	prephenate dehydrogenase; Validated	84.08
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	84.06
PRK06914		280	short chain dehydrogenase; Provisional	84.02
PRK10084		352	dTDP-glucose 4,6 dehydratase; Provisional	84.01
PRK12825		249	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	83.99
PRK06200		263	2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog	83.96
PRK07791		286	short chain dehydrogenase; Provisional	83.95
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	83.89
PF02629		96	CoA_binding: CoA binding domain; InterPro: IPR0037	83.87
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	83.79
TIGR02279		503	PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa	83.75
TIGR03451		358	mycoS_dep_FDH mycothiol-dependent formaldehyde deh	83.75
PLN02986		322	cinnamyl-alcohol dehydrogenase family protein	83.72
PRK08085		254	gluconate 5-dehydrogenase; Provisional	83.67
cd01336		325	MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli	83.65
PF05368		233	NmrA: NmrA-like family; InterPro: IPR008030 NmrA i	83.64
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	83.63
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	83.59
KOG1371\|consensus		343		83.58
PRK08410		311	2-hydroxyacid dehydrogenase; Provisional	83.44
PRK05786		238	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	83.4
PRK06185		407	hypothetical protein; Provisional	83.36
PRK07984		262	enoyl-(acyl carrier protein) reductase; Provisiona	83.36
PRK07236		386	hypothetical protein; Provisional	83.26
COG0287		279	TyrA Prephenate dehydrogenase [Amino acid transpor	83.25
PRK08017		256	oxidoreductase; Provisional	83.22
PRK12775		1006	putative trifunctional 2-polyprenylphenol hydroxyl	83.21
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	83.16
TIGR02371		325	ala_DH_arch alanine dehydrogenase, Archaeoglobus f	83.16
COG0136		334	Asd Aspartate-semialdehyde dehydrogenase [Amino ac	83.03
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	82.91

>KOG2015\|consensus	Back alignment and domain information

Probab=100.00  E-value=2.2e-95  Score=696.54  Aligned_cols=412  Identities=62%  Similarity=1.062  Sum_probs=395.0

Q ss_pred             hhhhHHHHHhhcCCCCCCC---CCChHHHHHHhcCCeEEEECCchHHHHHHHHHHHhCCCeEEEEeCCcCCccCCccccC
Q psy7810          14 ARKWNHLRKVLERPGPFCT---SPSSEALSFLQTSCKVLIIGAGGLGCELLKDIALMGFNEIHVIDMDTIDLSNLNRQFL   90 (478)
Q Consensus        14 ~~r~~~~~~l~~r~~~f~~---~~G~e~~~~~L~~~~VlvvG~GglG~eiaknLal~Gvg~i~iiD~D~v~~sNL~rqfl   90 (478)
                      ..||.+.+++++|+|||..   ++++|+++.+ .+.|||||||||+|||++|||+++||+.+++||+|+|+++|||||||
T Consensus         7 s~r~~~~~~~l~r~gpf~~~~f~~~~e~l~~l-~~~kiLviGAGGLGCElLKnLal~gF~~~~viDmDTId~sNLNRQFL   85 (422)
T KOG2015|consen    7 SKRWNGWRQSLERPGPFNLDAFEPSEENLEFL-QDCKILVIGAGGLGCELLKNLALSGFRQLHVIDMDTIDLSNLNRQFL   85 (422)
T ss_pred             hhhhHHHHHHhcCCCCCCCCCCCCCHHHHHHH-hhCcEEEEccCcccHHHHHhHHhhccceeEEEeecceecccchhhhc
Confidence            6799999999999999997   9999999965 78999999999999999999999999999999999999999999999


