Psyllid ID: psy7864

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
NLLPSERKKLLNKQKKAKRKELEKANAIAAAQEKREQHNKARQQTNNQDNDTDTPQQDELIPDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWALDPKNPTLHTCLIRLALFIEQMKGAEGDVHPAVWEVLKSGLEPIMGSKPALELNASYLKENASHLPALLCEVALSSEVGFQNR
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHcHHHccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccc
NLLPSERKKLLNKQKKAKRKELEKANAIAAAQEKREQHNKARqqtnnqdndtdtpqqdelipdklakteepLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRawaldpknptlHTCLIRLALFIEQmkgaegdvhPAVWEVLKSglepimgskpalELNASYLKENASHLPALLCEVALssevgfqnr
nllpserkkllnkqkkakrkELEKANAIAAAQEKREQHNkarqqtnnqdndtdtpqqDELIPDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWaldpknptLHTCLIRLALFIEQMKGAEGDVHPAVWEVLKSGLEPIMGSKPALELNASYLKENASHLPALLCEVAlssevgfqnr
NLLPSerkkllnkqkkakrkelekanaIAAAQEKREQHNKARqqtnnqdndtdtpqqdELIPDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWALDPKNPTLHTCLIRLALFIEQMKGAEGDVHPAVWEVLKSGLEPIMGSKPALELNASYLKENASHLPALLCEVALSSEVGFQNR
**************************************************************************AVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWALDPKNPTLHTCLIRLALFIEQMKGAEGDVHPAVWEVLKSGLEPIMGSKPALELNASYLKENASHLPALLCEVAL*********
*****ER******************************************************PDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWALDPKNPTLHTCLIRLALFI*************VWEVLKSGLEPIMGSKPALELNASYLKENASHLPALLCEVAL**E******
NLLPSERKKLL********************************************QQDELIPDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWALDPKNPTLHTCLIRLALFIEQMKGAEGDVHPAVWEVLKSGLEPIMGSKPALELNASYLKENASHLPALLCEVALSSEVGFQNR
*****ER*K*LNKQKKAK**************************************QDELIPDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWALDPKNPTLHTCLIRLALFIEQMKGAEGDVHPAVWEVLKSGLEPIMGSKPALELNASYLKENASHLPALLCEVALSSEVGF***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NLLPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTDTPQQDELIPDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWALDPKNPTLHTCLIRLALFIEQMKGAEGDVHPAVWEVLKSGLEPIMGSKPALELNASYLKENASHLPALLCEVALSSEVGFQNR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query201 2.2.26 [Sep-21-2011]
Q9DBB4864 N-alpha-acetyltransferase yes N/A 0.870 0.202 0.395 1e-29
Q6N069864 N-alpha-acetyltransferase yes N/A 0.870 0.202 0.416 2e-29
Q80UM3865 N-alpha-acetyltransferase no N/A 0.880 0.204 0.434 1e-28
Q5R4J9866 N-alpha-acetyltransferase no N/A 0.885 0.205 0.429 2e-28
Q9BXJ9866 N-alpha-acetyltransferase no N/A 0.885 0.205 0.429 2e-28
>sp|Q9DBB4|NAA16_MOUSE N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Mus musculus GN=Naa16 PE=2 SV=1 Back     alignment and function desciption
 Score =  129 bits (325), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 76/192 (39%), Positives = 117/192 (60%), Gaps = 17/192 (8%)

Query: 1   NLLPSERKKLLNKQKKAKRKELEKANAIAAAQEKREQHNKARQQTNNQDN-----DTDTP 55
           NL   E KK+L+KQ++A++K        A  +E+R+   + RQQ N +       +  + 
Sbjct: 586 NLSAKEMKKMLSKQRRAQKK--------AKVEEERKHTERERQQKNQKKKREEEEEVTSG 637

Query: 56  QQDELIPDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKR 115
            ++ELIP+KL + + PLE+A+KFL+PL+ LA + I+THL+AFEIYFR+ K LLMLQSVKR
Sbjct: 638 HKEELIPEKLERVDNPLEEAIKFLTPLKTLAAESIDTHLLAFEIYFRKGKFLLMLQSVKR 697

Query: 116 AWALDPKNPTLHTCLIRLALFIEQMKGAEGDVHPAVWEVLKSGLEPIMGSKPALELNASY 175
           A+A++  NP LH CLI+ +  +        ++   V +VL   ++ I  +K     N  +
Sbjct: 698 AFAIESNNPWLHECLIKFSKSVSN----HSNLPDIVSKVLAQEMKKIFVNKDLHSFNEDF 753

