Psyllid ID: psy7826


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210---
MALICHIFWLAFGHLATGQEIFGINNKPNNYENNLDVQVCMGKHKGTKMEKKPMEYLVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGI
ccHHHHHHHHHHcccccccEEEEEccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHcccccccccccEEEEEccccccccccccccEEEEEcccccccccc
cHHHHHHHHHHHHHHHccccHcccccccccccccHHHHHHHHHHccHHHcHHHHHHHHHHHHHccccccHHHHHHHHHccHHccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHcHHHHccccEEEEEccccccccccccccEEEEEcccccccccc
MALICHIFWLAfghlatgqeifginnkpnnyennlDVQVCmgkhkgtkmekkPMEYLVEHLKETlfieselpykAMLAvdrghyttwrpyancitnigygahmqapfqqAMVLDDLSEELtegkkvldigsgngYFTALLAWCVGktgkvigiehIPQLVQRAThnvisgnpefvkdgrikfvlgdgrkgyldeapydiihvggsiedipegi
MALICHIFWLAFGHLATGQEIFGINNKPNNYENNLDVQVCMGKHKGTKMEKKPMEYLVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNvisgnpefvkdgrIKFVLGDGRKGyldeapydiihvggsiedipegi
MALICHIFWLAFGHLATGQEIFGINNKPNNYENNLDVQVCMGKHKGTKMEKKPMEYLVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGI
**LICHIFWLAFGHLATGQEIFGINNKPNNYENNLDVQVCMGKHKG*****KPMEYLVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSI*******
*ALICHIFWLAFGHLATGQEIFGINNKPN***************************LVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPE**
MALICHIFWLAFGHLATGQEIFGINNKPNNYENNLDVQVCMGKHKGTKMEKKPMEYLVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGI
MALICHIFWLAFGHLATGQEIFGINNKPNNYENNLDVQVCMGKHKGTKMEKKPMEYLVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALICHIFWLAFGHLATGQEIFGINNKPNNYENNLDVQVCMGKHKGTKMEKKPMEYLVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query213 2.2.26 [Sep-21-2011]
Q92047228 Protein-L-isoaspartate(D- no N/A 0.737 0.688 0.433 8e-34
Q5F3N1228 Protein-L-isoaspartate(D- no N/A 0.737 0.688 0.420 2e-33
P22061227 Protein-L-isoaspartate(D- yes N/A 0.737 0.691 0.433 3e-33
Q4R5H0227 Protein-L-isoaspartate(D- N/A N/A 0.737 0.691 0.433 4e-33
Q5RA89227 Protein-L-isoaspartate(D- yes N/A 0.737 0.691 0.433 4e-33
P80895227 Protein-L-isoaspartate(D- yes N/A 0.737 0.691 0.426 6e-33
P15246227 Protein-L-isoaspartate(D- yes N/A 0.737 0.691 0.426 7e-33
P23506227 Protein-L-isoaspartate(D- no N/A 0.737 0.691 0.426 8e-33
P22062227 Protein-L-isoaspartate(D- yes N/A 0.737 0.691 0.420 2e-32
Q27873225 Protein-L-isoaspartate O- yes N/A 0.737 0.697 0.394 6e-31
>sp|Q92047|PIMT_DANRE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Danio rerio GN=pcmt PE=2 SV=3 Back     alignment and function desciption
 Score =  143 bits (361), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 99/157 (63%)

Query: 57  LVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDL 116
           LV +L++   I+S+  Y+ MLA DR H++   PY +   +IGY A + AP   A  L+ L
Sbjct: 13  LVNNLRKNGIIKSDRVYEVMLATDRSHFSRCNPYMDSPQSIGYQATISAPHMHAYALELL 72

Query: 117 SEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVK 176
            + L EG K LD+GSG+G  +   +  VG TGKVIGI+HI +LV+ +  NV   +P  + 
Sbjct: 73  HDHLYEGAKALDVGSGSGILSVCFSRMVGPTGKVIGIDHIKELVEDSIANVKKDDPSLIT 132

Query: 177 DGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGI 213
            GRIK ++GDGR G+ +EAPYD IHVG +   +P+ +
Sbjct: 133 SGRIKLIVGDGRMGFTEEAPYDAIHVGAAAPTVPQAL 169




Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.
Danio rerio (taxid: 7955)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 7EC: 7
>sp|Q5F3N1|PIMT_CHICK Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Gallus gallus GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens GN=PCMT1 PE=1 SV=4 Back     alignment and function description
>sp|Q4R5H0|PIMT_MACFA Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Macaca fascicularis GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|Q5RA89|PIMT_PONAB Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Pongo abelii GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|P80895|PIMT_PIG Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Sus scrofa GN=PCMT1 PE=1 SV=3 Back     alignment and function description
>sp|P15246|PIMT_BOVIN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Bos taurus GN=PCMT1 PE=1 SV=2 Back     alignment and function description
>sp|P23506|PIMT_MOUSE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Mus musculus GN=Pcmt1 PE=1 SV=3 Back     alignment and function description
>sp|P22062|PIMT_RAT Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Rattus norvegicus GN=Pcmt1 PE=1 SV=2 Back     alignment and function description
>sp|Q27873|PIMT_CAEEL Protein-L-isoaspartate O-methyltransferase OS=Caenorhabditis elegans GN=pcm-1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
339239031290 protein-L-isoaspartate(D-aspartate) O-me 0.680 0.5 0.510 9e-38
291222791257 PREDICTED: Protein-L-isoaspartate (D-asp 0.746 0.618 0.446 1e-35
41152134228 l-isoaspartyl protein carboxyl methyltra 0.737 0.688 0.484 2e-35
348531162246 PREDICTED: protein-L-isoaspartate(D-aspa 0.737 0.638 0.477 3e-35
226443368249 Protein-L-isoaspartateD-aspartate O-meth 0.737 0.630 0.471 8e-35
390345040296 PREDICTED: protein-L-isoaspartate(D-aspa 0.746 0.537 0.446 8e-35
318102097249 l-isoaspartate(d-aspartate) o-methyltran 0.737 0.630 0.490 1e-34
213982893169 uncharacterized protein LOC100216173 [Xe 0.727 0.917 0.477 1e-34
225710608250 Protein-L-isoaspartateD-aspartate O-meth 0.708 0.604 0.470 3e-34
326919840248 PREDICTED: protein-L-isoaspartate(D-aspa 0.727 0.625 0.458 4e-34
>gi|339239031|ref|XP_003381070.1| protein-L-isoaspartate(D-aspartate) O-methyltransferase [Trichinella spiralis] gi|316975942|gb|EFV59314.1| protein-L-isoaspartate(D-aspartate) O-methyltransferase [Trichinella spiralis] Back     alignment and taxonomy information
 Score =  162 bits (410), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 98/145 (67%)

Query: 69  SELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEGKKVLD 128
           SE   KAMLAVDRG YT  RPY +    IG+ A + AP   A  L+ L + LTEG + LD
Sbjct: 83  SESVEKAMLAVDRGFYTDSRPYIDSPQGIGFAATISAPHMHAYALEMLKDHLTEGNRALD 142

Query: 129 IGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGR 188
           +GSG+GY TA  A  +G +GK +GIEHIPQLV+++  NV +GNPE +  GR+K ++GDGR
Sbjct: 143 VGSGSGYLTACFAIMLGNSGKAVGIEHIPQLVEKSIQNVRNGNPELLSSGRVKLIVGDGR 202