Q ss_pred             CCCCccCchHHHHHHHHHHhhCCCCeEEEEecccCCCchhhhccccEEEeccCcHHHHHHHHHHHHHhhhccccCcccCC
Q psy7810          91 FRQKDIGSSKAEVAAKFINSRIPGVKVIPHFCKIQDYDSDFYQQFHIIVCGLDSIVARRWINGMLLSLLQYEEDGQVDQS  170 (478)
Q Consensus        91 ~~~~diG~~Ka~aa~~~l~~~np~v~i~~~~~~i~~~~~~~~~~~DlVi~~~Dn~~~r~~in~~~~~l~~~~~~~~~~~~  170 (478)
                      |+++|||++||++||+++++..|.+.|.+|..+|++++.+|+++||+||+++|++++|+|||.+...+..+   |..+..
T Consensus        86 F~~~DiG~pKAqvAA~fvn~Rvp~~~v~~h~~kIqd~~~~FYk~F~~iicGLDsIeaRRwIN~mL~~l~~~---g~~d~~  162 (422)
T KOG2015|consen   86 FRESDIGEPKAQVAAEFVNRRVPGCVVVPHRQKIQDKPISFYKRFDLIICGLDSIEARRWINGMLVRLKLE---GNYDIS  162 (422)
T ss_pred             ccccccCchhHHHHHHHHHhhCCCcEEeeeecchhcCCHHHHhhhceEEecccchhHHHHHHHHHHHHHhc---cCCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999887665   666667


Q ss_pred             CceeEEEeeeeceeceEEEEcCCCCccccccCCCCCCCCCCCcceeccCCCCCccchhhhhhccccccccCCCCCCCCCC
Q psy7810         171 TIIPMVDGGTEGFKGNARVILPGMTACIDCTLDLFPPQVTYPLCTIASTPRLPEHCIEYVKVTYPLCTIASTPRLPEHCD  250 (478)
Q Consensus       171 ~~ip~i~~g~~G~~G~v~~~~p~~t~c~~c~~~~~p~~~~~p~cti~~~p~~~~h~i~wak~~~~~~~~~~~~~~~~~~~  250 (478)
                      .-+|+||+|++|++|++++++|+.|+|++|+.+.+|++.+||.|||.++|+.|+|                         
T Consensus       163 ~iiPlIDGGtEG~KG~arvI~Pg~TaCieCtldlyppqvs~P~CTiAntPRlpEH-------------------------  217 (422)
T KOG2015|consen  163 SIIPLIDGGTEGFKGHARVIYPGITACIECTLDLYPPQVSYPMCTIANTPRLPEH-------------------------  217 (422)
T ss_pred             ceeeeeecCcccccceeEEEecCccHHHHhHHhhcCcccCcccceecCCCCCchH-------------------------
Confidence            7899999999999999999999999999999999999999999999999999999                         


Q ss_pred             CCCCCchhhHHHHHHhhhccCCCCCCCCCCCChhhHHHHHHHHHHHHHhcCCCccchhhhhhhhcccccccccHHHHHHH
Q psy7810         251 LPPRLPEHCIEYVKVIQWSKENPFDCPIDGDDPNHINWIYEKASERASQFNIVGVTYRLVQGVIKNIIPAVASTNAVIAA  330 (478)
Q Consensus       251 ~~~~~~~~c~~~~~~~~~~~~~~~~~~~d~dd~~~l~~v~~~a~~ra~~f~I~~~~~~~~k~ia~~iiPaia~tnAivag  330 (478)
                              |++|++.++|.+.+++|..++.||+.|++||++.+++||..|+|+++++.++.|+++.|||++|+|||+||+
T Consensus       218 --------ciEyv~liqwpe~~~~g~~~~gdd~~hI~wi~er~~eRA~ef~I~gv~~~lvtGvvK~IIPaVasTNA~IAA  289 (422)
T KOG2015|consen  218 --------CIEYVKLIQWPELNPFGVPLDGDDPEHIEWIVERSNERANEFNITGVTRRLVTGVVKRIIPAVASTNAVIAA  289 (422)
T ss_pred             --------hhhhhhhhcchhhCccCCCCCCCCHHHHHHHHHHHHHHhhhcccccchHHhhhhhHHhhcchhhhhhHHHHH
Confidence                    888888999999999988999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCCCCccceEEEeeCCCceEEeeccccCCCCccCCCCCCCeEEEEcCCCCcHHHHHHHHhcCCCCCccC
Q psy7810         331 TCATEVFKLATGCATSLNNYMVFNDVAGIYTYTYEAERKSNCLACGPANQPKYLDIESLDMKLSELIELLCQHPSYQMKS  410 (478)
Q Consensus       331 l~~~EalK~l~~~~~pl~n~~~~~~~~g~~~~~~~~~~~~~C~vC~~~~~~~~~~~~~~~~Tl~~li~~l~~~~~~~~~~  410 (478)
                      .+|.||+|+++....+++||++|++.+|.+++++.+++.++|+||+  .....+.++++. ||+++++++++  .|+|..
T Consensus       290 ~Ca~ea~Kl~t~~~~~~~Nym~~n~~eG~ytytf~~er~~nC~vCS--~~~~~~~ispt~-tl~~vl~~ls~--~~~lk~  364 (422)
T KOG2015|consen  290 VCATEALKLLTATDDPLDNYMNYNAEEGIYTYTFLLERDKNCPVCS--NLVQNYDISPTV-TLEDVLNHLSK--SFQLKS  364 (422)
T ss_pred             HHHHHHHHHHHhcchhhhhheeeecccceeEEEeeeccCCCCcccc--CCCcccccCCcc-cHHHHHHHhhh--hhccCC
Confidence            9999999999999999999999999999999999999999999999  778888888754 99999999997  999999