Query: 176 LKENASHLPALL 187
           L+ NA+ L  LL
Sbjct: 754 LRHNATSLQHLL 765
May belong to a complex displaying N-terminal acetyltransferase activity.
Mus musculus (taxid: 10090)
>sp|Q6N069|NAA16_HUMAN N-alpha-acetyltransferase 16, NatA auxiliary subunit OS=Homo sapiens GN=NAA16 PE=1 SV=2 Back     alignment and function description
>sp|Q80UM3|NAA15_MOUSE N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Mus musculus GN=Naa15 PE=1 SV=1 Back     alignment and function description
>sp|Q5R4J9|NAA15_PONAB N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Pongo abelii GN=NAA15 PE=2 SV=1 Back     alignment and function description
>sp|Q9BXJ9|NAA15_HUMAN N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens GN=NAA15 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
66511128 856 PREDICTED: n-alpha-acetyltransferase 15, 0.885 0.207 0.579 7e-46
380019989 856 PREDICTED: N-alpha-acetyltransferase 15, 0.885 0.207 0.579 8e-46
332025339278 NMDA receptor-regulated 1-like protein [ 0.885 0.640 0.569 7e-45
322794619271 hypothetical protein SINV_09012 [Solenop 0.885 0.656 0.569 2e-44
350417201 856 PREDICTED: N-alpha-acetyltransferase 15, 0.885 0.207 0.569 3e-44
340715008 856 PREDICTED: n-alpha-acetyltransferase 15, 0.885 0.207 0.569 3e-44
91081191 863 PREDICTED: similar to AGAP002284-PA [Tri 0.900 0.209 0.529 3e-43
307202969287 NMDA receptor-regulated protein 1 [Harpe 0.875 0.613 0.563 6e-43
156554300283 PREDICTED: N-alpha-acetyltransferase 16, 0.885 0.628 0.547 4e-42
383855588 861 PREDICTED: N-alpha-acetyltransferase 15, 0.890 0.207 0.531 5e-42
>gi|66511128|ref|XP_394637.2| PREDICTED: n-alpha-acetyltransferase 15, NatA auxiliary subunit-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 109/188 (57%), Positives = 132/188 (70%), Gaps = 10/188 (5%)

Query: 1   NLLPSERKKLLNKQKKAKRK-ELEKANAIAAAQEKREQHNKARQQTNNQDNDTDTPQQDE 59
           NL PSE KKL NKQ+K +RK ELE+  A A AQEKREQHNK+RQQT   D D + P  DE
Sbjct: 585 NLAPSELKKLRNKQRKQRRKAELERQQA-AQAQEKREQHNKSRQQT---DPDLEQPTLDE 640

Query: 60  LIPDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWAL 119
           LIP+KL + E+PLEQA+KFL PLQ LA +RIETHLMAFEIY R+ + LLML+S+KRA  L
Sbjct: 641 LIPEKLERIEDPLEQAIKFLQPLQDLASNRIETHLMAFEIYIRKGRTLLMLRSIKRAHGL 700

Query: 120 DPKNPTLHTCLIRLALFIEQMKGAEGDVHPAVWEVLKSGLEPIMGSKPALELNASYLKEN 179
           DP NP LHTCL+R  L+I +    EG     V EV+K     I  +  A +LNA +LK+N
Sbjct: 701 DPNNPDLHTCLVRFMLYINR-SPLEG----PVGEVVKRQTSGIYSASTATQLNAEFLKKN 755