Query: 189 KGYLDEAPYDIIHVGGSIEDIPEGI 213
            GY  + PYD IHVG + E +P+ +
Sbjct: 203 DGYAQDGPYDAIHVGAAAERVPQAL 227




Source: Trichinella spiralis

Species: Trichinella spiralis

Genus: Trichinella

Family: Trichinellidae

Order: Trichocephalida

Class: Enoplea

Phylum: Nematoda

Superkingdom: Eukaryota

>gi|291222791|ref|XP_002731398.1| PREDICTED: Protein-L-isoaspartate (D-aspartate) O-methyltransferase-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|41152134|ref|NP_957062.1| l-isoaspartyl protein carboxyl methyltransferase, like [Danio rerio] gi|37589722|gb|AAH59599.1| L-isoaspartyl protein carboxyl methyltransferase, like [Danio rerio] Back     alignment and taxonomy information
>gi|348531162|ref|XP_003453079.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|226443368|ref|NP_001140111.1| Protein-L-isoaspartateD-aspartate O-methyltransferase precursor [Salmo salar] gi|221222218|gb|ACM09770.1| Protein-L-isoaspartateD-aspartate O-methyltransferase [Salmo salar] Back     alignment and taxonomy information
>gi|390345040|ref|XP_786523.3| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|318102097|ref|NP_001188104.1| l-isoaspartate(d-aspartate) o-methyltransferase precursor [Ictalurus punctatus] gi|308322677|gb|ADO28476.1| l-isoaspartate(d-aspartate) o-methyltransferase [Ictalurus punctatus] Back     alignment and taxonomy information
>gi|213982893|ref|NP_001135614.1| uncharacterized protein LOC100216173 [Xenopus (Silurana) tropicalis] gi|197246545|gb|AAI68437.1| Unknown (protein for MGC:135713) [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|225710608|gb|ACO11150.1| Protein-L-isoaspartateD-aspartate O-methyltransferase [Caligus rogercresseyi] Back     alignment and taxonomy information
>gi|326919840|ref|XP_003206185.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Meleagris gallopavo] gi|363734030|ref|XP_420939.3| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase [Gallus gallus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query213
ZFIN|ZDB-GENE-040426-1738249 pcmtl "l-isoaspartyl protein c 0.737 0.630 0.484 4e-35
UNIPROTKB|E1BXJ0228 LOC423008 "Protein-L-isoaspart 0.727 0.679 0.458 2.8e-34
ZFIN|ZDB-GENE-990415-134266 pcmt "l-isoaspartyl protein ca 0.737 0.590 0.433 1.8e-32
UNIPROTKB|Q5F3N1228 PCMT1 "Protein-L-isoaspartate( 0.737 0.688 0.420 2.3e-32
UNIPROTKB|H7BY58286 PCMT1 "Protein-L-isoaspartate 0.737 0.548 0.433 2.3e-32
UNIPROTKB|J3KP72285 PCMT1 "Protein-L-isoaspartate 0.737 0.550 0.433 2.3e-32
UNIPROTKB|P22061227 PCMT1 "Protein-L-isoaspartate( 0.737 0.691 0.433 2.3e-32
UNIPROTKB|E2R3G3286 PCMT1 "Protein-L-isoaspartate 0.737 0.548 0.426 4.7e-32
UNIPROTKB|P80895227 PCMT1 "Protein-L-isoaspartate( 0.737 0.691 0.426 6e-32
UNIPROTKB|G3MZZ6228 PCMT1 "Protein-L-isoaspartate 0.737 0.688 0.426 9.8e-32
ZFIN|ZDB-GENE-040426-1738 pcmtl "l-isoaspartyl protein carboxyl methyltransferase, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 380 (138.8 bits), Expect = 4.0e-35, P = 4.0e-35
 Identities = 76/157 (48%), Positives = 104/157 (66%)

Query:    57 LVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDL 116
             L+  L++   I ++  + AMLA DRG Y+   PYA+   +IGY A + AP   A  L+ L
Sbjct:    34 LITRLRDHGVIHNDRVFNAMLATDRGIYSRDHPYADSPQSIGYKATISAPHMHAHALEVL 93

Query:   117 SEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVK 176
             S++LTEG   LD+GSG+GY TA  A  VG +GKV+GI+HI QLVQ +  NV + +PE + 
Sbjct:    94 SDKLTEGASALDVGSGSGYLTACFARMVGPSGKVVGIDHIDQLVQSSVKNVQADDPELLA 153

Query:   177 DGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGI 213
              GRIK V+GDGR G+ DEAPYD IHVG +   +P+ +
Sbjct:   154 TGRIKLVVGDGRFGFPDEAPYDAIHVGAAAPTLPKAL 190




GO:0006464 "cellular protein modification process" evidence=IEA
GO:0004719 "protein-L-isoaspartate (D-aspartate) O-methyltransferase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0032259 "methylation" evidence=IEA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
UNIPROTKB|E1BXJ0 LOC423008 "Protein-L-isoaspartate O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-134 pcmt "l-isoaspartyl protein carboxyl methyltransferase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F3N1 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H7BY58 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KP72 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P22061 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3G3 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P80895 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZZ6 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B1YC47PIMT_PYRNV2, ., 1, ., 1, ., 7, 70.30430.70890.7294yesN/A
A3DMG3PIMT_STAMF2, ., 1, ., 1, ., 7, 70.33330.69480.6577yesN/A
A8AAV7PIMT_IGNH42, ., 1, ., 1, ., 7, 70.32540.73700.7440yesN/A
Q5RA89PIMT_PONAB2, ., 1, ., 1, ., 7, 70.43310.73700.6916yesN/A
A7HL14PIMT_FERNB2, ., 1, ., 1, ., 7, 70.33330.62440.6683yesN/A
B6YX51PIMT_THEON2, ., 1, ., 1, ., 7, 70.35400.69010.6681yesN/A
O27962PIMT2_ARCFU2, ., 1, ., 1, ., 7, 70.37260.69950.6803yesN/A
A4G087PIMT_METM52, ., 1, ., 1, ., 7, 70.31540.64780.6509yesN/A
A3MY16PIMT_PYRCJ2, ., 1, ., 1, ., 7, 70.30430.70890.7294yesN/A
Q27873PIMT_CAEEL2, ., 1, ., 1, ., 7, 70.39490.73700.6977yesN/A
Q42539PIMT_ARATH2, ., 1, ., 1, ., 7, 70.43120.73700.6826yesN/A
Q8TYL4PIMT_METKA2, ., 1, ., 1, ., 7, 70.36840.74640.7035yesN/A
A1RSC6PIMT_PYRIL2, ., 1, ., 1, ., 7, 70.32270.69480.7149yesN/A
A6UWM1PIMT_META32, ., 1, ., 1, ., 7, 70.34310.74170.7314yesN/A
P15246PIMT_BOVIN2, ., 1, ., 1, ., 7, 70.42670.73700.6916yesN/A
Q9URZ1PIMT_SCHPO2, ., 1, ., 1, ., 7, 70.38650.73700.6826yesN/A
Q6M116PIMT_METMP2, ., 1, ., 1, ., 7, 70.32290.70420.7075yesN/A
A6LNM3PIMT_THEM42, ., 1, ., 1, ., 7, 70.33550.63380.6818yesN/A
C6A3F2PIMT_THESM2, ., 1, ., 1, ., 7, 70.33330.69010.6651yesN/A
B5YF00PIMT_DICT62, ., 1, ., 1, ., 7, 70.32700.67600.6545yesN/A
P80895PIMT_PIG2, ., 1, ., 1, ., 7, 70.42670.73700.6916yesN/A
A6VI91PIMT_METM72, ., 1, ., 1, ., 7, 70.30920.66190.6650yesN/A
P22061PIMT_HUMAN2, ., 1, ., 1, ., 7, 70.43310.73700.6916yesN/A
P22062PIMT_RAT2, ., 1, ., 1, ., 7, 70.42030.73700.6916yesN/A
A0B9U1PIMT_METTP2, ., 1, ., 1, ., 7, 70.38650.69950.7095yesN/A
Q27869PIMT_DROME2, ., 1, ., 1, ., 7, 70.37880.73230.6902yesN/A
Q9GPS6PIMT_DICDI2, ., 1, ., 1, ., 7, 70.30800.90140.6075yesN/A
O26915PIMT_METTH2, ., 1, ., 1, ., 7, 70.33960.69480.6820yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691
4th Layer2.1.1.77LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
pfam01135210 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartat 9e-41
TIGR00080215 TIGR00080, pimt, protein-L-isoaspartate(D-aspartat 3e-30
PRK13942212 PRK13942, PRK13942, protein-L-isoaspartate O-methy 1e-28
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethy 5e-28
PRK00312212 PRK00312, pcm, protein-L-isoaspartate O-methyltran 1e-16
TIGR04364 394 TIGR04364, methyltran_FxLD, methyltransferase, FxL 3e-15
PRK13944205 PRK13944, PRK13944, protein-L-isoaspartate O-methy 2e-14
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 2e-11
PRK13943 322 PRK13943, PRK13943, protein-L-isoaspartate O-methy 5e-11
TIGR04188 363 TIGR04188, methyltr_grsp, methyltransferase, ATP-g 3e-10
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltran 1e-08
PRK08317 241 PRK08317, PRK08317, hypothetical protein; Provisio 2e-08
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 3e-08
PRK11873 272 PRK11873, arsM, arsenite S-adenosylmethyltransfera 3e-07
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 3e-06
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 4e-05
TIGR02021219 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-m 2e-04
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 5e-04
PRK14896 258 PRK14896, ksgA, 16S ribosomal RNA methyltransferas 6e-04
PRK00377198 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltr 6e-04
PRK13168443 PRK13168, rumA, 23S rRNA m(5)U1939 methyltransfera 9e-04
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 0.001
COG2242187 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme 0.001
TIGR02752231 TIGR02752, MenG_heptapren, demethylmenaquinone met 0.001
COG4122219 COG4122, COG4122, Predicted O-methyltransferase [G 0.002
COG0500 257 COG0500, SmtA, SAM-dependent methyltransferases [S 0.002
pfam13489154 pfam13489, Methyltransf_23, Methyltransferase doma 0.003
COG2265432 COG2265, TrmA, SAM-dependent methyltransferases re 0.003
>gnl|CDD|216320 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
 Score =  137 bits (347), Expect = 9e-41
 Identities = 70/161 (43%), Positives = 95/161 (59%), Gaps = 11/161 (6%)