Q ss_pred             CcceEeecCCccEEEecCccchhHHhhhccccccccccccCCcEEEEecCCCCeeEEEEEEe
Q psy7810         411 PGLTTMQDGRNRTLYMSTVRSIEEATRENLKRSLVELGLRDEGIVNVADSTTPNTLEITLRV  472 (478)
Q Consensus       411 ~~i~~~~~~~~~~ly~~~~~~~~~~~~~nl~k~l~~l~~~~g~~l~v~d~~~~~~~~~~i~~  472 (478)
                      |++++..   .+.||.+++|++|+.++.||.++|++|  .+|++|.|+|...+..+++++++
T Consensus       365 p~~tt~~---~~~ly~~~~~~~e~~t~~nl~~~l~~l--~dg~~l~vtd~~~~~~l~~~l~~  421 (422)
T KOG2015|consen  365 PALTTAA---GRTLYLSSVPSIEEATRKNLSQSLKEL--SDGQELVVTDKTLSTALTLQLRE  421 (422)
T ss_pred             chhhhhh---cceEeecCCcHHHHHhhhhhhhhHHHh--cCCceEEEecccCCcceeEEEec
Confidence            9998642   479999999999999999999999999  99999999999999999999986

>KOG2013\|consensus	Back alignment and domain information

>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3	Back alignment and domain information

>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2	Back alignment and domain information

>TIGR01408 Ube1 ubiquitin-activating enzyme E1	Back alignment and domain information

>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2	Back alignment and domain information

>KOG2012\|consensus	Back alignment and domain information

>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like	Back alignment and domain information

>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>PRK07411 hypothetical protein; Validated	Back alignment and domain information

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>PRK05600 thiamine biosynthesis protein ThiF; Validated	Back alignment and domain information

>PRK05597 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated	Back alignment and domain information

>PRK08223 hypothetical protein; Validated	Back alignment and domain information

>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1	Back alignment and domain information

>PRK08328 hypothetical protein; Provisional	Back alignment and domain information

>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA	Back alignment and domain information

>PRK08762 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1	Back alignment and domain information

>KOG2014\|consensus	Back alignment and domain information

>TIGR01408 Ube1 ubiquitin-activating enzyme E1	Back alignment and domain information

>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism]	Back alignment and domain information

>KOG2017\|consensus	Back alignment and domain information

>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like	Back alignment and domain information

>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1	Back alignment and domain information

>TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family	Back alignment and domain information

>KOG2012\|consensus	Back alignment and domain information

>PRK14852 hypothetical protein; Provisional	Back alignment and domain information

>PRK14851 hypothetical protein; Provisional	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>PRK07877 hypothetical protein; Provisional	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively	Back alignment and domain information

>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E	Back alignment and domain information

>PTZ00245 ubiquitin activating enzyme; Provisional	Back alignment and domain information

>KOG2336\|consensus	Back alignment and domain information

>KOG2016\|consensus	Back alignment and domain information

>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism]	Back alignment and domain information

>PRK06153 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein	Back alignment and domain information

>KOG2018\|consensus	Back alignment and domain information

>PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ]	Back alignment and domain information

>PF08825 E2_bind: E2 binding domain; InterPro: IPR014929 E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades	Back alignment and domain information

>KOG2337\|consensus	Back alignment and domain information

>PF14732 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquitin-like domain; PDB: 1Y8Q_B 1Y8R_E 3KYD_B 3KYC_B	Back alignment and domain information

>PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein	Back alignment and domain information

>TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>PRK12549 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only]	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>PRK12548 shikimate 5-dehydrogenase; Provisional	Back alignment and domain information

>PF09358 UBA_e1_C: Ubiquitin-activating enzyme e1 C-terminal domain; InterPro: IPR018965 This presumed domain found at the C terminus of Ubiquitin-activating enzyme e1 proteins is functionally uncharacterised	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>PRK14027 quinate/shikimate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>PRK12749 quinate/shikimate dehydrogenase; Reviewed	Back alignment and domain information

>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase	Back alignment and domain information

>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	Back alignment and domain information

>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]	Back alignment and domain information

>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13940 glutamyl-tRNA reductase; Provisional	Back alignment and domain information

>PRK05562 precorrin-2 dehydrogenase; Provisional	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases	Back alignment and domain information

>KOG4169\|consensus	Back alignment and domain information

>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []	Back alignment and domain information

>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK12550 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PTZ00082 L-lactate dehydrogenase; Provisional	Back alignment and domain information

>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase	Back alignment and domain information

>PLN00203 glutamyl-tRNA reductase	Back alignment and domain information

>PRK00066 ldh L-lactate dehydrogenase; Reviewed	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]	Back alignment and domain information

>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PRK00045 hemA glutamyl-tRNA reductase; Reviewed	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR00507 aroE shikimate 5-dehydrogenase	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK06197 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05854 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate	Back alignment and domain information

>KOG0069\|consensus	Back alignment and domain information

>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional	Back alignment and domain information

>PRK12480 D-lactate dehydrogenase; Provisional	Back alignment and domain information

>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase	Back alignment and domain information

>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ]	Back alignment and domain information

>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins	Back alignment and domain information

>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway	Back alignment and domain information

>PRK07062 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK10637 cysG siroheme synthase; Provisional	Back alignment and domain information

>PRK06141 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK07063 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK13243 glyoxylate reductase; Reviewed	Back alignment and domain information

>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases	Back alignment and domain information

>PLN02602 lactate dehydrogenase	Back alignment and domain information

>PRK09242 tropinone reductase; Provisional	Back alignment and domain information

>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK05866 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>TIGR02992 ectoine_eutC ectoine utilization protein EutC	Back alignment and domain information

>PRK08251 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07502 cyclohexadienyl dehydrogenase; Validated	Back alignment and domain information

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed	Back alignment and domain information

>PRK07340 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK07831 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02928 oxidoreductase family protein	Back alignment and domain information

>PRK08618 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain	Back alignment and domain information

>PRK06436 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>PRK09186 flagellin modification protein A; Provisional	Back alignment and domain information

>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase	Back alignment and domain information

>PRK07574 formate dehydrogenase; Provisional	Back alignment and domain information

>PRK05875 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK00048 dihydrodipicolinate reductase; Provisional	Back alignment and domain information

>PRK08339 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd00300 LDH_like L-lactate dehydrogenase-like enzymes	Back alignment and domain information

>PRK07634 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK05867 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]	Back alignment and domain information

>PRK08291 ectoine utilization protein EutC; Validated	Back alignment and domain information

>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK06223 malate dehydrogenase; Reviewed	Back alignment and domain information

>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>PRK07680 late competence protein ComER; Validated	Back alignment and domain information

>PRK07417 arogenate dehydrogenase; Reviewed	Back alignment and domain information

>PRK06194 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00117 malate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01035 hemA glutamyl-tRNA reductase	Back alignment and domain information

>PTZ00142 6-phosphogluconate dehydrogenase; Provisional	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PRK07576 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases	Back alignment and domain information

>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases	Back alignment and domain information

>PRK10537 voltage-gated potassium channel; Provisional	Back alignment and domain information

>PRK11559 garR tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form	Back alignment and domain information

>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN03139 formate dehydrogenase; Provisional	Back alignment and domain information

>PLN02780 ketoreductase/ oxidoreductase	Back alignment and domain information

>PRK14982 acyl-ACP reductase; Provisional	Back alignment and domain information

>PRK06181 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>PRK06928 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins	Back alignment and domain information

>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]	Back alignment and domain information

>PRK13304 L-aspartate dehydrogenase; Reviewed	Back alignment and domain information

>PRK06940 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK06932 glycerate dehydrogenase; Provisional	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PRK07453 protochlorophyllide oxidoreductase; Validated	Back alignment and domain information

>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>PRK00676 hemA glutamyl-tRNA reductase; Validated	Back alignment and domain information

>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN02350 phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e	Back alignment and domain information

>PRK11880 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism]	Back alignment and domain information

>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK05872 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07814 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07478 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07679 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional	Back alignment and domain information

>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+))	Back alignment and domain information

>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating	Back alignment and domain information

>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating)	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional	Back alignment and domain information

>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed	Back alignment and domain information

>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional	Back alignment and domain information

>PLN02253 xanthoxin dehydrogenase	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK08655 prephenate dehydrogenase; Provisional	Back alignment and domain information

>PLN02427 UDP-apiose/xylose synthase	Back alignment and domain information

>PRK06138 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06523 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07326 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase	Back alignment and domain information

>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK06196 oxidoreductase; Provisional	Back alignment and domain information

>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]	Back alignment and domain information

>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1	Back alignment and domain information

>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase	Back alignment and domain information

>PRK06172 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07024 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02688 pyrroline-5-carboxylate reductase	Back alignment and domain information

>PRK06125 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent	Back alignment and domain information

>PRK13403 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>PRK08818 prephenate dehydrogenase; Provisional	Back alignment and domain information

>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12829 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated	Back alignment and domain information

>PRK12491 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1	Back alignment and domain information

>PRK13302 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK06949 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional	Back alignment and domain information

>PRK07067 sorbitol dehydrogenase; Provisional	Back alignment and domain information

>PRK08374 homoserine dehydrogenase; Provisional	Back alignment and domain information

>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>PRK09880 L-idonate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase	Back alignment and domain information

>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family	Back alignment and domain information

>PRK07109 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR01915 npdG NADPH-dependent F420 reductase	Back alignment and domain information

>PRK05876 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>PRK07074 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02240 UDP-glucose 4-epimerase	Back alignment and domain information

>PLN02989 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>PRK06476 pyrroline-5-carboxylate reductase; Reviewed	Back alignment and domain information

>PTZ00431 pyrroline carboxylate reductase; Provisional	Back alignment and domain information

>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK06249 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A	Back alignment and domain information

>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion]	Back alignment and domain information

>PRK06124 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional	Back alignment and domain information

>PLN02383 aspartate semialdehyde dehydrogenase	Back alignment and domain information

>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed	Back alignment and domain information

>PRK06139 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd08230 glucose_DH Glucose dehydrogenase	Back alignment and domain information

>PRK08278 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed	Back alignment and domain information

>PRK09072 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PLN02852 ferredoxin-NADP+ reductase	Back alignment and domain information

>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated	Back alignment and domain information

>PRK06057 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK05855 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK06114 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08265 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07806 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms)	Back alignment and domain information

>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only]	Back alignment and domain information

>PRK06398 aldose dehydrogenase; Validated	Back alignment and domain information

>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase	Back alignment and domain information

>PRK06198 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07677 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase	Back alignment and domain information

>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK08277 D-mannonate oxidoreductase; Provisional	Back alignment and domain information

>KOG0409\|consensus	Back alignment and domain information

>PRK07102 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG0024\|consensus	Back alignment and domain information

>PRK08040 putative semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PRK13301 putative L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PRK10669 putative cation:proton antiport protein; Provisional	Back alignment and domain information

>TIGR00518 alaDH alanine dehydrogenase	Back alignment and domain information

>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>PRK05479 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>PRK07856 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12827 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed	Back alignment and domain information

>PLN00106 malate dehydrogenase	Back alignment and domain information

>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional	Back alignment and domain information

>PLN02662 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>PRK05717 oxidoreductase; Validated	Back alignment and domain information

>TIGR01771 L-LDH-NAD L-lactate dehydrogenase	Back alignment and domain information

>TIGR00036 dapB dihydrodipicolinate reductase	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK07097 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK08264 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK12744 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12367 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02545 3-hydroxybutyryl-CoA dehydrogenase	Back alignment and domain information

>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins	Back alignment and domain information

>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase	Back alignment and domain information

>PRK06046 alanine dehydrogenase; Validated	Back alignment and domain information

>PRK06841 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN02206 UDP-glucuronate decarboxylase	Back alignment and domain information

>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional	Back alignment and domain information

>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase	Back alignment and domain information

>PRK08226 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02896 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>PRK13303 L-aspartate dehydrogenase; Provisional	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>TIGR00465 ilvC ketol-acid reductoisomerase	Back alignment and domain information

>PRK08324 short chain dehydrogenase; Validated	Back alignment and domain information

>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase	Back alignment and domain information

>PRK09330 cell division protein FtsZ; Validated	Back alignment and domain information

>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase	Back alignment and domain information

>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>TIGR03466 HpnA hopanoid-associated sugar epimerase	Back alignment and domain information

>PRK07774 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG0281 SfcA Malic enzyme [Energy production and conversion]	Back alignment and domain information

>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent	Back alignment and domain information

>PRK09291 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK08936 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK07825 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB	Back alignment and domain information

>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]	Back alignment and domain information

>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK07035 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02494 adenosylhomocysteinase	Back alignment and domain information

>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>cd00704 MDH Malate dehydrogenase	Back alignment and domain information

>PRK06500 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase	Back alignment and domain information

>PLN02650 dihydroflavonol-4-reductase	Back alignment and domain information

>cd01763 Sumo Small ubiquitin-related modifier (SUMO)	Back alignment and domain information

>PRK08643 acetoin reductase; Validated	Back alignment and domain information

>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK08267 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional	Back alignment and domain information

>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated	Back alignment and domain information

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional	Back alignment and domain information

>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent	Back alignment and domain information

>PTZ00325 malate dehydrogenase; Provisional	Back alignment and domain information

>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase)	Back alignment and domain information

>PRK08862 short chain dehydrogenase; Provisional	Back alignment and domain information

>PTZ00075 Adenosylhomocysteinase; Provisional	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>TIGR00936 ahcY adenosylhomocysteinase	Back alignment and domain information

>TIGR00065 ftsZ cell division protein FtsZ	Back alignment and domain information

>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase	Back alignment and domain information

>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK00257 erythronate-4-phosphate dehydrogenase; Validated	Back alignment and domain information

>PRK06199 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>PRK08303 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06701 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02695 GDP-D-mannose-3',5'-epimerase	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN02166 dTDP-glucose 4,6-dehydratase	Back alignment and domain information

>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain	Back alignment and domain information

>PRK08703 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases	Back alignment and domain information

>PRK08589 short chain dehydrogenase; Validated	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>PRK07904 short chain dehydrogenase; Provisional	Back alignment and domain information

>CHL00194 ycf39 Ycf39; Provisional	Back alignment and domain information

>PRK06487 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PLN02858 fructose-bisphosphate aldolase	Back alignment and domain information

>TIGR01759 MalateDH-SF1 malate dehydrogenase	Back alignment and domain information

>PRK07060 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase	Back alignment and domain information

>PRK13018 cell division protein FtsZ; Provisional	Back alignment and domain information

>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway	Back alignment and domain information

>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional	Back alignment and domain information

>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	Back alignment and domain information

>PRK09135 pteridine reductase; Provisional	Back alignment and domain information

>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases	Back alignment and domain information

>PRK08340 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>TIGR01289 LPOR light-dependent protochlorophyllide reductase	Back alignment and domain information

>PRK06270 homoserine dehydrogenase; Provisional	Back alignment and domain information

>PLN00016 RNA-binding protein; Provisional	Back alignment and domain information

>PRK06128 oxidoreductase; Provisional	Back alignment and domain information

>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit	Back alignment and domain information

>PLN02740 Alcohol dehydrogenase-like	Back alignment and domain information

>PRK06179 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12937 short chain dehydrogenase; Provisional	Back alignment and domain information

>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain	Back alignment and domain information

>PLN00112 malate dehydrogenase (NADP); Provisional	Back alignment and domain information

>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>TIGR02415 23BDH acetoin reductases	Back alignment and domain information

>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain	Back alignment and domain information

>PRK06720 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01500 sepiapter_red sepiapterin reductase	Back alignment and domain information

>PLN02256 arogenate dehydrogenase	Back alignment and domain information

>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade	Back alignment and domain information

>PRK12828 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd02201 FtsZ_type1 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes	Back alignment and domain information

>PRK05442 malate dehydrogenase; Provisional	Back alignment and domain information

>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial	Back alignment and domain information

>PTZ00188 adrenodoxin reductase; Provisional	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PRK08628 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated	Back alignment and domain information

>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent	Back alignment and domain information

>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial	Back alignment and domain information

>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase	Back alignment and domain information

>PRK10538 malonic semialdehyde reductase; Provisional	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>PRK08507 prephenate dehydrogenase; Validated	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>PRK06914 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional	Back alignment and domain information

>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional	Back alignment and domain information

>PRK07791 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC	Back alignment and domain information

>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase	Back alignment and domain information

>PLN02986 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PRK08085 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases	Back alignment and domain information

>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>KOG1371\|consensus	Back alignment and domain information

>PRK08410 2-hydroxyacid dehydrogenase; Provisional	Back alignment and domain information

>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08017 oxidoreductase; Provisional	Back alignment and domain information

>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type	Back alignment and domain information

>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		478
2nvu_B		805	Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1		1e-162
3dbl_B		434	Structural Dissection Of A Gating Mechanism Prevent		1e-162
1r4m_B		431	Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com		1e-162
3gzn_B		463	Structure Of Nedd8-Activating Enzyme In Complex Wit		1e-162
1yov_B		444	Insights Into The Ubiquitin Transfer Cascade From T		1e-162
3dbr_B		434	Structural Dissection Of A Gating Mechanism Prevent		1e-161
1tt5_B		434	Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I		1e-161
3dbh_B		434	Structural Dissection Of A Gating Mechanism Prevent		1e-161
3kyc_B		660	Human Sumo E1 Complex With A Sumo1-Amp Mimic Length		1e-36
3kyc_B		660	Human Sumo E1 Complex With A Sumo1-Amp Mimic Length		4e-05
3kyd_B		551	Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi		1e-36
3kyd_B		551	Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi		1e-05
1y8q_B		640	Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex		6e-36
1y8q_B		640	Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex		5e-05
3cmm_A		1015	Crystal Structure Of The Uba1-Ubiquitin Complex Len		1e-25
4ii2_A		1001	Crystal Structure Of Ubiquitin Activating Enzyme 1		2e-24
2lq7_A		97	E2 Binding Surface On Uba3 Beta-Grasp Domain Underg		6e-15
1y8x_B		98	Structural Basis For Recruitment Of Ubc12 By An E2-		7e-14
3h5n_A		353	Crystal Structure Of E. Coli Mccb + Atp Length = 35		3e-08
3h5a_A		358	Crystal Structure Of E. Coli Mccb Length = 358		3e-08
1jwb_B		249	Structure Of The Covalent Acyl-Adenylate Form Of Th		6e-08
1zud_1		251	Structure Of This-Thif Protein Complex Length = 251		1e-06
1zfn_A		253	Structural Analysis Of Escherichia Coli Thif Length		1e-06
4gsk_A		615	Crystal Structure Of An Atg7-Atg10 Crosslinked Comp		2e-06
3rui_A		340	Crystal Structure Of Atg7c-Atg8 Complex Length = 34		3e-06
3t7e_A		344	Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E		3e-06
3vh3_A		340	Crystal Structure Of Atg7ctd-Atg8 Complex Length =		3e-06
4gsl_A		615	Crystal Structure Of An Atg7-Atg3 Crosslinked Compl		3e-06
3vh2_A		616	Crystal Structure Of Saccharomyces Cerevisiae Atg7		3e-06
3vh1_A		598	Crystal Structure Of Saccharomyces Cerevisiae Atg7		3e-06
1y8q_A		346	Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex		1e-05
2nvu_A		536	Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1		2e-05
1yov_A		537	Insights Into The Ubiquitin Transfer Cascade From T		2e-05
1r4m_A		529	Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com		2e-05
1tt5_A		531	Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I		2e-05
3gzn_A		534	Structure Of Nedd8-Activating Enzyme In Complex Wit		2e-05

>pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805