Query: 180 ASHLPALL 187
            + LP LL
Sbjct: 756 RNSLPHLL 763

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380019989|ref|XP_003693881.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like [Apis florea] Back     alignment and taxonomy information
>gi|332025339|gb|EGI65507.1| NMDA receptor-regulated 1-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322794619|gb|EFZ17627.1| hypothetical protein SINV_09012 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350417201|ref|XP_003491306.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340715008|ref|XP_003396013.1| PREDICTED: n-alpha-acetyltransferase 15, NatA auxiliary subunit-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|91081191|ref|XP_975602.1| PREDICTED: similar to AGAP002284-PA [Tribolium castaneum] gi|270006047|gb|EFA02495.1| hypothetical protein TcasGA2_TC008190 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307202969|gb|EFN82185.1| NMDA receptor-regulated protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|156554300|ref|XP_001602377.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like, partial [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383855588|ref|XP_003703292.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query201
RGD|1310984865 Naa15 "N(alpha)-acetyltransfer 0.606 0.141 0.523 1.1e-26
UNIPROTKB|F1N4V5866 NAA15 "Uncharacterized protein 0.611 0.142 0.523 2.3e-26
FB|FBgn0031020 890 Nat1 "Nat1" [Drosophila melano 0.751 0.169 0.424 2.4e-26
MGI|MGI:1922088865 Naa15 "N(alpha)-acetyltransfer 0.606 0.141 0.515 4.8e-26
UNIPROTKB|F1NVR6852 NAA15 "Uncharacterized protein 0.606 0.143 0.507 5.9e-26
UNIPROTKB|Q9BXJ9866 NAA15 "N-alpha-acetyltransfera 0.611 0.142 0.515 6.1e-26
UNIPROTKB|F1RRD3868 NAA15 "Uncharacterized protein 0.611 0.141 0.515 6.1e-26
UNIPROTKB|Q6N069864 NAA16 "N-alpha-acetyltransfera 0.751 0.174 0.433 5.2e-24
MGI|MGI:1914147864 Naa16 "N(alpha)-acetyltransfer 0.746 0.173 0.409 2.9e-23
ASPGD|ASPL0000013634833 AN3628 [Emericella nidulans (t 0.820 0.198 0.333 2.5e-13
RGD|1310984 Naa15 "N(alpha)-acetyltransferase 15, NatA auxiliary subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 311 (114.5 bits), Expect = 1.1e-26, P = 1.1e-26
 Identities = 66/126 (52%), Positives = 88/126 (69%)

Query:    59 ELIPDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWA 118
             ELIP+KLAK E PLE+A+KFL+PL+ L K++IETHL AFEIYFR++K LLMLQSVKRA+A
Sbjct:   641 ELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETHLFAFEIYFRKEKFLLMLQSVKRAFA 700

Query:   119 LDPKNPTLHTCLIRLALFIEQMKGAEGDVHPAVWEVLKSGLEPIMGSKPALELNASYLKE 178
             +D  +P LH C+IRL   + + K    D+  AV  VLK  +  + G+      N ++LK 
Sbjct:   701 IDSSHPWLHECMIRLFNSVCESK----DLPEAVRTVLKQEMNRLFGATNPKNFNETFLKR 756

Query:   179 NASHLP 184
             N+  LP
Sbjct:   757 NSDSLP 762
GO:0005634 "nucleus" evidence=ISO
GO:0005667 "transcription factor complex" evidence=ISO
GO:0005737 "cytoplasm" evidence=ISO
GO:0006474 "N-terminal protein amino acid acetylation" evidence=ISO
GO:0008080 "N-acetyltransferase activity" evidence=ISO
GO:0008152 "metabolic process" evidence=ISO
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=ISO
GO:0016407 "acetyltransferase activity" evidence=ISO
GO:0043022 "ribosome binding" evidence=ISO
UNIPROTKB|F1N4V5 NAA15 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0031020 Nat1 "Nat1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1922088 Naa15 "N(alpha)-acetyltransferase 15, NatA auxiliary subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVR6 NAA15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BXJ9 NAA15 "N-alpha-acetyltransferase 15, NatA auxiliary subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RRD3 NAA15 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q6N069 NAA16 "N-alpha-acetyltransferase 16, NatA auxiliary subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914147 Naa16 "N(alpha)-acetyltransferase 16, NatA auxiliary subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ASPGD|ASPL0000013634 AN3628 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 7e-36
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information 
 Score =  130 bits (330), Expect = 7e-36
 Identities = 52/116 (44%), Positives = 77/116 (66%), Gaps = 4/116 (3%)

Query: 1   NLLPSERKKLLNKQKKAKRKELEKANAIAAAQEKREQHNKARQQTNNQDNDTDTPQQDEL 60
           NL P+ERKKL  KQ+KA++K  EK  A  AA +K+ +    + +  + +         + 
Sbjct: 405 NLSPAERKKLRKKQRKAEKKA-EKEEAEKAAAKKKAEAAAKKAKGPDGETK---KVDPDP 460

Query: 61  IPDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRA 116
           + +KLA+TE+PLE+A+KFL PL  L+ D IETHL+AFE+Y R++K LL LQ++K A
Sbjct: 461 LGEKLARTEDPLEEAMKFLKPLLQLSPDNIETHLLAFEVYIRKKKYLLALQALKAA 516