Query: 55  EYLVEHLKETLFIESELPYKAMLAVDRGHYTTWR----PYANCITNIGYGAHMQAPFQQA 110
           E L+E+LK    I S+   +AMLAVDR  +         Y +   +IGYG  + AP   A
Sbjct: 4   EALIENLKNYGVIASDKVAEAMLAVDREEFVPESFKSYAYEDIPLSIGYGQTISAPHMHA 63

Query: 111 MVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISG 170
           M+L+ L  EL  G +VL+IGSG+GY TA  A  VG+ G V+ IEHIP+LV+ A  N+   
Sbjct: 64  MMLELL--ELKPGMRVLEIGSGSGYLTACFARMVGEVGLVVSIEHIPELVEIARRNLEKL 121

Query: 171 NPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPE 211
             E      +  V+GDGR+G+ + APYD IHVG +  +IPE
Sbjct: 122 GLE-----NVIVVVGDGRQGWPEFAPYDAIHVGAAAPEIPE 157


Length = 210

>gnl|CDD|232816 TIGR00080, pimt, protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>gnl|CDD|184409 PRK13942, PRK13942, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225316 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|178974 PRK00312, pcm, protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|234563 TIGR04364, methyltran_FxLD, methyltransferase, FxLD system Back     alignment and domain information
>gnl|CDD|140001 PRK13944, PRK13944, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|237568 PRK13943, PRK13943, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234492 TIGR04188, methyltr_grsp, methyltransferase, ATP-grasp peptide maturase system Back     alignment and domain information
>gnl|CDD|225317 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|237007 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|233687 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|237852 PRK14896, ksgA, 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>gnl|CDD|234740 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237291 PRK13168, rumA, 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|131799 TIGR02752, MenG_heptapren, demethylmenaquinone methyltransferase Back     alignment and domain information
>gnl|CDD|226607 COG4122, COG4122, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223574 COG0500, SmtA, SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|222171 pfam13489, Methyltransf_23, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225174 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 213
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.95
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.95
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.94
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.93
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.93
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.88
KOG1661|consensus237 99.87
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 99.84
PRK14903 431 16S rRNA methyltransferase B; Provisional 99.84
PRK14901434 16S rRNA methyltransferase B; Provisional 99.83
PRK14904 445 16S rRNA methyltransferase B; Provisional 99.78
PRK14902 444 16S rRNA methyltransferase B; Provisional 99.77
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 99.77
PRK10901427 16S rRNA methyltransferase B; Provisional 99.76
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.75
COG0144 355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 99.71
TIGR00446 264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.68
PF01189 283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 99.66
COG2226 238 UbiE Methylase involved in ubiquinone/menaquinone 99.63
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.62
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.61
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.57
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.57
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.54
PLN02233261 ubiquinone biosynthesis methyltransferase 99.51
PLN02244 340 tocopherol O-methyltransferase 99.5
COG2890280 HemK Methylase of polypeptide chain release factor 99.48
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 99.47
PRK11088 272 rrmA 23S rRNA methyltransferase A; Provisional 99.47
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.46
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.45
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.45
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.44
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.43
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.43
PF08704 247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.43
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.42
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.42
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.41
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.41
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.41
COG2227 243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.4
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 99.4
KOG1122|consensus 460 99.4
PRK15451 247 tRNA cmo(5)U34 methyltransferase; Provisional 99.4
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.4
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 99.39
PRK11207197 tellurite resistance protein TehB; Provisional 99.39
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.38
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 99.37
PLN02396 322 hexaprenyldihydroxybenzoate methyltransferase 99.37
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 99.36
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.35
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.34
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.33
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.33
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.32
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.32
COG4122219 Predicted O-methyltransferase [General function pr 99.32
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 99.32
PRK06202232 hypothetical protein; Provisional 99.31
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.3
PRK05785226 hypothetical protein; Provisional 99.3
PLN02336 475 phosphoethanolamine N-methyltransferase 99.3
PRK08317 241 hypothetical protein; Provisional 99.3
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.29
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.29
PRK07402196 precorrin-6B methylase; Provisional 99.29
PRK10258 251 biotin biosynthesis protein BioC; Provisional 99.29
KOG2904|consensus328 99.29
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.28
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.28
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.28
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.27
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.27
PRK00216 239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.26
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 99.26
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.25
PLN02476278 O-methyltransferase 99.25
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.25
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.25
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.25
COG4123 248 Predicted O-methyltransferase [General function pr 99.25
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.24
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.24
PRK12335287 tellurite resistance protein TehB; Provisional 99.24
KOG1540|consensus 296 99.24
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.24
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 99.24
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.24
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 99.24
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 99.23
PRK04266226 fibrillarin; Provisional 99.23
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.23
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.22
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.21
PRK14967 223 putative methyltransferase; Provisional 99.21
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.2
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.19
PF07021 193 MetW: Methionine biosynthesis protein MetW; InterP 99.19
PTZ00146293 fibrillarin; Provisional 99.18
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.18
PLN02672 1082 methionine S-methyltransferase 99.18
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.18
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.18
PLN02490 340 MPBQ/MSBQ methyltransferase 99.17
PLN03075296 nicotianamine synthase; Provisional 99.17
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.17
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.17
TIGR00452 314 methyltransferase, putative. Known examples to dat 99.17
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 99.16
PHA03411 279 putative methyltransferase; Provisional 99.16
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 99.15
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.15
TIGR02081 194 metW methionine biosynthesis protein MetW. This pr 99.15
PLN02589247 caffeoyl-CoA O-methyltransferase 99.14
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.13
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.12
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.12
KOG2915|consensus 314 99.12
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.11
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.1
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.1
KOG1270|consensus 282 99.1
PRK06922 677 hypothetical protein; Provisional 99.09
KOG3420|consensus185 99.08
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 99.08
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.08
PHA03412 241 putative methyltransferase; Provisional 99.08
PRK14968188 putative methyltransferase; Provisional 99.06
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 99.05
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 99.05
PRK04457 262 spermidine synthase; Provisional 99.04
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.04
PLN02336 475 phosphoethanolamine N-methyltransferase 99.04
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 99.01
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.0
TIGR03438 301 probable methyltransferase. This model represents 98.99
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.99
KOG1541|consensus 270 98.97
KOG1271|consensus227 98.97
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.96
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.95
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.94
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.94
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.94
TIGR00438188 rrmJ cell division protein FtsJ. 98.93
PRK05134 233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.93
PRK00811 283 spermidine synthase; Provisional 98.92
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.91
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.91
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.91
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.91
PRK11727 321 23S rRNA mA1618 methyltransferase; Provisional 98.9
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.89
PF08003 315 Methyltransf_9: Protein of unknown function (DUF16 98.88
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.87
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.81
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 98.8
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.78
PRK04148134 hypothetical protein; Provisional 98.76
KOG3191|consensus209 98.75
KOG1499|consensus 346 98.74
PLN02366 308 spermidine synthase 98.73
KOG0820|consensus 315 98.72
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.7
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.7
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.68
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.68
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.66
PRK01581 374 speE spermidine synthase; Validated 98.65
TIGR00417 270 speE spermidine synthase. the SpeE subunit of sper 98.64
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.62
KOG2187|consensus534 98.61
PRK03612 521 spermidine synthase; Provisional 98.61
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.59
COG2520341 Predicted methyltransferase [General function pred 98.59
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 98.55
KOG4300|consensus252 98.55
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.55
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.54
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.51
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.51
KOG1500|consensus 517 98.49
COG1041347 Predicted DNA modification methylase [DNA replicat 98.48
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 98.46
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.45
KOG1663|consensus237 98.45
PF04816 205 DUF633: Family of unknown function (DUF633) ; Inte 98.44
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.44
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.43
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 98.42
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.41
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 98.37
KOG2730|consensus263 98.35
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.33
KOG3010|consensus 261 98.32
PRK10742250 putative methyltransferase; Provisional 98.3
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.3
KOG2899|consensus 288 98.3
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 98.28
KOG2198|consensus 375 98.26
PLN02823 336 spermine synthase 98.26
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.25
KOG2360|consensus 413 98.23
COG2384 226 Predicted SAM-dependent methyltransferase [General 98.21
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 98.2
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 98.19
PF13679141 Methyltransf_32: Methyltransferase domain 98.18
COG4076 252 Predicted RNA methylase [General function predicti 98.18
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.17
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 98.16
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 98.16
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.08
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 98.02
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 98.01
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.98
KOG2361|consensus 264 97.93
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 97.92
COG0421 282 SpeE Spermidine synthase [Amino acid transport and 97.92
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.91
COG2521287 Predicted archaeal methyltransferase [General func 97.89
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 97.88
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.85
COG3897218 Predicted methyltransferase [General function pred 97.85
TIGR03439 319 methyl_EasF probable methyltransferase domain, Eas 97.84
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.82
PLN02232160 ubiquinone biosynthesis methyltransferase 97.81
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.78
PF05971 299 Methyltransf_10: Protein of unknown function (DUF8 97.73
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.7
KOG1975|consensus 389 97.66
COG0286 489 HsdM Type I restriction-modification system methyl 97.63
KOG2940|consensus 325 97.6
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 97.53
KOG4589|consensus232 97.52
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 97.49
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 97.46
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 97.44
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 97.43
PRK00536 262 speE spermidine synthase; Provisional 97.34
PHA01634156 hypothetical protein 97.34
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 97.33
KOG1596|consensus317 97.3
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 97.29
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 97.08
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 97.0
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 96.97
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 96.95
KOG1269|consensus 364 96.91
COG0500 257 SmtA SAM-dependent methyltransferases [Secondary m 96.86
PF01861 243 DUF43: Protein of unknown function DUF43; InterPro 96.84
KOG2671|consensus 421 96.82
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 96.81
COG4262 508 Predicted spermidine synthase with an N-terminal m 96.79
KOG1501|consensus 636 96.72
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 96.7
KOG4058|consensus199 96.39
KOG3178|consensus342 96.35
KOG3115|consensus249 96.33
KOG1227|consensus351 96.32
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 96.2
KOG1098|consensus 780 96.19
PRK11524284 putative methyltransferase; Provisional 96.19
KOG1099|consensus 294 96.04
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 96.01
COG1565 370 Uncharacterized conserved protein [Function unknow 95.93
KOG1331|consensus 293 95.72
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 95.71
PRK13699227 putative methylase; Provisional 95.63
PF02636 252 Methyltransf_28: Putative S-adenosyl-L-methionine- 95.58
KOG3045|consensus325 95.5
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 95.29
KOG2651|consensus 476 95.25
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 95.16
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 95.15
KOG0024|consensus354 95.11
KOG2782|consensus 303 95.1
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 94.93
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 94.93
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 94.87
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 94.87
COG3129 292 Predicted SAM-dependent methyltransferase [General 94.6
KOG1709|consensus271 94.18
COG4798238 Predicted methyltransferase [General function pred 93.85
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 93.85
TIGR00497 501 hsdM type I restriction system adenine methylase ( 93.83
PRK10458 467 DNA cytosine methylase; Provisional 93.61
PF05050167 Methyltransf_21: Methyltransferase FkbM domain; In 93.3
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 93.03
KOG3987|consensus288 92.93
COG3510237 CmcI Cephalosporin hydroxylase [Defense mechanisms 92.91
COG1568 354 Predicted methyltransferases [General function pre 92.86
KOG2078|consensus 495 92.73
KOG2352|consensus 482 92.71
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 92.56
PF07942 270 N2227: N2227-like protein; InterPro: IPR012901 Thi 92.09
PF05206 259 TRM13: Methyltransferase TRM13; InterPro: IPR00787 92.08
KOG3201|consensus201 91.93
COG4301 321 Uncharacterized conserved protein [Function unknow 91.57
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 91.44
KOG1253|consensus 525 90.72
KOG2793|consensus248 90.32
PRK08213 259 gluconate 5-dehydrogenase; Provisional 89.81
KOG2352|consensus482 89.21
PF03492 334 Methyltransf_7: SAM dependent carboxyl methyltrans 89.01
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 88.87
PTZ00357 1072 methyltransferase; Provisional 88.69
PRK07904 253 short chain dehydrogenase; Provisional 88.65
KOG0822|consensus 649 88.47
COG2933358 Predicted SAM-dependent methyltransferase [General 88.37
PRK08945 247 putative oxoacyl-(acyl carrier protein) reductase; 87.62
cd08283 386 FDH_like_1 Glutathione-dependent formaldehyde dehy 87.21
PRK06172 253 short chain dehydrogenase; Provisional 87.14
PRK08339 263 short chain dehydrogenase; Provisional 86.98
KOG1201|consensus 300 86.96
KOG2920|consensus282 86.94
PRK06940 275 short chain dehydrogenase; Provisional 86.91
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 86.75
PLN02668 386 indole-3-acetate carboxyl methyltransferase 86.66
PRK05867 253 short chain dehydrogenase; Provisional 86.46
PRK05599 246 hypothetical protein; Provisional 86.36
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.69
PRK07774 250 short chain dehydrogenase; Provisional 85.5
PRK06125 259 short chain dehydrogenase; Provisional 85.36
PRK08862 227 short chain dehydrogenase; Provisional 85.26
PRK08703 239 short chain dehydrogenase; Provisional 85.12
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 85.11
KOG0821|consensus 326 84.99
PF11899 380 DUF3419: Protein of unknown function (DUF3419); In 84.58
PRK06720169 hypothetical protein; Provisional 84.57
PRK07890 258 short chain dehydrogenase; Provisional 84.33
PRK05854 313 short chain dehydrogenase; Provisional 84.11
PRK07063 260 short chain dehydrogenase; Provisional 83.99
PRK06139 330 short chain dehydrogenase; Provisional 83.79
PRK07478 254 short chain dehydrogenase; Provisional 83.67
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 83.31
PRK06124 256 gluconate 5-dehydrogenase; Provisional 83.23
PRK07097 265 gluconate 5-dehydrogenase; Provisional 83.2
PRK07062 265 short chain dehydrogenase; Provisional 83.16
PRK08589 272 short chain dehydrogenase; Validated 83.01
PRK06914 280 short chain dehydrogenase; Provisional 82.95
KOG2912|consensus 419 82.95
PRK09496 453 trkA potassium transporter peripheral membrane com 82.88
KOG1562|consensus 337 82.66
PRK08251 248 short chain dehydrogenase; Provisional 82.43
PRK06949 258 short chain dehydrogenase; Provisional 82.34
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 82.16
PRK05876 275 short chain dehydrogenase; Provisional 82.15
PRK07677 252 short chain dehydrogenase; Provisional 82.11
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 81.77
PRK07035 252 short chain dehydrogenase; Provisional 81.68
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 81.6
PRK06194 287 hypothetical protein; Provisional 81.59
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 81.37
PRK08277 278 D-mannonate oxidoreductase; Provisional 81.13
KOG0022|consensus375 81.12
PRK08340 259 glucose-1-dehydrogenase; Provisional 80.84
PRK07109 334 short chain dehydrogenase; Provisional 80.53
PRK07814 263 short chain dehydrogenase; Provisional 80.37
PRK06181 263 short chain dehydrogenase; Provisional 80.31
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 80.16
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 80.13
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
Probab=99.95  E-value=3.1e-28  Score=191.90  Aligned_cols=153  Identities=35%  Similarity=0.557  Sum_probs=132.4

Q ss_pred             hHHHHHHHHHHcCCCCCHHHHHHHHhCCCCCCCCC----CCCCCCccccCCCCccCcHHHHHHHHHHHhhhCCCCCEEEE
Q psy7826          53 PMEYLVEHLKETLFIESELPYKAMLAVDRGHYTTW----RPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEGKKVLD  128 (213)
Q Consensus        53 ~~~~l~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vLD  128 (213)
                      ++++|++.|++.|.+.++++.++|+.+||+.|+|.    .+|.|.+++++.++++++|.+.+.+++.+  .++++++|||
T Consensus         1 ~~~~lv~~l~~~g~v~~~~v~~A~~~VpR~~Fvp~~~~~~aY~d~~l~i~~~~~is~P~~~a~~l~~L--~l~pg~~VLe   78 (209)
T PF01135_consen    1 SNKALVDNLIRPGDVTDPRVLDAFRAVPREDFVPPAFRDLAYEDRPLPIGCGQTISAPSMVARMLEAL--DLKPGDRVLE   78 (209)
T ss_dssp             CHHHHHHHHHHTTSS-SHHHHHHHHHS-GGGCSSCGGGGGTTSSS-EEEETTEEE--HHHHHHHHHHT--TC-TT-EEEE
T ss_pred             CHHHHHHHHHHcCCCCCHHHHHHHHhCCHHHhCchhhhcCCCCCCCeeecceeechHHHHHHHHHHHH--hcCCCCEEEE
Confidence            35899999999999999999999999999999994    79999999999999999999999999999  6999999999


Q ss_pred             EcCCccHHHHHHHHHcCCCCEEEEEeCChHHHHHHHHHHhhCCCCCccCCCeEEEEcCCCCCCCCCCCcCEEEEcCcCcc
Q psy7826         129 IGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIED  208 (213)
Q Consensus       129 iG~G~G~~t~~la~~~~~~~~v~gvD~s~~~l~~a~~~~~~~gl~~~~~~~v~~~~~d~~~~~~~~~~fD~Ii~~~~~~~  208 (213)
                      +|||+||.|+.++..+++.++|+++|+++..++.|++++..++     ..||.++++|....++..++||+|++++++..
T Consensus        79 IGtGsGY~aAlla~lvg~~g~Vv~vE~~~~l~~~A~~~l~~~~-----~~nv~~~~gdg~~g~~~~apfD~I~v~~a~~~  153 (209)
T PF01135_consen   79 IGTGSGYQAALLAHLVGPVGRVVSVERDPELAERARRNLARLG-----IDNVEVVVGDGSEGWPEEAPFDRIIVTAAVPE  153 (209)
T ss_dssp             ES-TTSHHHHHHHHHHSTTEEEEEEESBHHHHHHHHHHHHHHT-----THSEEEEES-GGGTTGGG-SEEEEEESSBBSS
T ss_pred             ecCCCcHHHHHHHHhcCccceEEEECccHHHHHHHHHHHHHhc-----cCceeEEEcchhhccccCCCcCEEEEeeccch
Confidence            9999999999999999887899999999999999999999988     57999999999888877789999999999999


Q ss_pred             CCCC
Q psy7826         209 IPEG  212 (213)
Q Consensus       209 ~p~~  212 (213)
                      +|..
T Consensus       154 ip~~  157 (209)
T PF01135_consen  154 IPEA  157 (209)
T ss_dssp             --HH
T ss_pred             HHHH
Confidence            8864



1.1.77 from EC) (PCMT) [] (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyses the transfer of a methyl group from S-adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerisation of normal L-aspartyl and L-asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process; PDB: 3LBF_A 1DL5_B 1JG3_B 1JG2_A 1JG1_A 1JG4_A 2YXE_A 2PBF_B 1VBF_C 1R18_A ....

>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>KOG1661|consensus Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>KOG1541|consensus Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG2187|consensus Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>KOG1500|consensus Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>KOG2730|consensus Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG2360|consensus Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>KOG2940|consensus Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>KOG1269|consensus Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>KOG2671|consensus Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>KOG1501|consensus Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>KOG4058|consensus Back     alignment and domain information
>KOG3178|consensus Back     alignment and domain information
>KOG3115|consensus Back     alignment and domain information
>KOG1227|consensus Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>KOG1098|consensus Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1099|consensus Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1331|consensus Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>KOG3045|consensus Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>KOG2651|consensus Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>KOG2782|consensus Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1709|consensus Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG3987|consensus Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>KOG2078|consensus Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] Back     alignment and domain information
>KOG3201|consensus Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>KOG1253|consensus Back     alignment and domain information
>KOG2793|consensus Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PTZ00357 methyltransferase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0822|consensus Back     alignment and domain information
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>KOG2920|consensus Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0821|consensus Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2912|consensus Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>KOG1562|consensus Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
1i1n_A226 Human Protein L-Isoaspartate O-Methyltransferase Wi 2e-34
1r18_A227 Drosophila Protein Isoaspartyl Methyltransferase Wi 9e-26
2pbf_A227 Crystal Structure Of A Putative Protein-L-Isoaspart 1e-17
2yxe_A215 Crystal Structure Of L-Isoaspartyl Protein Carboxyl 1e-11
1jg4_A235 Crystal Structure Of L-Isoaspartyl (D-Aspartyl) O- 1e-09
1dl5_A 317 Protein-L-Isoaspartate O-Methyltransferase Length = 3e-09
3lbf_A210 Crystal Structure Of Protein L-Isoaspartyl Methyltr 7e-08
1vbf_A231 Crystal Structure Of Protein L-Isoaspartate O-Methy 2e-07
>pdb|1I1N|A Chain A, Human Protein L-Isoaspartate O-Methyltransferase With S- Adenosyl Homocysteine Length = 226 Back     alignment and structure

Iteration: 1

Score = 141 bits (356), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 68/157 (43%), Positives = 100/157 (63%) Query: 57 LVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDL 116 L+ +L++ I+++ ++ MLA DR HY PY + +IG+ A + AP A L+ L Sbjct: 12 LIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELL 71 Query: 117 SEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVK 176 ++L EG K LD+GSG+G TA A VG TGKVIGI+HI +LV + +NV +P + Sbjct: 72 FDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLS 131 Query: 177 DGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGI 213 GR++ V+GDGR GY +EAPYD IHVG + +P+ + Sbjct: 132 SGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQAL 168
>pdb|1R18|A Chain A, Drosophila Protein Isoaspartyl Methyltransferase With S-Adenosyl-L- Homocysteine Length = 227 Back     alignment and structure
>pdb|2PBF|A Chain A, Crystal Structure Of A Putative Protein-L-Isoaspartate O- Methyltransferase Beta-Aspartate Methyltransferase (Pcmt) From Plasmodium Falciparum In Complex With S-Adenosyl-L-Homocysteine Length = 227 Back     alignment and structure
>pdb|2YXE|A Chain A, Crystal Structure Of L-Isoaspartyl Protein Carboxyl Methyltranferase Length = 215 Back     alignment and structure
>pdb|1JG4|A Chain A, Crystal Structure Of L-Isoaspartyl (D-Aspartyl) O- Methyltransferase With S-Adenosylmethionine Length = 235 Back     alignment and structure
>pdb|1DL5|A Chain A, Protein-L-Isoaspartate O-Methyltransferase Length = 317 Back     alignment and structure
>pdb|3LBF|A Chain A, Crystal Structure Of Protein L-Isoaspartyl Methyltransferase From Escherichia Coli Length = 210 Back     alignment and structure
>pdb|1VBF|A Chain A, Crystal Structure Of Protein L-Isoaspartate O-Methyltransferase Homologue From Sulfolobus Tokodaii Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query213
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 2e-52
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 7e-49
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 3e-45
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 3e-42
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 9e-40
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 7e-36
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 6e-33
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 9e-33
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 2e-11
3dh0_A219 SAM dependent methyltransferase; cystal structure, 3e-11
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 3e-11
3f4k_A 257 Putative methyltransferase; structural genomics, P 3e-11
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 8e-11
3ocj_A 305 Putative exported protein; structural genomics, PS 1e-10
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 1e-10
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 2e-10
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 2e-10
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 6e-10
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 8e-10
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 4e-09
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 1e-08
2b25_A 336 Hypothetical protein; structural genomics, methyl 2e-08
1yb2_A275 Hypothetical protein TA0852; structural genomics, 2e-08
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 3e-08
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 4e-08
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 6e-08
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 7e-08
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 1e-07
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 1e-07
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 1e-07
3ll7_A 410 Putative methyltransferase; methytransferase, stru 2e-07
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 2e-07
3m33_A226 Uncharacterized protein; structural genomics, PSI- 2e-07
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 2e-07
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 2e-07
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 3e-07
3i9f_A170 Putative type 11 methyltransferase; structural gen 3e-07
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 3e-07
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 4e-07
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 5e-07
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 5e-07
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 1e-06
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 2e-06
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 2e-06
3ege_A 261 Putative methyltransferase from antibiotic biosyn 3e-06
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 3e-06
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 3e-06
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 3e-06
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 4e-06
3lpm_A 259 Putative methyltransferase; structural genomics, p 7e-06
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 7e-06
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 1e-05
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 1e-05
2p7i_A 250 Hypothetical protein; putative methyltransferase, 1e-05
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 1e-05
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 2e-05
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 3e-05
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 4e-05
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 4e-05
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 5e-05
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 6e-05
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 7e-05
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 8e-05
3hnr_A220 Probable methyltransferase BT9727_4108; structural 8e-05
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 9e-05
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 9e-05
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 9e-05
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 1e-04
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 1e-04
2avd_A229 Catechol-O-methyltransferase; structural genomics, 1e-04
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 1e-04
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 1e-04
1vlm_A219 SAM-dependent methyltransferase; possible histamin 1e-04
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 1e-04
1xxl_A 239 YCGJ protein; structural genomics, protein structu 1e-04
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 2e-04
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 2e-04
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 2e-04
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 2e-04
3cc8_A 230 Putative methyltransferase; structural genomics, j 2e-04
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 2e-04
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 2e-04
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 3e-04
3duw_A223 OMT, O-methyltransferase, putative; alternating of 3e-04
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 3e-04
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 4e-04
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 4e-04
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 4e-04
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 4e-04
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 4e-04
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 4e-04
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 5e-04
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 8e-04
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 9e-04
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 9e-04
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Length = 226 Back     alignment and structure
 Score =  166 bits (424), Expect = 2e-52
 Identities = 68/155 (43%), Positives = 99/155 (63%)

Query: 57  LVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDL 116
           L+ +L++   I+++  ++ MLA DR HY    PY +   +IG+ A + AP   A  L+ L
Sbjct: 12  LIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELL 71

Query: 117 SEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVK 176
            ++L EG K LD+GSG+G  TA  A  VG TGKVIGI+HI +LV  + +NV   +P  + 
Sbjct: 72  FDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLS 131

Query: 177 DGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPE 211
            GR++ V+GDGR GY +EAPYD IHVG +   +P+
Sbjct: 132 SGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQ 166


>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Length = 227 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Length = 227 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Length = 215 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Length = 235 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Length = 231 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Length = 210 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Length = 317 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Length = 255 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Length = 336 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Length = 410 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} Length = 204 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Length = 248 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Length = 237 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Length = 233 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Length = 433 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Length = 247 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Length = 229 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Length = 241 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} Length = 225 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Length = 242 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Length = 299 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Length = 221 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Length = 223 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Length = 425 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4er3_A* 3sr4_A* Length = 438 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Length = 232 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Length = 239 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* Length = 312 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.9
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.89
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.88
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.87
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.84
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.83
1ixk_A 315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.83
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.8
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.79
2yxl_A 450 PH0851 protein, 450AA long hypothetical FMU protei 99.79
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.75
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.75
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.74
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.71
2b9e_A 309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.71
3ajd_A 274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.68
4gek_A 261 TRNA (CMO5U34)-methyltransferase; structural genom 99.62
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 99.56
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.54
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.53
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 99.53
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.52
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.52
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.52
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.52
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 99.51
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.51
1xxl_A 239 YCGJ protein; structural genomics, protein structu 99.5
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 99.5
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.5
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.5
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.49
3f4k_A 257 Putative methyltransferase; structural genomics, P 99.48
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.48
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.48
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.48
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.47
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.47
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 99.46
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 99.46
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.46
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.45
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.45
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.45
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.45
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.44
2b25_A 336 Hypothetical protein; structural genomics, methyl 99.44
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.44
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 99.43
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 99.42
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 99.42
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.42
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.42
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.42
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.42
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.42
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.42
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.42
2h00_A254 Methyltransferase 10 domain containing protein; st 99.42
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.41
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 99.41
3ocj_A 305 Putative exported protein; structural genomics, PS 99.41
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.41
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.41
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.41
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.41
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 99.4
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 99.4
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 99.39
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 99.39
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.39
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.39
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.39
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.38
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.38
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.38
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.38
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.38
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.38
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.37
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.37
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.37
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.37
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 99.37
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.36
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 99.36
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.36
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.36
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.36
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 99.36
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.35
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.35
2p7i_A 250 Hypothetical protein; putative methyltransferase, 99.35
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.35
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.35
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.35
3ege_A 261 Putative methyltransferase from antibiotic biosyn 99.35
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 99.35
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.35
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.35
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.34
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.34
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.34
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.34
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.33
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.33
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.33
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.32
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 99.32
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.32
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.32
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.32
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.32
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.32
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.32
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 99.32
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.32
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.32
3lpm_A 259 Putative methyltransferase; structural genomics, p 99.32
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.32
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.32
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 99.31
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 99.31
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.31
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.31
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.31
3lcc_A235 Putative methyl chloride transferase; halide methy 99.31
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.3
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.3
4fzv_A 359 Putative methyltransferase NSUN4; mterf fold, meth 99.3
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.3
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.3
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.3
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.3
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 99.29
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.29
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.29
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.29
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.29
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.28
3k6r_A278 Putative transferase PH0793; structural genomics, 99.28
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 99.28
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 99.28
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.28
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.27
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 99.26
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.26
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.26
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.26
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.26
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.26
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 99.25
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 99.25
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.25
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.24
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.24
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.24
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 99.24
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.24
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 99.23
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.23
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.23
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.23
2vdv_E 246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.23
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 99.23
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.22
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.22
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 99.22
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.21
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 99.21
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.21
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.21
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.21
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.2
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.2
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.2
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 99.19
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 99.19
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.19
2qm3_A 373 Predicted methyltransferase; putative methyltransf 99.19
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.18
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.18
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 99.18
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; R 99.18
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.18
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.17
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 99.17
3mq2_A 218 16S rRNA methyltransferase; methyltranferase, ribo 99.17
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.17
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.17
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.17
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.17
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.16
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.16
3adn_A 294 Spermidine synthase; aminopropyltransferase, polya 99.15
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 99.15
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.14
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 99.14
3p2e_A 225 16S rRNA methylase; methyltransferase, transferase 99.14
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 99.14
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.14
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 99.12
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.12
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.12
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.12
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.11
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 99.11
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.1
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.1
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.09
3bzb_A 281 Uncharacterized protein; RED ALGA, protein structu 99.08
2f8l_A 344 Hypothetical protein LMO1582; structural genomics, 99.08
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.08
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 99.08
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 99.08
3ll7_A 410 Putative methyltransferase; methytransferase, stru 99.08
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 99.08
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.07
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 99.07
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.06
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.05
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.04
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.04
1xj5_A 334 Spermidine synthase 1; structural genomics, protei 99.04
3cc8_A 230 Putative methyltransferase; structural genomics, j 99.04
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.04
3bwc_A 304 Spermidine synthase; SAM, SGPP, structura genomics 99.04
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.04
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.03
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.03
1iy9_A 275 Spermidine synthase; rossmann fold, structural gen 99.02
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 99.02
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 99.02
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.01
1mjf_A 281 Spermidine synthase; spermidine synthetase, struct 99.01
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 99.0
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 98.99
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 98.99
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.99
1inl_A 296 Spermidine synthase; beta-barrel, rossman fold, st 98.98
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 98.97
2o07_A 304 Spermidine synthase; structural genomics, structur 98.96
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.96
2i7c_A 283 Spermidine synthase; transferase, structural genom 98.96
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.95
2b2c_A 314 Spermidine synthase; beta-alpha, transferase; 2.50 98.95
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.95
2pt6_A 321 Spermidine synthase; transferase, structural genom 98.95
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.94
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.93
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.91
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.9
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.88
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.88
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.85
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.84
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.84
2oxt_A 265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.83
2cmg_A 262 Spermidine synthase; transferase, putrescine amino 98.82
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.82
2wa2_A 276 Non-structural protein 5; transferase, S-adenosyl- 98.82
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.81
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 98.8
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.79
3lkd_A 542 Type I restriction-modification system methyltrans 98.78
3sso_A 419 Methyltransferase; macrolide, natural product, ros 98.77
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 98.74
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.74
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.73
3khk_A 544 Type I restriction-modification system methylation 98.71
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.71
3opn_A 232 Putative hemolysin; structural genomics, PSI-2, pr 98.69
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 98.66
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.65
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 98.58
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.57
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 98.51
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 98.48
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.46
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.45
3ufb_A 530 Type I restriction-modification system methyltran 98.4
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.34
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.33
3o4f_A 294 Spermidine synthase; aminopropyltransferase, polya 98.27
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 98.17
2px2_A 269 Genome polyprotein [contains: capsid protein C (co 98.12
3gcz_A 282 Polyprotein; flavivirus, RNA capping, methyltransf 98.11
2zig_A297 TTHA0409, putative modification methylase; methylt 98.1
3evf_A 277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.1
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 98.06
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 98.04
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 98.02
3p8z_A 267 Mtase, non-structural protein 5; methyltransferase 97.95
3lkz_A 321 Non-structural protein 5; flavivirus, methyltransf 97.84
3eld_A 300 Methyltransferase; flavivirus, RNA capping, guanyl 97.7
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 97.67
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 97.58
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 97.47
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 97.47
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 97.36
3r24_A 344 NSP16, 2'-O-methyl transferase; methyltransferase, 97.2
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 97.2
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 97.17
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 96.93
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 96.9
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 96.88
2oo3_A 283 Protein involved in catabolism of external DNA; st 96.7
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 96.35
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 96.19
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 96.18
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 96.15
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 96.09
1zkd_A 387 DUF185; NESG, RPR58, structural genomics, PSI, pro 96.05
3me5_A 482 Cytosine-specific methyltransferase; structural ge 95.62
4f3n_A 432 Uncharacterized ACR, COG1565 superfamily; structur 95.59
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 94.76
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 93.66
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 93.56
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 92.86
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 92.84
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 92.82
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 92.76
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 92.66
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 92.63
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 92.16
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 92.02
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 91.72
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 91.66
4dkj_A 403 Cytosine-specific methyltransferase; CG-specificit 91.28
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 91.13
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 91.11
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 91.0
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 90.84
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 90.78
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 90.74
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 90.74
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 90.65
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 90.54
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 90.43
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 90.24
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 90.2
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 90.16
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 90.06
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 90.01
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 89.98
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 89.97
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 89.84
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 89.74
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 89.7
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 89.65
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 89.64
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 89.36
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 89.34
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 89.33
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 89.29
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 89.24
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 89.22
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 89.09
2jah_A 247 Clavulanic acid dehydrogenase; short-chain dehydro 89.03
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 88.99
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 88.98
3rih_A 293 Short chain dehydrogenase or reductase; structural 88.84
3imf_A 257 Short chain dehydrogenase; structural genomics, in 88.84
3f1l_A 252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 88.83
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 88.82
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 88.81
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 88.76
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 88.75
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 88.72
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 88.7
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 88.66
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 88.66
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 88.61
3l77_A 235 Short-chain alcohol dehydrogenase; oxidoreductase; 88.6
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 88.59
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 88.58
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 88.53
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 88.49
4f6c_A 427 AUSA reductase domain protein; thioester reductase 88.47
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 88.32
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 88.14
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 88.13
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 87.96
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 87.92
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 87.91
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 87.72
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 87.71
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 87.57
1rjd_A 334 PPM1P, carboxy methyl transferase for protein phos 87.55
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 87.52
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 87.45
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 87.35
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 87.22
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 87.21
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 87.13
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 87.05
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 87.0
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 86.95
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 86.8
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 86.77
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 86.71
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 86.58
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 86.52
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 86.38
3cxt_A 291 Dehydrogenase with different specificities; rossma 86.31
1xq1_A 266 Putative tropinone reducatse; structural genomics, 86.02
3gms_A 340 Putative NADPH:quinone reductase; structural genom 85.81
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 85.77
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 85.75
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 85.68
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 85.67
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 85.64
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 85.63
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 85.63
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 85.48
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 85.44
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 85.33
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 85.31
3vyw_A 308 MNMC2; tRNA wobble uridine, modification enzyme, g 85.15
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 85.07
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 85.04
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 84.96
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 84.95
1xkq_A 280 Short-chain reductase family member (5D234); parra 84.95
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 84.9
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 84.86
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 84.85
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 84.8
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 84.78
2uvd_A 246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 84.72
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 84.64
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 84.54
3nyw_A 250 Putative oxidoreductase; fatty acid synthesis,3-ox 84.3
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 84.25
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 84.16
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 84.07
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 83.94
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 83.9
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 83.81
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 83.73
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 83.72
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 83.71
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 83.71
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 83.66
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 83.58
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 83.47
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 83.4
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 83.36
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 83.31
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 83.29
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 82.97
1xhl_A 297 Short-chain dehydrogenase/reductase family member 82.95
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 82.92
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 82.91
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 82.78
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 82.6
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 82.52
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 82.49
1lss_A140 TRK system potassium uptake protein TRKA homolog; 82.38
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 82.37
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 82.29
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 82.25
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 82.24
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 82.17
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 82.0
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 81.99
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 81.97
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 81.94
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 81.57
4dqx_A 277 Probable oxidoreductase protein; structural genomi 81.34
4g65_A 461 TRK system potassium uptake protein TRKA; structur 81.33
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 81.31
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 81.2
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 81.18
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 81.18
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 81.11
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 81.0
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 80.97
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 80.97
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 80.84
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 80.61
4eye_A342 Probable oxidoreductase; structural genomics, niai 80.56
4g65_A 461 TRK system potassium uptake protein TRKA; structur 80.54
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 80.44
3l6e_A 235 Oxidoreductase, short-chain dehydrogenase/reducta; 80.35
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 80.33
1spx_A 278 Short-chain reductase family member (5L265); paral 80.26
2bd0_A 244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 80.22
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 80.06
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
Probab=99.90  E-value=7.7e-23  Score=162.29  Aligned_cols=168  Identities=36%  Similarity=0.621  Sum_probs=142.8

Q ss_pred             cccCCCCchhHHHHHHHHHHcCCCCCHHHHHHHHhCCCCCCCCCCCCCCCccccCCCCccCcHHHHHHHHHHHhhhCCCC
Q psy7826          44 HKGTKMEKKPMEYLVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEG  123 (213)
Q Consensus        44 ~~~~~~~~~~~~~l~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  123 (213)
                      ++.++..+.++++|++.|++.|++.++++.+++..++|+.|.+...|.+.++++++++.+++|.+.+.+++.+...+.++
T Consensus         6 ~m~~~~~~~~~~~l~~~l~~~~~~~~~~~~~a~~~~~r~~f~~~~~y~d~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~   85 (227)
T 1r18_A            6 HMAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKPG   85 (227)
T ss_dssp             CCCCCCBCSSHHHHHHHHHHTTSCCCHHHHHHHHTSCGGGTCSSCTTBSSCEEEETTEEECCHHHHHHHHHHTTTTCCTT
T ss_pred             eeeeecCccHHHHHHHHHHhcCCCCCHHHHHHHHhCCHHHcCCcccccCCCcccCCCCccCChHHHHHHHHHHHhhCCCC
Confidence            55667778888999999999998899999999999999999998899999999999999999999999999885457788


Q ss_pred             CEEEEEcCCccHHHHHHHHHcCC-----CCEEEEEeCChHHHHHHHHHHhhCCCCCccCCCeEEEEcCCCCCCCCCCCcC
Q psy7826         124 KKVLDIGSGNGYFTALLAWCVGK-----TGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYD  198 (213)
Q Consensus       124 ~~vLDiG~G~G~~t~~la~~~~~-----~~~v~gvD~s~~~l~~a~~~~~~~gl~~~~~~~v~~~~~d~~~~~~~~~~fD  198 (213)
                      .+|||+|||+|+.+..+++.++.     .++|+++|+++.+++.+++++...+...+...+++++++|....++..++||
T Consensus        86 ~~VLdiG~G~G~~~~~la~~~~~~~~~~~~~v~~vD~~~~~~~~a~~~~~~~~~~~~~~~~v~~~~~d~~~~~~~~~~fD  165 (227)
T 1r18_A           86 ARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYN  165 (227)
T ss_dssp             CEEEEESCTTSHHHHHHHHHHHHSCCCTTCEEEEEESCHHHHHHHHHHHHHHHHHHHHHTSEEEEESCGGGCCGGGCSEE
T ss_pred             CEEEEECCCccHHHHHHHHhcccccCCccCEEEEEEcCHHHHHHHHHHHHhcCccccCCCceEEEECCcccCCCcCCCcc
Confidence            99999999999999999997642     3599999999999999999987643000001479999999987555446899


Q ss_pred             EEEEcCcCccCCC
Q psy7826         199 IIHVGGSIEDIPE  211 (213)
Q Consensus       199 ~Ii~~~~~~~~p~  211 (213)
                      +|+++.+++++++
T Consensus       166 ~I~~~~~~~~~~~  178 (227)
T 1r18_A          166 AIHVGAAAPDTPT  178 (227)
T ss_dssp             EEEECSCBSSCCH
T ss_pred             EEEECCchHHHHH
Confidence            9999999988764



>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 213
d1i1na_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 3e-27
d1r18a_223 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 2e-25
d2b25a1 324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 4e-11
d1i9ga_264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 9e-11
d1jg1a_215 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 4e-10
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 1e-09
d1vbfa_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 6e-09
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 9e-09
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 1e-06
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 4e-06
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 7e-06
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 9e-06
d2gh1a1 281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 2e-05
d2fyta1 311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 2e-05
d1dl5a1213 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methylt 3e-05
d1vl5a_ 231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 8e-05
d2g72a1 263 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltr 1e-04
d1nw3a_328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 5e-04
d1oria_ 316 c.66.1.6 (A:) Protein arginine N-methyltransferase 5e-04
d1xxla_ 234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 5e-04
d1nkva_ 245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 0.001
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 0.002
d1xvaa_ 292 c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra 0.002
d1g6q1_ 328 c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba 0.004
d1ri5a_ 252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 0.004
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  101 bits (252), Expect = 3e-27
 Identities = 68/155 (43%), Positives = 99/155 (63%)

Query: 57  LVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDL 116
           L+ +L++   I+++  ++ MLA DR HY    PY +   +IG+ A + AP   A  L+ L
Sbjct: 11  LIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELL 70

Query: 117 SEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVK 176
            ++L EG K LD+GSG+G  TA  A  VG TGKVIGI+HI +LV  + +NV   +P  + 
Sbjct: 71  FDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLS 130

Query: 177 DGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPE 211
            GR++ V+GDGR GY +EAPYD IHVG +   +P+
Sbjct: 131 SGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQ 165


>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 223 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 215 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Length = 224 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query213
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.97
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.96
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.95
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.93
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.9
d1ixka_ 313 Hypothetical methyltransferase PH1374 {Archaeon Py 99.8
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 99.76
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.72
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.69
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.68
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.68
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.66
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.65
d2b9ea1 293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 99.64
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 99.63
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.6
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.6
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.58
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.58
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.56
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.55
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.53
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.53
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.52
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.5
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.5
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.49
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.48
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.48
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.48
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 99.45
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.43
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.43
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.42
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.41
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 99.4
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.4
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.39
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.38
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.38
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.34
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.34
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.34
d2h00a1250 Methyltransferase 10 domain containing protein MET 99.32
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.31
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.31
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.29
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.27
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.26
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.23
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.21
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.2
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 99.2
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.19
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.19
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.19
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.18
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.18
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.18
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 99.16
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.14
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 99.14
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.14
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.11
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 99.11
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 99.1
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.1
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 99.1
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.08
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 99.06
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.05
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.92
d1yuba_ 245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.87
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 98.81
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.75
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.75
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.74
d2f8la1 328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.65
d1qyra_ 252 High level kasugamycin resistance protein KsgA {Es 98.59
d2ih2a1 223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.52
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.51
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.46
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 98.43
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 98.37
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 98.3
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.19
d1mjfa_ 276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.19
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.15
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 98.13
d1iy9a_ 274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.06
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 98.05
d1inla_ 295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.01
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.98
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.95
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 97.91
d2b2ca1 312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.9
d1xj5a_ 290 Spermidine synthase {Thale cress (Arabidopsis thal 97.87
d2o07a1 285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.86
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.8
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.79
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.79
d2p41a1 257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.23
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 96.76
d1zkda1 365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 96.65
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 96.63
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.61
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 96.45
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 96.44
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 96.37
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 96.16
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.1
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 96.07
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.01
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.89
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.82
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.59
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.59
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 94.56
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 94.4
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.22
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.15
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.88
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 93.65
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.59
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 93.52
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.45
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 93.36
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.28
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 93.2
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 93.12
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 92.95
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 92.67
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 92.62
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 92.62
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 92.62
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 92.54
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 92.52
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 92.44
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.3
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 92.17
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 92.04
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 91.9
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 91.79
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 91.45
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 90.49
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 90.43
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 90.36
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 90.25
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 90.05
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 89.78
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 89.76
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 89.68
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 89.67
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 89.55
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 89.36
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 89.04
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 88.47
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 88.34
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 88.21
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 88.05
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 87.76
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 87.62
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 87.37
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 87.06
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 86.75
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 86.69
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 86.68
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 86.45
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 86.25
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 86.17
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 85.68
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 85.62
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 85.04
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 84.7
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 83.48
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 83.3
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 82.91
d1m6ex_ 359 Salicylic acid carboxyl methyltransferase (SAMT) { 82.89
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 82.1
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 82.03
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 81.9
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 81.81
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 81.25
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 80.76
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 80.31
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 80.25
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 80.15
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 80.04
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=7.5e-31  Score=206.83  Aligned_cols=165  Identities=42%  Similarity=0.740  Sum_probs=150.1

Q ss_pred             CCCchhHHHHHHHHHHcCCCCCHHHHHHHHhCCCCCCCCCCCCCCCccccCCCCccCcHHHHHHHHHHHhhhCCCCCEEE
Q psy7826          48 KMEKKPMEYLVEHLKETLFIESELPYKAMLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQQAMVLDDLSEELTEGKKVL  127 (213)
Q Consensus        48 ~~~~~~~~~l~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vL  127 (213)
                      .+++.++++|++.|++.|++.++++.++|+.+||+.|+|..+|.|.+++++.++++++|.+.+.+++.|...+++|++||
T Consensus         2 ~s~~~~~~~mv~~l~~~g~i~~~~v~~a~~~vpRe~Fvp~~aY~D~~l~i~~~~~is~P~~~a~~le~L~~~l~~g~~VL   81 (224)
T d1i1na_           2 KSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKAL   81 (224)
T ss_dssp             CCCCSSHHHHHHHHHHTTSCCSHHHHHHHHTSCGGGTCSSCTTSSSCEEEETTEEECCHHHHHHHHHHTTTTSCTTCEEE
T ss_pred             CCCcccHHHHHHHHHHcCCCCCHHHHHHHHhCCHHHcCCcccCCCCCccccchhhhhhhHHHHHHHHHHhhccCCCCeEE
Confidence            45667789999999999999999999999999999999999999999999999999999999999999976789999999


Q ss_pred             EEcCCccHHHHHHHHHcCCCCEEEEEeCChHHHHHHHHHHhhCCCCCccCCCeEEEEcCCCCCCCCCCCcCEEEEcCcCc
Q psy7826         128 DIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIE  207 (213)
Q Consensus       128 DiG~G~G~~t~~la~~~~~~~~v~gvD~s~~~l~~a~~~~~~~gl~~~~~~~v~~~~~d~~~~~~~~~~fD~Ii~~~~~~  207 (213)
                      |+|||+|+.|..+|+.+++.++|+++|+++++++.|++++++.++..+...++.++++|+...+++.++||+|+++++++
T Consensus        82 diG~GsGy~ta~la~l~~~~g~V~~ie~~~~l~~~a~~~l~~~~~~~~~~~~~~~~~gD~~~~~~~~~~fD~I~~~~~~~  161 (224)
T d1i1na_          82 DVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAP  161 (224)
T ss_dssp             EETCTTSHHHHHHHHHHCTTCEEEEEESCHHHHHHHHHHHHHHCTHHHHTSSEEEEESCGGGCCGGGCCEEEEEECSBBS
T ss_pred             EecCCCCHHHHHHHHHhCCCceEEEEcCCHHHHHHHHHhccccCcccccccceEEEEeecccccchhhhhhhhhhhcchh
Confidence            99999999999999998888999999999999999999998766432234689999999987777777999999999999


Q ss_pred             cCCCC
Q psy7826         208 DIPEG  212 (213)
Q Consensus       208 ~~p~~  212 (213)
                      ++|+.
T Consensus       162 ~ip~~  166 (224)
T d1i1na_         162 VVPQA  166 (224)
T ss_dssp             SCCHH
T ss_pred             hcCHH
Confidence            99864



>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure