Psyllid ID: psy7896


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------72
MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYELDEEVAALHLEHLGVKLTKLTEDQAKYLDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYEVTTMEEAAKEGGIFVTTTGCKDIIRGEHFLQMRDDAIVCNIGHFDCEIQVSWLDKNAVEKVNVKPQVSPTSRTKHLTTEALLATCNSLFKYSLVNTIHEAPTLLVHLSTDIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVDRYTLPNGNHIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTKHSQYPVGVYMLPKKLDEEVAALHLEHLGVKLTKLTEDQAKYLGLPIEGPYKPDHYRY
cccccccHHHHHHHHHHHHcccHHHHHHHHHcccccccccEEEEEEcHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHccccccccccEEEcccccHHHHHHHHcHHHHcccccccccccHHHHHHHHHHHccccccccccccccccccccEEEcccccHHHHHHHHcccccccccccccccHHHHHcHHHHHHHcccccccEEEcccccEEEccccccccHHHHHHHHHHHHHHHccEEEEEEcccccccHHHHHHHccccEEEEEEccHHHHHHHcccccccccHHHHHccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHcccccEEEEEEcccHHHHHHHccccEEEEHHHHHHcccEEEEcccccccccHHHHHccccccEEEccccccccccHHHHHccccEEEEccccccccccEEEEcccccccccccccccccccccccccccccEEEccccccccccEEEEEcccccHHHHHHHHHHcccccccccEEEEEEEEcHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHccccEEccccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHccccccccEEEcccHHHHHHHHHHHHHcccccccccHHHHHHHccccccccccccccc
EccHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHccccEEEcccccHHHHHHHHHcccEEccEEccEEEEccccHHHHHHHHHcHHHHHHccEEEEccHHHHHHHHHHHHccccccEEEEccccHHHEccEEEEcccHHHHHHHHHcHHHHHHccEEEEccHHHHHHHHHHHHccccccEEEEccccHHHHccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccEEHHHHHHHHHcccccccccccHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccEEccHHHHcccccEEEEcccccccEcHHHHccccccEEEEEcccccccEcHHHHHHHccEEEEEEccEcccccEEEEEEccEEEEccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHccccEEEcccccHHHHHHHHHcccEEEEEcccccEEEEEHHHccHHHHccccccHHHHHHHHHHHHHHHHHHHHcHHHcccEEEcccHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccccccc
MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAevqwsscnifsTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQtlvfpdgkplnmilddggdltnlvhekYPQFLSEIRgiseetttGVHNLYKMFkenklgvpainvndsvtkplnmilddggdltnlvhekYPQFLSEIRgiseetttGVHNLYKMFkenklgvpainvndsvtkskfdnlyGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYELDEEVAALHLEHLGVKLTKLTEDQAKYLDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSrvivteidpinalqasmegyevttMEEAakeggifvtttgckdiirgehflqmRDDAIVcnighfdceiqvswldknavekvnvkpqvsptsrtkhlTTEALLATCNSLFKYSLVNTIHEAPTLLVHLSTDIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAevqwsscnifsTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVdrytlpngnhiILLAEGRLVnlgcamghpsfvmsnsFTNQVLAQIELWtkhsqypvgvymlpkKLDEEVAALHLEHLGVKLTKLTEDQAKylglpiegpykpdhyry
madiklaewgrktiimaeneMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKenklgvpainvndsvtkskfdnlYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYELDEEVAALHLEHLGVKLTKLTEDQAKYLDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYEVTTMEEAAKEGGIFVTTTGCKDIIRGEHFLQMRDDAIVCNIGHFDCEIQVSWLDKNAVEKVnvkpqvsptsrtkhltTEALLATCNSLFKYSLVNTIHEAPTLLVHLSTDIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVDRYTLPNGNHIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTKHSQYPVGVYMLPKKLDEEVAALHLEHLGVKLTKLTEDQAkylglpiegpykpdhyry
MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHaaaaiaargvavyaWKGETDEEYVWCIEQTLVFPDGKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYELDEEVAALHLEHLGVKLTKLTEDQAKYLDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYEVTTMEEAAKEGGIFVTTTGCKDIIRGEHFLQMRDDAIVCNIGHFDCEIQVSWLDKNAVEKVNVKPQVSPTSRTKHLTTEALLATCNSLFKYSLVNTIHEAPTLLVHLSTDIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHaaaaiaargvavyaWKGETDEEYVWCIEQTLVDRYTLPNGNHIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTKHSQYPVGVYMLPKKLDEEVAALHLEHLGVKLTKLTEDQAKYLGLPIEGPYKPDHYRY
*****LAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYELDEEVAALHLEHLGVKLTKLTEDQAKYLDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYEVTTMEEAAKEGGIFVTTTGCKDIIRGEHFLQMRDDAIVCNIGHFDCEIQVSWLDKNAVEKVNVK*********KHLTTEALLATCNSLFKYSLVNTIHEAPTLLVHLSTDIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVDRYTLPNGNHIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTKHSQYPVGVYMLPKKLDEEVAALHLEHLGVKLTKLTEDQAKYLGLPIE**********
MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYELDEEVAALHLEHLGVKLTKLTEDQAKYLDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYEVTTMEEAAKEGGIFVTTTGCKDIIRGEHFLQMRDDAIVCNIGHFDCEIQVSWLDKNAVEKVNVKPQVSPTSRTKHLTTEALLATCNSLFKYSLVNTIHEAPTLLVHLSTDIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVDRYTLPNGNHIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTKHSQYPVGVYMLPKKLDEEVAALHLEHLGVKLTKLTEDQAKYLGLPIEGPYKP***RY
MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYELDEEVAALHLEHLGVKLTKLTEDQAKYLDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYEVTTMEEAAKEGGIFVTTTGCKDIIRGEHFLQMRDDAIVCNIGHFDCEIQVSWLDKNAVEKVNVKPQVSPTSRTKHLTTEALLATCNSLFKYSLVNTIHEAPTLLVHLSTDIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVDRYTLPNGNHIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTKHSQYPVGVYMLPKKLDEEVAALHLEHLGVKLTKLTEDQAKYLGLPIEGPYKPDHYRY
MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYELDEEVAALHLEHLGVKLTKLTEDQAKYLDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYEVTTMEEAAKEGGIFVTTTGCKDIIRGEHFLQMRDDAIVCNIGHFDCEIQVSWLDKNAVEKVNVKPQVSPTSRTKHLTTEALLATCNSLFKYSLVNTIHEAPTLLVHLSTDIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVDRYTLPNGNHIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTKHSQYPVGVYMLPKKLDEEVAALHLEHLGVKLTKLTEDQAKYLGLPIEGPYKPD*Y**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYELDEEVAALHLEHLGVKLTKLTEDQAKYLDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYEVTTMEEAAKEGGIFVTTTGCKDIIRGEHFLQMRDDAIVCNIGHFDCEIQVSWLDKNAVEKVNVKPQVSPTSRTKHLTTEALLATCNSLFKYSLVNTIHEAPTLLVHLSTDIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVDRYTLPNGNHIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVLAQIELWTKHSQYPVGVYMLPKKLDEEVAALHLEHLGVKLTKLTEDQAKYLGLPIEGPYKPDHYRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query718 2.2.26 [Sep-21-2011]
B3EDY3471 Adenosylhomocysteinase OS yes N/A 0.394 0.600 0.593 5e-99
A4SF77471 Adenosylhomocysteinase OS yes N/A 0.401 0.611 0.593 4e-96
Q3B532471 Adenosylhomocysteinase OS yes N/A 0.394 0.600 0.593 7e-96
Q01VU1475 Adenosylhomocysteinase OS yes N/A 0.395 0.597 0.592 2e-95
Q3AQC2471 Adenosylhomocysteinase OS yes N/A 0.417 0.636 0.566 2e-95
B4SD43471 Adenosylhomocysteinase OS yes N/A 0.399 0.609 0.590 3e-94
Q8KEG8471 Adenosylhomocysteinase OS yes N/A 0.394 0.600 0.578 3e-94
Q82DC9485 Adenosylhomocysteinase OS yes N/A 0.444 0.657 0.522 4e-94
B3QMF5471 Adenosylhomocysteinase OS yes N/A 0.394 0.600 0.581 5e-94
Q9KZM1485 Adenosylhomocysteinase OS yes N/A 0.447 0.661 0.528 5e-93
>sp|B3EDY3|SAHH_CHLL2 Adenosylhomocysteinase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=ahcY PE=3 SV=1 Back     alignment and function desciption
 Score =  362 bits (930), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 233/320 (72%), Gaps = 37/320 (11%)

Query: 1   MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLL 60
           +ADI LAEWGRK I +AE EMPGLMA RRKY  QK LKGARI G LHMT+QTAVLIETL+
Sbjct: 12  VADITLAEWGRKEIEIAEKEMPGLMATRRKYAGQKPLKGARITGSLHMTIQTAVLIETLV 71

Query: 61  ELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNM 120
           +LGAEV+W+SCNIFSTQDHAAAAIAA G+ V+AWKGE+ +EY WC  Q L F DGK  N+
Sbjct: 72  DLGAEVRWASCNIFSTQDHAAAAIAAAGIPVFAWKGESLDEYWWCTRQILEFEDGKGPNL 131

Query: 121 ILDDGGDLTNLVH-----EKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVND 175
           I+DDGGD T ++H     E  P+ L ++ G +EE       LY+  +E       +   D
Sbjct: 132 IVDDGGDATLMIHLGYKIENNPELLEKVPGNAEEKA-----LYQQLRE-------VYSED 179

Query: 176 SVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAIN 235
           +                    +++ +  +E++G+SEETTTGVH LY+M ++ +L  PAIN
Sbjct: 180 T--------------------QRWHKVAAEMKGVSEETTTGVHRLYQMMEKGELLFPAIN 219

Query: 236 VNDSVTKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRV 295
           VNDSVTKSKFDNLYGCRESL DG+KRATD+M+AGKV VV GYGDVGKGCA S+R +G+RV
Sbjct: 220 VNDSVTKSKFDNLYGCRESLADGIKRATDVMIAGKVVVVLGYGDVGKGCAHSMRTYGARV 279

Query: 296 IVTEIDPINALQASMEGYEL 315
           IVTEIDPI ALQASMEG+E+
Sbjct: 280 IVTEIDPICALQASMEGFEV 299




May play a key role in the regulation of the intracellular concentration of adenosylhomocysteine.
Chlorobium limicola (strain DSM 245 / NBRC 103803) (taxid: 290315)
EC: 3EC: .EC: 3EC: .EC: 1EC: .EC: 1
>sp|A4SF77|SAHH_PROVI Adenosylhomocysteinase OS=Prosthecochloris vibrioformis (strain DSM 265) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q3B532|SAHH_PELLD Adenosylhomocysteinase OS=Pelodictyon luteolum (strain DSM 273) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q01VU1|SAHH_SOLUE Adenosylhomocysteinase OS=Solibacter usitatus (strain Ellin6076) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q3AQC2|SAHH_CHLCH Adenosylhomocysteinase OS=Chlorobium chlorochromatii (strain CaD3) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|B4SD43|SAHH_PELPB Adenosylhomocysteinase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q8KEG8|SAHH_CHLTE Adenosylhomocysteinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q82DC9|SAHH_STRAW Adenosylhomocysteinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|B3QMF5|SAHH_CHLP8 Adenosylhomocysteinase OS=Chlorobaculum parvum (strain NCIB 8327) GN=ahcY PE=3 SV=1 Back     alignment and function description
>sp|Q9KZM1|SAHH_STRCO Adenosylhomocysteinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ahcY PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query718
410925318432 PREDICTED: adenosylhomocysteinase A-like 0.350 0.583 0.660 1e-110
430812176454 unnamed protein product [Pneumocystis ji 0.371 0.588 0.620 2e-99
189347135471 S-adenosyl-L-homocysteine hydrolase [Chl 0.394 0.600 0.593 3e-97
375254871472 adenosylhomocysteinase [Tannerella forsy 0.395 0.601 0.601 3e-96
410097121472 adenosylhomocysteinase [Parabacteroides 0.401 0.610 0.606 1e-95
390947668469 adenosylhomocysteinase [Alistipes finego 0.410 0.628 0.574 6e-95
334366509469 adenosylhomocysteinase [Alistipes sp. HG 0.410 0.628 0.574 9e-95
194333640472 S-adenosyl-L-homocysteine hydrolase [Pro 0.394 0.599 0.606 1e-94
145219929471 S-adenosyl-L-homocysteine hydrolase [Chl 0.401 0.611 0.593 3e-94
154490354472 hypothetical protein PARMER_00587 [Parab 0.401 0.610 0.6 3e-94
>gi|410925318|ref|XP_003976128.1| PREDICTED: adenosylhomocysteinase A-like [Takifugu rubripes] Back     alignment and taxonomy information
 Score =  405 bits (1042), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 232/315 (73%), Gaps = 63/315 (20%)

Query: 1   MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLL 60
           +ADI LAEWGRK I +AENEMPGLM +R KYG  K LKGARIAGCLHMT+QTAVLIETL 
Sbjct: 9   VADISLAEWGRKAIDIAENEMPGLMKMREKYGQSKPLKGARIAGCLHMTLQTAVLIETLT 68

Query: 61  ELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNM 120
            LGAEVQWSSCNIFSTQDHAAAA+A  G+ VYAWKGETDEEYVWCI              
Sbjct: 69  ALGAEVQWSSCNIFSTQDHAAAAVAKSGIPVYAWKGETDEEYVWCI-------------- 114

Query: 121 ILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKP 180
                                      E+T      LY  FK+N+              P
Sbjct: 115 ---------------------------EQT------LY--FKDNQ--------------P 125

Query: 181 LNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSV 240
           LNMILDDGGDLTN+VH+KYP+ LS IRG+SEETTTGVHNLYKM K+ +L VPAINVNDSV
Sbjct: 126 LNMILDDGGDLTNMVHQKYPKLLSGIRGLSEETTTGVHNLYKMLKKGELKVPAINVNDSV 185

Query: 241 TKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEI 300
           TKSKFDNLYGCRESL+DG+KRATD+M+AGKVAVVAGYGDVGKGC Q+LR FG+RVIVTE+
Sbjct: 186 TKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCVQALRGFGARVIVTEV 245

Query: 301 DPINALQASMEGYEL 315
           DPINALQA+MEGYE+
Sbjct: 246 DPINALQAAMEGYEV 260




Source: Takifugu rubripes

Species: Takifugu rubripes

Genus: Takifugu

Family: Tetraodontidae

Order: Tetraodontiformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|430812176|emb|CCJ30398.1| unnamed protein product [Pneumocystis jirovecii] Back     alignment and taxonomy information
>gi|189347135|ref|YP_001943664.1| S-adenosyl-L-homocysteine hydrolase [Chlorobium limicola DSM 245] gi|226695327|sp|B3EDY3.1|SAHH_CHLL2 RecName: Full=Adenosylhomocysteinase; AltName: Full=S-adenosyl-L-homocysteine hydrolase; Short=AdoHcyase gi|189341282|gb|ACD90685.1| adenosylhomocysteinase [Chlorobium limicola DSM 245] Back     alignment and taxonomy information
>gi|375254871|ref|YP_005014038.1| adenosylhomocysteinase [Tannerella forsythia ATCC 43037] gi|363407006|gb|AEW20692.1| adenosylhomocysteinase [Tannerella forsythia ATCC 43037] Back     alignment and taxonomy information
>gi|410097121|ref|ZP_11292105.1| adenosylhomocysteinase [Parabacteroides goldsteinii CL02T12C30] gi|409224915|gb|EKN17839.1| adenosylhomocysteinase [Parabacteroides goldsteinii CL02T12C30] Back     alignment and taxonomy information
>gi|390947668|ref|YP_006411428.1| adenosylhomocysteinase [Alistipes finegoldii DSM 17242] gi|390424237|gb|AFL78743.1| adenosylhomocysteinase [Alistipes finegoldii DSM 17242] Back     alignment and taxonomy information
>gi|334366509|ref|ZP_08515439.1| adenosylhomocysteinase [Alistipes sp. HGB5] gi|313157319|gb|EFR56744.1| adenosylhomocysteinase [Alistipes sp. HGB5] Back     alignment and taxonomy information
>gi|194333640|ref|YP_002015500.1| S-adenosyl-L-homocysteine hydrolase [Prosthecochloris aestuarii DSM 271] gi|194311458|gb|ACF45853.1| adenosylhomocysteinase [Prosthecochloris aestuarii DSM 271] Back     alignment and taxonomy information
>gi|145219929|ref|YP_001130638.1| S-adenosyl-L-homocysteine hydrolase [Chlorobium phaeovibrioides DSM 265] gi|189046122|sp|A4SF77.1|SAHH_PROVI RecName: Full=Adenosylhomocysteinase; AltName: Full=S-adenosyl-L-homocysteine hydrolase; Short=AdoHcyase gi|145206093|gb|ABP37136.1| adenosylhomocysteinase [Chlorobium phaeovibrioides DSM 265] Back     alignment and taxonomy information
>gi|154490354|ref|ZP_02030615.1| hypothetical protein PARMER_00587 [Parabacteroides merdae ATCC 43184] gi|154088965|gb|EDN88009.1| adenosylhomocysteinase [Parabacteroides merdae ATCC 43184] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query718
FB|FBgn0014455432 Ahcy13 "Adenosylhomocysteinase 0.249 0.414 0.793 1.9e-171
ZFIN|ZDB-GENE-031219-6433 ahcy "S-adenosylhomocysteine h 0.249 0.413 0.754 4e-171
UNIPROTKB|F1P3F1438 AHCY "Adenosylhomocysteinase" 0.249 0.408 0.765 3.2e-169
RGD|69260432 Ahcy "adenosylhomocysteinase" 0.247 0.412 0.737 5.9e-166
UNIPROTKB|Q3MHL4432 AHCY "Adenosylhomocysteinase" 0.247 0.412 0.743 7.5e-166
UNIPROTKB|P23526432 AHCY "Adenosylhomocysteinase" 0.247 0.412 0.743 4.1e-165
UNIPROTKB|Q710C4432 AHCY "Adenosylhomocysteinase" 0.247 0.412 0.743 4.1e-165
UNIPROTKB|F1S4Y7423 AHCY "Adenosylhomocysteinase" 0.246 0.418 0.747 5.2e-165
WB|WBGene00019322437 ahcy-1 [Caenorhabditis elegans 0.249 0.409 0.754 4.6e-164
DICTYBASE|DDB_G0267418431 sahA "adenosylhomocysteinase" 0.246 0.410 0.774 1.1e-162
FB|FBgn0014455 Ahcy13 "Adenosylhomocysteinase at 13" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 765 (274.4 bits), Expect = 1.9e-171, Sum P(3) = 1.9e-171
 Identities = 142/179 (79%), Positives = 155/179 (86%)

Query:     1 MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLL 60
             +ADI LAEWGRK II+AENEMPGLMA R+KYG  K LKGARI GCLHMTVQTAVLIETL+
Sbjct:     8 VADISLAEWGRKAIIIAENEMPGLMACRKKYGPSKPLKGARITGCLHMTVQTAVLIETLV 67

Query:    61 ELGAEVQWSSCNIFSTQDHXXXXXXXXXXXXXXWKGETDEEYVWCIEQTLVFPDGKPLNM 120
             ELGA+VQWSSCNIFSTQD+              WKGETDEEY+WCIEQTLVFPDG+PLNM
Sbjct:    68 ELGAQVQWSSCNIFSTQDNAAAAIAATGVPVYAWKGETDEEYMWCIEQTLVFPDGQPLNM 127

Query:   121 ILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTK 179
             ILDDGGDLTNLVHEK+PQ+L  I+G+SEETTTGVHNLYKMFKE +LGVPAINVNDSVTK
Sbjct:   128 ILDDGGDLTNLVHEKFPQYLKNIKGLSEETTTGVHNLYKMFKEGRLGVPAINVNDSVTK 186


GO:0004013 "adenosylhomocysteinase activity" evidence=ISS;NAS
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006730 "one-carbon metabolic process" evidence=IEA
ZFIN|ZDB-GENE-031219-6 ahcy "S-adenosylhomocysteine hydrolase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3F1 AHCY "Adenosylhomocysteinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|69260 Ahcy "adenosylhomocysteinase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MHL4 AHCY "Adenosylhomocysteinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P23526 AHCY "Adenosylhomocysteinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q710C4 AHCY "Adenosylhomocysteinase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1S4Y7 AHCY "Adenosylhomocysteinase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00019322 ahcy-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0267418 sahA "adenosylhomocysteinase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B2AGG2SAHH_CUPTR3, ., 3, ., 1, ., 10.56560.39270.5974yesN/A
B2U774SAHH_RALPJ3, ., 3, ., 1, ., 10.5750.39270.5949yesN/A
Q9ABH0SAHH_CAUCR3, ., 3, ., 1, ., 10.57450.38440.5961yesN/A
B4SD43SAHH_PELPB3, ., 3, ., 1, ., 10.59020.39970.6093yesN/A
Q62G22SAHH_BURMA3, ., 3, ., 1, ., 10.55870.39970.6067yesN/A
B8DR41SAHH_DESVM3, ., 3, ., 1, ., 10.55370.40110.6012yesN/A
Q3JY79SAHH_BURP13, ., 3, ., 1, ., 10.55870.39970.6067yesN/A
Q8KEG8SAHH_CHLTE3, ., 3, ., 1, ., 10.57810.39410.6008yesN/A
Q2STU0SAHH_BURTA3, ., 3, ., 1, ., 10.55870.39970.6067yesN/A
A4SF77SAHH_PROVI3, ., 3, ., 1, ., 10.59360.40110.6114yesN/A
Q8PP84SAHH_XANAC3, ., 3, ., 1, ., 10.56340.39830.5958yesN/A
A1V8Z2SAHH_BURMS3, ., 3, ., 1, ., 10.55870.39970.6067yesN/A
B2SPN6SAHH_XANOP3, ., 3, ., 1, ., 10.56030.39830.5958yesN/A
Q82WL1SAHH_NITEU3, ., 3, ., 1, ., 10.55900.39270.5899yesN/A
Q63PT2SAHH_BURPS3, ., 3, ., 1, ., 10.55870.39970.6067yesN/A
Q87EI8SAHH_XYLFT3, ., 3, ., 1, ., 10.55900.39690.5937yesN/A
A2S6W2SAHH_BURM93, ., 3, ., 1, ., 10.55870.39970.6067yesN/A
Q01VU1SAHH_SOLUE3, ., 3, ., 1, ., 10.59240.39550.5978yesN/A
Q3BXC6SAHH_XANC53, ., 3, ., 1, ., 10.56340.39830.5958yesN/A
Q8Y387SAHH_RALSO3, ., 3, ., 1, ., 10.58300.39410.5970yesN/A
A3MQW7SAHH_BURM73, ., 3, ., 1, ., 10.55870.39970.6067yesN/A
Q30WL8SAHH_DESDG3, ., 3, ., 1, ., 10.55090.39830.5970yesN/A
B2T6X2SAHH_BURPP3, ., 3, ., 1, ., 10.57140.39970.6067yesN/A
Q4UQZ8SAHH_XANC83, ., 3, ., 1, ., 10.56340.39830.5958yesN/A
Q13T36SAHH_BURXL3, ., 3, ., 1, ., 10.56820.39970.6067yesN/A
Q3B532SAHH_PELLD3, ., 3, ., 1, ., 10.59370.39410.6008yesN/A
Q476T8SAHH_CUPPJ3, ., 3, ., 1, ., 10.56250.39270.5974yesN/A
Q9KZM1SAHH_STRCO3, ., 3, ., 1, ., 10.52830.44700.6618yesN/A
Q2NZE3SAHH_XANOM3, ., 3, ., 1, ., 10.56030.39830.5958yesN/A
Q64MT2SAHH_BACFR3, ., 3, ., 1, ., 10.58730.40110.5913yesN/A
Q8A407SAHH_BACTN3, ., 3, ., 1, ., 10.58990.39830.6008yesN/A
B0U232SAHH_XYLFM3, ., 3, ., 1, ., 10.55900.39690.5937yesN/A
Q7TTZ5SAHH_RHOBA3, ., 3, ., 1, ., 10.58460.34810.5580yesN/A
A3NER1SAHH_BURP63, ., 3, ., 1, ., 10.55870.39970.6067yesN/A
Q8PCH5SAHH_XANCP3, ., 3, ., 1, ., 10.56340.39830.5958yesN/A
B3EDY3SAHH_CHLL23, ., 3, ., 1, ., 10.59370.39410.6008yesN/A
B2JIP4SAHH_BURP83, ., 3, ., 1, ., 10.56500.39970.6067yesN/A
Q9PEJ1SAHH_XYLFA3, ., 3, ., 1, ., 10.55590.39690.5937yesN/A
Q82DC9SAHH_STRAW3, ., 3, ., 1, ., 10.52270.44420.6577yesN/A
A1BEZ2SAHH_CHLPD3, ., 3, ., 1, ., 10.57940.39550.6029yesN/A
B1VUW6SAHH_STRGG3, ., 3, ., 1, ., 10.52310.44980.6659yesN/A
A3P0L8SAHH_BURP03, ., 3, ., 1, ., 10.55870.39970.6067yesN/A
Q3AQC2SAHH_CHLCH3, ., 3, ., 1, ., 10.56670.41780.6369yesN/A
Q0AEV8SAHH_NITEC3, ., 3, ., 1, ., 10.57230.39830.5983yesN/A
B2I7N4SAHH_XYLF23, ., 3, ., 1, ., 10.55900.39690.5937yesN/A
Q27580SAHH_DROME3, ., 3, ., 1, ., 10.86030.24090.4004yesN/A
B3QMF5SAHH_CHLP83, ., 3, ., 1, ., 10.58120.39410.6008yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!
3rd Layer3.3.10.921
3rd Layer3.3.1.10.914

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query718
PTZ00075476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 1e-160
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 1e-128
PLN02494477 PLN02494, PLN02494, adenosylhomocysteinase 1e-120
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 1e-114
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 1e-107
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 1e-105
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 2e-96
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 2e-89
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 2e-88
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 1e-86
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 2e-85
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 2e-83
smart00996 426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 4e-74
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 1e-73
pfam00670162 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocystein 3e-73
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 3e-72
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 6e-72
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 1e-71
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 1e-71
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 1e-69
smart00997162 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocystei 7e-68
PTZ00075476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 1e-64
PRK05476 425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 4e-64
pfam05221 430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 6e-64
PTZ00075 476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 2e-62
PTZ00075476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 4e-62
cd00401 402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 2e-61
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 2e-61
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 4e-61
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 5e-61
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 8e-61
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 1e-58
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 1e-55
COG0499 420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 1e-52
PLN02494477 PLN02494, PLN02494, adenosylhomocysteinase 5e-49
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 8e-48
TIGR00936 407 TIGR00936, ahcY, adenosylhomocysteinase 7e-47
PLN02494 477 PLN02494, PLN02494, adenosylhomocysteinase 4e-46
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 1e-45
PLN02494477 PLN02494, PLN02494, adenosylhomocysteinase 4e-45
pfam00670162 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocystein 2e-42
smart00997162 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocystei 9e-39
cd12154310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 2e-33
cd12154310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 6e-28
pfam00670162 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocystein 1e-11
smart00997162 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocystei 5e-10
smart00996426 smart00996, AdoHcyase, S-adenosyl-L-homocysteine h 7e-10
cd00401402 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, N 8e-10
PTZ00075476 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provis 6e-09
PRK05476425 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydr 7e-09
pfam05221430 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hy 3e-08
COG0499420 COG0499, SAM1, S-adenosylhomocysteine hydrolase [C 7e-07
PLN02494477 PLN02494, PLN02494, adenosylhomocysteinase 1e-06
cd12154 310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 1e-06
cd05300313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 4e-06
TIGR00936407 TIGR00936, ahcY, adenosylhomocysteinase 5e-06
cd12154310 cd12154, FDH_GDH_like, Formate/glycerate dehydroge 6e-06
cd12171310 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 1e-05
cd12165314 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 3e-05
cd12175311 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 3e-05
COG0111324 COG0111, SerA, Phosphoglycerate dehydrogenase and 1e-04
pfam02826175 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydro 2e-04
cd05198302 cd05198, formate_dh_like, Formate/glycerate and re 0.002
cd12173304 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, 0.002
cd05300313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 0.003
cd05303301 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P 0.003
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
 Score =  472 bits (1216), Expect = e-160
 Identities = 190/314 (60%), Positives = 225/314 (71%), Gaps = 23/314 (7%)

Query: 2   ADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLE 61
            DI LAE+GRK I +AENEMPGLMALR +YG  K LKGARI GCLHMTVQTAVLIETL  
Sbjct: 8   KDISLAEFGRKEIELAENEMPGLMALREEYGPSKPLKGARITGCLHMTVQTAVLIETLKA 67

Query: 62  LGAEVQWSSCNIFSTQDHAAAAIAARG-VAVYAWKGETDEEYVWCIEQTLVFPDGKPLNM 120
           LGAEV+W SCNIFSTQDHAAAAIA  G V V+AWKGET EEY WC EQ L +P+G   N+
Sbjct: 68  LGAEVRWCSCNIFSTQDHAAAAIAKAGSVPVFAWKGETLEEYWWCTEQALKWPNGDGPNL 127

Query: 121 ILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKP 180
           I+DDGGD T LVHE                  GV    K+++E  +    ++ ++   K 
Sbjct: 128 IVDDGGDATLLVHE------------------GVK-AEKLYEEKGILPDPLDPSNEDEKC 168

Query: 181 LNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSV 240
           L  +L           +K+   + +I G+SEETTTGVH LYKM K+ +L  PAINVNDSV
Sbjct: 169 LLTVLKKLLTKNP---DKWTNLVKKIVGVSEETTTGVHRLYKMLKKGELLFPAINVNDSV 225

Query: 241 TKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEI 300
           TKSKFDN+YGCR SL+DG+ RATD+M+AGK  VV GYGDVGKGCAQ+LR FG+RV+VTEI
Sbjct: 226 TKSKFDNIYGCRHSLIDGIFRATDVMIAGKTVVVCGYGDVGKGCAQALRGFGARVVVTEI 285

Query: 301 DPINALQASMEGYE 314
           DPI ALQA+MEGY+
Sbjct: 286 DPICALQAAMEGYQ 299


Length = 476

>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|109716 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|198065 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|109716 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|198065 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|109716 pfam00670, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|198065 smart00997, AdoHcyase_NAD, S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>gnl|CDD|214963 smart00996, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|240619 cd00401, SAHH, S-Adenosylhomocysteine Hydrolase, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240258 PTZ00075, PTZ00075, Adenosylhomocysteinase; Provisional Back     alignment and domain information
>gnl|CDD|235488 PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|218507 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase Back     alignment and domain information
>gnl|CDD|223573 COG0499, SAM1, S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|178111 PLN02494, PLN02494, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information
>gnl|CDD|213572 TIGR00936, ahcY, adenosylhomocysteinase Back     alignment and domain information
>gnl|CDD|240631 cd12154, FDH_GDH_like, Formate/glycerate dehydrogenases, D-specific 2-hydroxy acid dehydrogenases and related dehydrogenases Back     alignment and domain information
>gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|217244 pfam02826, 2-Hacid_dh_C, D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family Back     alignment and domain information
>gnl|CDD|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information
>gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 718
KOG1370|consensus434 100.0
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 100.0
PLN02494477 adenosylhomocysteinase 100.0
PTZ00075476 Adenosylhomocysteinase; Provisional 100.0
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 100.0
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 100.0
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 100.0
PF05221268 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; In 100.0
PF05221268 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; In 100.0
COG0499 420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 100.0
PLN02494 477 adenosylhomocysteinase 100.0
KOG1370|consensus 434 100.0
PTZ00075 476 Adenosylhomocysteinase; Provisional 100.0
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 100.0
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 100.0
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 100.0
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 100.0
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 99.93
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 99.92
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 99.9
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 99.89
KOG0068|consensus406 99.89
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 99.89
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 99.89
PRK06487317 glycerate dehydrogenase; Provisional 99.87
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.87
PLN02306386 hydroxypyruvate reductase 99.87
PRK06932314 glycerate dehydrogenase; Provisional 99.87
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 99.86
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 99.86
PRK13243333 glyoxylate reductase; Reviewed 99.85
PLN02928347 oxidoreductase family protein 99.85
PRK07574385 formate dehydrogenase; Provisional 99.84
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 99.83
PLN03139386 formate dehydrogenase; Provisional 99.83
KOG0069|consensus336 99.81
PRK12480330 D-lactate dehydrogenase; Provisional 99.77
PRK06436303 glycerate dehydrogenase; Provisional 99.76
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 99.76
PRK08605332 D-lactate dehydrogenase; Validated 99.76
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.31
PRK13403335 ketol-acid reductoisomerase; Provisional 99.17
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.03
KOG0067|consensus435 98.66
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.58
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.54
PRK05479330 ketol-acid reductoisomerase; Provisional 98.53
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.5
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 98.49
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.49
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.49
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 98.39
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.38
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.37
PRK05225487 ketol-acid reductoisomerase; Validated 98.36
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 98.35
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 98.28
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 98.25
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.24
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.23
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.22
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.22
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 98.2
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 98.2
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 98.14
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.14
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 98.13
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.13
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.12
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.11
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 98.11
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.08
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.08
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.07
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.07
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.06
PLN02712667 arogenate dehydrogenase 98.06
PLN02256304 arogenate dehydrogenase 98.05
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.05
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.05
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.05
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.04
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.04
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.04
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 98.03
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.02
PRK12779 944 putative bifunctional glutamate synthase subunit b 98.02
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 98.02
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 98.01
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.01
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.99
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.98
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 97.95
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.95
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.93
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.93
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.92
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.92
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.92
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 97.92
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.91
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.89
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.88
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 97.86
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.85
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 97.83
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 97.81
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.79
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 97.78
PRK07417279 arogenate dehydrogenase; Reviewed 97.78
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 97.74
PLN02712 667 arogenate dehydrogenase 97.7
PRK07502307 cyclohexadienyl dehydrogenase; Validated 97.69
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 97.68
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.68
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 97.66
PRK08655437 prephenate dehydrogenase; Provisional 97.65
PRK12831464 putative oxidoreductase; Provisional 97.63
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.63
PRK15059292 tartronate semialdehyde reductase; Provisional 97.62
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.62
PRK06545359 prephenate dehydrogenase; Validated 97.6
PLN00203519 glutamyl-tRNA reductase 97.56
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.53
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 97.51
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 97.49
PRK14982340 acyl-ACP reductase; Provisional 97.48
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.48
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 97.48
PRK08507275 prephenate dehydrogenase; Validated 97.48
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.48
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.48
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 97.47
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 97.46
PLN02688266 pyrroline-5-carboxylate reductase 97.43
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.42
PRK07340304 ornithine cyclodeaminase; Validated 97.39
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 97.38
PRK098531019 putative selenate reductase subunit YgfK; Provisio 97.37
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.36
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.34
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.32
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.29
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 97.29
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.28
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.28
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.27
PRK08818370 prephenate dehydrogenase; Provisional 97.26
PLN02858 1378 fructose-bisphosphate aldolase 97.25
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 97.25
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.24
PRK08618325 ornithine cyclodeaminase; Validated 97.22
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.22
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 97.21
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.2
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 97.2
PLN02858 1378 fructose-bisphosphate aldolase 97.2
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 97.18
PRK09414445 glutamate dehydrogenase; Provisional 97.17
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 97.16
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 97.15
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.13
PRK12814652 putative NADPH-dependent glutamate synthase small 97.12
PLN02477410 glutamate dehydrogenase 97.12
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.1
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 97.09
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.09
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.09
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 97.08
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.08
PRK14031444 glutamate dehydrogenase; Provisional 97.07
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.06
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 97.05
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 97.04
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.02
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 97.02
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.01
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 97.0
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.96
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 96.96
PRK06141314 ornithine cyclodeaminase; Validated 96.96
PRK13940414 glutamyl-tRNA reductase; Provisional 96.95
PRK07680273 late competence protein ComER; Validated 96.95
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.95
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.93
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 96.91
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.9
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 96.89
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 96.87
PRK14030445 glutamate dehydrogenase; Provisional 96.86
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.85
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 96.84
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.84
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.84
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.82
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.81
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 96.81
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 96.8
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 96.8
PRK06719157 precorrin-2 dehydrogenase; Validated 96.79
PLN02852491 ferredoxin-NADP+ reductase 96.78
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 96.75
PRK00779304 ornithine carbamoyltransferase; Provisional 96.74
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.73
PRK06046326 alanine dehydrogenase; Validated 96.73
PLN02527306 aspartate carbamoyltransferase 96.7
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 96.7
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.66
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.66
KOG0409|consensus327 96.66
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 96.63
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 96.62
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 96.61
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 96.6
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 96.57
PRK09880343 L-idonate 5-dehydrogenase; Provisional 96.56
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 96.55
PTZ00431260 pyrroline carboxylate reductase; Provisional 96.51
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 96.5
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.47
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.46
PRK06823315 ornithine cyclodeaminase; Validated 96.46
PRK01713334 ornithine carbamoyltransferase; Provisional 96.45
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.36
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 96.34
PRK13304265 L-aspartate dehydrogenase; Reviewed 96.32
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 96.32
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 96.31
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 96.3
KOG2380|consensus480 96.3
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.28
PRK06407301 ornithine cyclodeaminase; Provisional 96.28
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.28
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.27
PRK02102331 ornithine carbamoyltransferase; Validated 96.27
PRK08229341 2-dehydropantoate 2-reductase; Provisional 96.26
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members o 96.26
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 96.26
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.25
PRK12562334 ornithine carbamoyltransferase subunit F; Provisio 96.23
PLN02342348 ornithine carbamoyltransferase 96.23
PRK02255338 putrescine carbamoyltransferase; Provisional 96.21
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 96.2
PRK07589346 ornithine cyclodeaminase; Validated 96.19
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 96.17
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 96.16
PRK08291330 ectoine utilization protein EutC; Validated 96.13
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.12
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 96.1
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.1
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.1
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 96.09
PRK12921305 2-dehydropantoate 2-reductase; Provisional 96.07
PRK13984604 putative oxidoreductase; Provisional 96.06
PRK04284332 ornithine carbamoyltransferase; Provisional 95.97
PRK03659601 glutathione-regulated potassium-efflux system prot 95.96
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 95.93
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 95.92
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 95.92
PRK03562621 glutathione-regulated potassium-efflux system prot 95.9
KOG0023|consensus360 95.9
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 95.88
PRK11891429 aspartate carbamoyltransferase; Provisional 95.84
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 95.83
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.82
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 95.74
PTZ00117319 malate dehydrogenase; Provisional 95.74
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 95.74
PLN02586360 probable cinnamyl alcohol dehydrogenase 95.74
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 95.74
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 95.74
PRK12862 763 malic enzyme; Reviewed 95.71
PRK12861 764 malic enzyme; Reviewed 95.68
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.67
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.65
PRK06199379 ornithine cyclodeaminase; Validated 95.64
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 95.64
PRK05562223 precorrin-2 dehydrogenase; Provisional 95.62
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.6
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 95.57
PRK07200395 aspartate/ornithine carbamoyltransferase family pr 95.55
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 95.51
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 95.49
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 95.49
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 95.48
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 95.47
PLN02740381 Alcohol dehydrogenase-like 95.46
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.45
PRK10669558 putative cation:proton antiport protein; Provision 95.45
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 95.44
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 95.43
PRK12770352 putative glutamate synthase subunit beta; Provisio 95.43
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.42
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.42
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.41
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 95.38
COG5322351 Predicted dehydrogenase [General function predicti 95.38
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 95.37
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.37
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 95.34
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 95.33
PRK06370463 mercuric reductase; Validated 95.32
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 95.3
PRK10637457 cysG siroheme synthase; Provisional 95.29
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 95.29
PLN02178375 cinnamyl-alcohol dehydrogenase 95.28
PRK13301267 putative L-aspartate dehydrogenase; Provisional 95.22
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic cha 95.22
KOG0024|consensus354 95.21
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 95.21
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 95.2
PRK14804311 ornithine carbamoyltransferase; Provisional 95.17
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 95.17
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 95.17
PRK07574385 formate dehydrogenase; Provisional 95.17
PTZ00082321 L-lactate dehydrogenase; Provisional 95.17
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.15
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 95.15
PRK06249313 2-dehydropantoate 2-reductase; Provisional 95.15
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.15
PRK06116450 glutathione reductase; Validated 95.13
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.12
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.1
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 95.09
PRK09496453 trkA potassium transporter peripheral membrane com 95.06
COG0281432 SfcA Malic enzyme [Energy production and conversio 95.04
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.0
KOG4230|consensus 935 94.98
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 94.96
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 94.93
PRK10262321 thioredoxin reductase; Provisional 94.88
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 94.84
KOG0399|consensus2142 94.83
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 94.81
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 94.8
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 94.79
PRK05976472 dihydrolipoamide dehydrogenase; Validated 94.78
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.74
PRK15116268 sulfur acceptor protein CsdL; Provisional 94.63
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.61
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.61
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 94.59
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 94.58
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 94.58
PRK04148134 hypothetical protein; Provisional 94.56
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 94.55
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 94.54
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.54
PLN02827378 Alcohol dehydrogenase-like 94.53
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.51
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.5
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 94.48
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.45
PRK14805302 ornithine carbamoyltransferase; Provisional 94.4
PLN02546558 glutathione reductase 94.36
PLN02514357 cinnamyl-alcohol dehydrogenase 94.36
PRK08192338 aspartate carbamoyltransferase; Provisional 94.32
KOG0022|consensus375 94.31
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 94.31
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 94.31
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.28
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 94.18
PRK09564444 coenzyme A disulfide reductase; Reviewed 94.16
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 94.09
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 94.05
TIGR02053463 MerA mercuric reductase. This model represents the 94.04
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.04
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 94.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 93.98
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 93.96
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 93.95
PRK09496453 trkA potassium transporter peripheral membrane com 93.95
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 93.93
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 93.93
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 93.92
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 93.85
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.84
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 93.84
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 93.81
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 93.81
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 93.8
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 93.78
KOG0089|consensus309 93.78
PRK14027283 quinate/shikimate dehydrogenase; Provisional 93.78
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 93.77
PRK00048257 dihydrodipicolinate reductase; Provisional 93.76
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 93.71
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 93.66
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 93.66
PRK08223287 hypothetical protein; Validated 93.62
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 93.59
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 93.58
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 93.55
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 93.54
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 93.52
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 93.46
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 93.45
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 93.43
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 93.32
PRK06223307 malate dehydrogenase; Reviewed 93.31
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 93.31
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 93.26
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 93.24
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 93.24
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 93.18
PRK05086312 malate dehydrogenase; Provisional 93.17
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.13
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 93.12
TIGR01161352 purK phosphoribosylaminoimidazole carboxylase, Pur 93.12
PRK12550272 shikimate 5-dehydrogenase; Reviewed 93.12
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 93.08
PLN02948 577 phosphoribosylaminoimidazole carboxylase 93.08
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 93.05
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 92.85
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 92.83
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 92.79
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 92.79
PRK05600370 thiamine biosynthesis protein ThiF; Validated 92.73
PLN02353473 probable UDP-glucose 6-dehydrogenase 92.72
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 92.71
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 92.66
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 92.65
PRK08300302 acetaldehyde dehydrogenase; Validated 92.65
PRK11730715 fadB multifunctional fatty acid oxidation complex 92.64
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 92.64
PRK11579346 putative oxidoreductase; Provisional 92.62
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 92.59
PRK10083339 putative oxidoreductase; Provisional 92.57
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic cha 92.53
PF04016147 DUF364: Domain of unknown function (DUF364); Inter 92.48
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 92.48
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 92.36
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 92.35
PRK13303265 L-aspartate dehydrogenase; Provisional 92.33
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 92.31
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 92.31
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 92.28
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 92.25
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 92.21
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 92.21
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 92.19
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 92.18
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 92.16
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 92.13
PRK12742237 oxidoreductase; Provisional 92.12
KOG0068|consensus406 92.11
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 92.11
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 92.04
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 92.03
PRK12771564 putative glutamate synthase (NADPH) small subunit; 92.03
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 92.03
PLN03139386 formate dehydrogenase; Provisional 92.03
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 92.0
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 91.99
PRK13529563 malate dehydrogenase; Provisional 91.97
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 91.95
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 91.92
PLN03129581 NADP-dependent malic enzyme; Provisional 91.87
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 91.85
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid tr 91.82
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.8
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 91.79
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 91.57
PRK12814652 putative NADPH-dependent glutamate synthase small 91.56
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 91.52
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 91.51
PTZ00325321 malate dehydrogenase; Provisional 91.5
PLN00106323 malate dehydrogenase 91.46
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 91.44
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 91.43
PRK11154708 fadJ multifunctional fatty acid oxidation complex 91.34
PRK07411390 hypothetical protein; Validated 91.33
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 91.28
PRK04148134 hypothetical protein; Provisional 91.23
PLN02602350 lactate dehydrogenase 91.22
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 91.21
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 91.16
PRK14851 679 hypothetical protein; Provisional 91.04
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 91.0
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 90.89
KOG0024|consensus354 90.89
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 90.88
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.87
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 90.85
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 90.84
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 90.69
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 90.6
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 90.55
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 90.54
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 90.44
PRK12480330 D-lactate dehydrogenase; Provisional 90.4
PRK05708305 2-dehydropantoate 2-reductase; Provisional 90.4
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 90.39
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 90.37
PRK07877 722 hypothetical protein; Provisional 90.36
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 90.27
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 90.22
PRK05562223 precorrin-2 dehydrogenase; Provisional 90.21
PRK06444197 prephenate dehydrogenase; Provisional 90.19
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 90.04
>KOG1370|consensus Back     alignment and domain information
Probab=100.00  E-value=4.7e-142  Score=1095.70  Aligned_cols=424  Identities=79%  Similarity=1.227  Sum_probs=405.6

Q ss_pred             CCCccchHhhhhhHHHHHhhCchHHHHHHHhccCCCCCCcEEEEEeeccHhHHHHHHHHHHCCCEEEEeecCCCCCHHHH
Q psy7896           1 MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHA   80 (718)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~mp~l~~~~~~~~~~~pl~g~ri~~~lh~~~~ta~l~~~L~~~Ga~v~~~~~n~~stqd~~   80 (718)
                      ++||++|+||||+|+.||+|||+||++|++|+++|||||+||++|+|||+|||||||||.++||||+|+|||+||||||+
T Consensus        10 v~~i~~aafGRkeieiAE~eMPglma~r~r~~~skPlkgArI~GClH~tvqTAVLiETLv~LGAev~WssCNIfSTQdha   89 (434)
T KOG1370|consen   10 VKDISQAAFGRKEIEIAENEMPGLMALRKRYGPSKPLKGARIAGCLHMTVQTAVLIETLVALGAEVRWSSCNIFSTQDHA   89 (434)
T ss_pred             eeechhhhhchhhhhhhhhhcchHHHHHHHhccCCCCCCCeeeeeeeeehhHHHHHHHHHHhCceeeeeecceecchhHH
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCeEEEecCCCHHHHHHHHHHHccCCCCCCceeEecCcchhHHHHHhhChhhhhcccCCCcccchhHHhHHHH
Q psy7896          81 AAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKM  160 (718)
Q Consensus        81 aaal~~~gv~v~a~~~~~~~ey~~~~~~~~~~~~~~~~~~i~Ddggdl~~~~~~~~~~~~~~~~g~~eet~~g~~~~~~~  160 (718)
                      ||||++.|+|||||+|||+|||||||++++.. +++|||||+|||||+|+++|+|||+++..|+|+||||||||||||+|
T Consensus        90 AAAiA~~g~Pvfawkget~ee~~wcie~~~~~-~g~~~nmIlDdggd~t~l~h~kyp~~~~~i~GiseEttTGVH~Lykm  168 (434)
T KOG1370|consen   90 AAAIAEAGVPVFAWKGETEEEYWWCIERCLNK-DGWQPNMILDDGGDLTHLVHEKYPQMFKKIRGISEETTTGVHNLYKM  168 (434)
T ss_pred             HHHHHhcCCceeeeccccchhhhhhhhhhhcc-CCCCcceeecCCCchhhhhhhhhHHHHhhhcccchhhhhhHHHHHHH
Confidence            99999999999999999999999999999984 66677999999999999999999999999999999999996666666


Q ss_pred             HhhcccCCCccccCCCCCccceeeecccccccccccccccccccccccccccchhhhhhhHHHHhcCCccceEEEecCCc
Q psy7896         161 FKENKLGVPAINVNDSVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSV  240 (718)
Q Consensus       161 ~~~~~l~~p~~~~~~s~~k~~~~~~d~ggyf~~~~~~~~~~~~~~~~Gv~E~T~sG~~rl~~~~~~g~l~~Pv~~v~ds~  240 (718)
                      +++|                                                               +|.+|+||||||+
T Consensus       169 ~k~G---------------------------------------------------------------~L~VPAiNVNDSV  185 (434)
T KOG1370|consen  169 SKNG---------------------------------------------------------------KLKVPAINVNDSV  185 (434)
T ss_pred             HhCC---------------------------------------------------------------ceecceeeccchh
Confidence            6555                                                               5555666666677


Q ss_pred             ccccccccccchhhHHHHHhhhcccccCCcEEEEEecCCCChhHHHHHHhcCCeEEEeecCchhhhhhhhhhhhhhHHHH
Q psy7896         241 TKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYELDEEVA  320 (718)
Q Consensus       241 ~K~~fd~~~G~~es~~~~i~r~t~~~~~Gk~vvViGyG~vG~~~A~aLra~Gv~VtV~D~dp~r~v~AvaeGf~L~r~i~  320 (718)
                      +|++|||.|||+||++|||+|+|++|++||.++|+|||.+|+++|                                   
T Consensus       186 TKsKFDnLygcreSl~DgikraTDvM~aGKv~Vv~GYGdVGKgCa-----------------------------------  230 (434)
T KOG1370|consen  186 TKSKFDNLYGCRESLLDGIKRATDVMIAGKVAVVCGYGDVGKGCA-----------------------------------  230 (434)
T ss_pred             hhhhccccccchhhhhhhhhhhhhheecccEEEEeccCccchhHH-----------------------------------
Confidence            788899999999999999999999999999999999999999999                                   


Q ss_pred             HHHHHHhcccccccchhhhhhhcccccCcEEEEEecChhHHHHHHHHHhCCCEEEEEecCCccHHHHhhcCceecCHHHH
Q psy7896         321 ALHLEHLGVKLTKLTEDQAKYLDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYEVTTMEEA  400 (718)
Q Consensus       321 ~~~l~~lgv~~~~~~~~~~~~~g~eL~GktVGIIG~G~IG~~vA~~l~~fGa~Viv~d~dp~~al~a~~~G~~v~~Leel  400 (718)
                                                                  +.|++||++|+++++||+.+++|.|+||++++|+|+
T Consensus       231 --------------------------------------------qaLkg~g~~VivTEiDPI~ALQAaMeG~~V~tm~ea  266 (434)
T KOG1370|consen  231 --------------------------------------------QALKGFGARVIVTEIDPICALQAAMEGYEVTTLEEA  266 (434)
T ss_pred             --------------------------------------------HHHhhcCcEEEEeccCchHHHHHHhhccEeeeHHHh
Confidence                                                        778899999999999999999999999999999999


Q ss_pred             hccCcEEEEcCCCCCCcCHHHHhcCCCCeEEEEcCCCCccccHHHHhccccceeeecCCcccCccccchhhHHHHhhhcc
Q psy7896         401 AKEGGIFVTTTGCKDIIRGEHFLQMRDDAIVCNIGHFDCEIQVSWLDKNAVEKVNVKPQVSPTSRTKHLTTEALLATCNS  480 (718)
Q Consensus       401 l~~aDiIi~atgt~~lI~~e~l~~MK~gAiLIN~GRgd~Eid~~aL~~~~l~~~~v~P~V~v~s~e~~~~~eal~n~~~~  480 (718)
                      ++++|||+++||++++|..+||.+||+++|++|+||+|.|||+.+|+...+++..++|+|                    
T Consensus       267 ~~e~difVTtTGc~dii~~~H~~~mk~d~IvCN~Ghfd~EiDv~~L~~~~~~~~~vk~Qv--------------------  326 (434)
T KOG1370|consen  267 IREVDIFVTTTGCKDIITGEHFDQMKNDAIVCNIGHFDTEIDVKWLNTPALTWENVKPQV--------------------  326 (434)
T ss_pred             hhcCCEEEEccCCcchhhHHHHHhCcCCcEEeccccccceeehhhccCCcceeeeccccc--------------------
Confidence            999999999999999999999999999999999999999999999999989999999999                    


Q ss_pred             cccccccccccCCcccccccccchhhcccchhhhHHHHhcChHHHHHHHHhcccccCCceEEEeeecchhhHHHHHHHHH
Q psy7896         481 LFKYSLVNTIHEAPTLLVHLSTDIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLL  560 (718)
Q Consensus       481 ~~~~nlv~~~h~~a~~~~Y~i~D~~La~~G~~kI~wa~~~MP~L~~Lr~~f~~~kpl~G~~i~~~lh~~~~Ta~L~~~l~  560 (718)
                                                                                                      
T Consensus       327 --------------------------------------------------------------------------------  326 (434)
T KOG1370|consen  327 --------------------------------------------------------------------------------  326 (434)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HcCCeEEeeccCcCCchHHHHHHHHhcCceEEEeeCCChHHHHHHHHHHhhcceecCCCCeEEEecCCccccccccCCCC
Q psy7896         561 ELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVDRYTLPNGNHIILLAEGRLVNLGCAMGHP  640 (718)
Q Consensus       561 ~~GA~v~~~~~nplstqd~vaaal~~~gi~v~a~~ge~~eey~~~~~~~l~~~~~~~~~~~~i~ddggdl~~~~~~~~~~  640 (718)
                                                                         |.++|++|-+||+...|+|+||+|++|||
T Consensus       327 ---------------------------------------------------D~~~~~~gr~iIlLAeGRLvNL~Catghp  355 (434)
T KOG1370|consen  327 ---------------------------------------------------DRYILPNGKHIILLAEGRLVNLGCATGHP  355 (434)
T ss_pred             ---------------------------------------------------ceeeccCCcEEEEEecCceeecccccCCC
Confidence                                                               55678999999999999999999999999


Q ss_pred             cceechhHHhHHHHHHHHHhcc-CCCCCceeeCChhhHHHHHHHhhhhcCcccccCCHHHHhhcCCCCCCCCCCCCCCC
Q psy7896         641 SFVMSNSFTNQVLAQIELWTKH-SQYPVGVYMLPKKLDEEVAALHLEHLGVKLTKLTEDQAKYLGLPIEGPYKPDHYRY  718 (718)
Q Consensus       641 ~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  718 (718)
                      |||||+|||||||||||||+++ ++|