This domain family is found in eukaryotes, and is approximately 40 amino acids in length. The family is found in association with pfam07719, pfam00515. There is a single completely conserved residue L that may be functionally important. NARP1 is the mammalian homologue of a yeast N-terminal acetyltransferase that regulates entry into the G(0) phase of the cell cycle. Length = 516

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 201
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.95
KOG1156|consensus700 99.91
KOG1156|consensus 700 98.4
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.39
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.31
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.5
PF1337173 TPR_9: Tetratricopeptide repeat 96.39
PRK15359144 type III secretion system chaperone protein SscB; 96.36
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 96.31
PRK10370198 formate-dependent nitrite reductase complex subuni 96.3
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.21
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.98
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 95.49
PF1342844 TPR_14: Tetratricopeptide repeat 95.46
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 95.19
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 94.86
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 94.83
PRK14574 822 hmsH outer membrane protein; Provisional 94.81
COG4235287 Cytochrome c biogenesis factor [Posttranslational 94.52
TIGR02552135 LcrH_SycD type III secretion low calcium response 94.44
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 94.31
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 94.3
TIGR02552135 LcrH_SycD type III secretion low calcium response 94.16
PF1337173 TPR_9: Tetratricopeptide repeat 94.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 93.52
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 93.44
PRK15359144 type III secretion system chaperone protein SscB; 93.41
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 93.25
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 92.91
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 92.91
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 92.9
PRK12370 553 invasion protein regulator; Provisional 92.5
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 92.36
PRK12370553 invasion protein regulator; Provisional 92.05
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 91.98
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.96
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 91.85
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 91.8
PRK11189296 lipoprotein NlpI; Provisional 91.44
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 91.31
PRK11189296 lipoprotein NlpI; Provisional 91.23
PRK10747398 putative protoheme IX biogenesis protein; Provisio 91.14
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 90.97
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 90.69
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.02
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 89.93
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 89.69
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 89.53
cd00189100 TPR Tetratricopeptide repeat domain; typically con 88.96
PRK10370198 formate-dependent nitrite reductase complex subuni 88.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 88.5
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 87.62
PRK10803263 tol-pal system protein YbgF; Provisional 87.48
KOG1126|consensus638 87.24
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 86.6
PRK11788389 tetratricopeptide repeat protein; Provisional 85.21
PRK02603172 photosystem I assembly protein Ycf3; Provisional 83.44
CHL00033168 ycf3 photosystem I assembly protein Ycf3 83.37
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 83.0
PRK10153517 DNA-binding transcriptional activator CadC; Provis 82.84
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 82.81
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 82.72
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 82.68
PRK11788389 tetratricopeptide repeat protein; Provisional 82.66
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 82.25
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 81.75
PF03704146 BTAD: Bacterial transcriptional activator domain; 81.74
KOG3060|consensus289 81.74
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 80.36
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information 
Probab=99.95  E-value=7.9e-28  Score=227.73  Aligned_cols=111  Identities=48%  Similarity=0.698  Sum_probs=91.6

Q ss_pred             CCCHHHHHHhHHHHHHHHHH-HHHHHHHHHHHHHHHHHhhHhhhhcCCCCCCCCCCCCCCCcchhhccccchHHHHHHhH
Q psy7864           1 NLLPSERKKLLNKQKKAKRK-ELEKANAIAAAQEKREQHNKARQQTNNQDNDTDTPQQDELIPDKLAKTEEPLEQAVKFL   79 (201)
Q Consensus         1 ~ls~~E~KKlr~Kqrka~kK-~~e~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~p~~~d~~GekL~~~~dPLeeA~KfL   79 (201)
                      +||++|.||+++|+||+++| +.+++++ ++.++.+++.+++++..    .+.+.+.|+||+|++|++|+|||++|+|||
T Consensus       406 ~~~~~e~Kk~~kK~kK~~~k~~~~~~~~-~~~~~~~~~~~~~~~~~----~~~~~~~D~Dp~GekL~~t~dPLe~A~kfl  480 (517)
T PF12569_consen  406 NMSAAERKKAKKKAKKAAKKAKKEEAEK-AAKKEPKKQQNKSKKKE----KVEPKKKDDDPLGEKLLKTEDPLEEAMKFL  480 (517)
T ss_pred             cCChHHHHHHHHHHHHHHHHHhHHHHHH-HHhhhhhhhhccccccc----cccCCcCCCCccHHHHhcCCcHHHHHHHHH
Confidence            58999999999999999888 6666655 43333323222222222    345677789999999999999999999999


Q ss_pred             HHHHHHccchHhHhHHhHhHhhhccchhHHHHHHHHH
Q psy7864          80 SPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRA  116 (201)
Q Consensus        80 ~pL~~~a~~~iet~llaFEVy~Rk~K~LLaLqaL~~a  116 (201)
                      +||++++|++++||+++||||+|+||||||||||++|
T Consensus       481 ~pL~~~a~~~~et~~laFeVy~Rk~K~LLaLqaL~kA  517 (517)
T PF12569_consen  481 KPLLELAPDNIETHLLAFEVYLRKGKYLLALQALKKA  517 (517)
T ss_pred             HHHHHhCccchhhHHHHhHHHHhcCcHHHHHHHHHhC
Confidence            9999999999999999999999999999999999986

N-terminal acetylation plays a role in normal eukaryotic translation and processing, protect against proteolytic degradation and protein turnover. NAT1 anchors ARD1 and NAT5 to the ribosome and may present the N- terminal of nascent polypeptides for acetylation [], [].
>KOG1156|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query201
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 47.2 bits (111), Expect = 1e-06
 Identities = 35/216 (16%), Positives = 67/216 (31%), Gaps = 46/216 (21%)

Query: 7   RKKLLNKQKKAKRKELEKAN---------------AIAAAQEKREQHNKARQ----QTNN 47
           R +   K ++A   EL  A                A+      + Q     +       N
Sbjct: 133 RLQPYLKLRQA-LLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKN 191

Query: 48  QDNDTDTPQQDELIPDKLAKTEEPLEQAVKFLSPLQLL---AKDRIETHLMAFEIYFRRQ 104
            ++     +  + +   L + +          S ++L     +  +   L+  + Y   +
Sbjct: 192 CNSPETVLEMLQKL---LYQIDPNWTSRSDHSSNIKLRIHSIQAELR-RLLKSKPY---E 244

Query: 105 KPLLMLQSVKRAWALDPKNPTLHTC--LI--RLALFIEQMKGAEGDVHPAVWEVLKSGLE 160
             LL+L +V+ A A +  N    +C  L+  R     + +  A    H ++ +     L 
Sbjct: 245 NCLLVLLNVQNAKAWNAFN---LSCKILLTTRFKQVTDFLSAATT-THISL-DHHSMTLT 299

Query: 161 PIMGSKPALELNASYLKENASHLPALLCEV---ALS 193
           P         L   YL      LP  +       LS
Sbjct: 300 P----DEVKSLLLKYLDCRPQDLPREVLTTNPRRLS 331

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 97.63
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.41
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.33
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.32
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.07
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.03
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.98
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 96.9
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.87
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.87
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.81
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.79
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.73
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.73
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 96.73
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.7
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.68
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.67
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.64
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.63
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.61
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 96.6
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.58
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.49
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.45
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.42
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.41
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.37
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.3
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 96.28
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 96.27
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.25
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.25
3k9i_A117 BH0479 protein; putative protein binding protein, 96.24
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.2
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.19
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.18
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.17
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.16
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.15
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.1
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.09
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.06
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.85
3k9i_A117 BH0479 protein; putative protein binding protein, 95.85
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.81
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 95.75
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 95.72
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.71
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.71
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.67
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 95.62
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 95.61
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 95.56
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.5
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.5
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.48
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.46
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.43
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 95.41
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 95.4
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.4
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 95.38
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 95.35
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 95.33
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.29
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.27
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 95.23
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 95.23
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 95.22
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 95.22
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 95.19
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 95.12
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 95.11
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 95.06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.04
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 95.04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.03
3q49_B137 STIP1 homology and U box-containing protein 1; E3 95.02
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 95.02
4i17_A228 Hypothetical protein; TPR repeats protein, structu 94.92
2kat_A115 Uncharacterized protein; NESG, structure, structur 94.87
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 94.85
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 94.79
4eqf_A365 PEX5-related protein; accessory protein, tetratric 94.79
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 94.77
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 94.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 94.74
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 94.61
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 94.55
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 94.55
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 94.51
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 94.5
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 94.49
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 94.49
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 94.46
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 94.45
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 94.44
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 94.34
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 94.27
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 94.21
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.18
3u4t_A272 TPR repeat-containing protein; structural genomics 94.1
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 93.99
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 93.88
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 93.82
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 93.81
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 93.69
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 93.59
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 93.58
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 93.58
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 93.37
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 93.35
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 93.33
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 93.21
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 93.21
2gw1_A514 Mitochondrial precursor proteins import receptor; 92.88
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 92.44
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 92.33
2gw1_A514 Mitochondrial precursor proteins import receptor; 92.29
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 92.07
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 91.9
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 91.8
3u4t_A 272 TPR repeat-containing protein; structural genomics 91.77
4g1t_A 472 Interferon-induced protein with tetratricopeptide 91.76
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 91.67
1pc2_A152 Mitochondria fission protein; unknown function; NM 91.64
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 91.09
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 90.7
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 90.58
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 90.39
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 90.09
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 89.99
2l6j_A111 TPR repeat-containing protein associated with HSP; 89.59
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 89.59
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 88.84
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 88.01
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 87.67
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 86.4
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 85.59
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 85.35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 84.83
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 83.88
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 83.88
4g1t_A 472 Interferon-induced protein with tetratricopeptide 83.39
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 83.19
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 82.57
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 82.22
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 80.07
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
Probab=97.63  E-value=0.00064  Score=51.26  Aligned_cols=83  Identities=11%  Similarity=0.067  Sum_probs=69.2

Q ss_pred             hHHHHHHhHHHHHHHccchHhHhHHhHhHhhhccchhHHHHHHHHHhhcCCCCchHHHHHHHHHHHHHhhhCCCCCCChH
Q psy7864          71 PLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWALDPKNPTLHTCLIRLALFIEQMKGAEGDVHPA  150 (201)
Q Consensus        71 PLeeA~KfL~pL~~~a~~~iet~llaFEVy~Rk~K~LLaLqaL~~a~~id~~~P~lh~~~vrf~~~v~~~~~~~~~~~~~  150 (201)
                      =.++|+.++.-.....|++.++|..--.+|.+.|+|-.|+.++.++..++|++|.++..+..+.....   .    .+..
T Consensus        46 ~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~---~----~~~a  118 (150)
T 4ga2_A           46 EYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKND---V----TDGR  118 (150)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHC---S----SSSH
T ss_pred             CHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCchHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcC---C----hHHH
Confidence            37899999999999999999999999999999999999999999999999999999988887765441   1    3445


Q ss_pred             HHHHHhhhhc
Q psy7864         151 VWEVLKSGLE  160 (201)
Q Consensus       151 V~~Vl~~e~~  160 (201)
                      +...++..+.
T Consensus       119 a~~~~~~al~  128 (150)
T 4ga2_A          119 AKYWVERAAK  128 (150)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHH
Confidence            5555555444
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query201
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.46
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.15
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.1
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.05
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.0
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.98
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.97
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.9
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.69
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.66
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.6
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.41
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.4
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.38
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.02
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.0
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.89
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 95.61
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.56
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 95.25
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 95.14
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 94.69
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 94.18
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 92.68
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 91.36
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.98
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 89.88
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 89.79
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 88.94
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 88.17
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 85.23
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 84.72
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 83.76
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 82.43
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor)
species: Trypanosoma brucei [TaxId: 5691]

Probab=97.46  E-value=0.0003  Score=49.69  Aligned_cols=76  Identities=18%  Similarity=0.078  Sum_probs=67.1

Q ss_pred             cchhhccccchHHHHHHhHHHHHHHccchHhHhHHhHhHhhhccchhHHHHHHHHHhhcCCCCchHHHHHHHHHHHH
Q psy7864          61 IPDKLAKTEEPLEQAVKFLSPLQLLAKDRIETHLMAFEIYFRRQKPLLMLQSVKRAWALDPKNPTLHTCLIRLALFI  137 (201)
Q Consensus        61 ~GekL~~~~dPLeeA~KfL~pL~~~a~~~iet~llaFEVy~Rk~K~LLaLqaL~~a~~id~~~P~lh~~~vrf~~~v  137 (201)
                      .|..+.+..+ +++|+.+++-.....|++.++|..--.+|.+.+++-.|+.++.++..++|+++..+..+.......
T Consensus        22 ~g~~~~~~g~-~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~la~~y~~~   97 (112)
T d1hxia_          22 EGLSMLKLAN-LAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARMLDPKDIAVHAALAVSHTNE   97 (112)
T ss_dssp             HHHHHHHTTC-HHHHHHHHHHHHHHSTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhh-hHHHHHHHhhhcccccccchhhhhhhhhhhhhhhHHHhhcccccccccccccccchHHHHHHHHHC
Confidence            3556666555 788999999999999999999999999999999999999999999999999999998877776554
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure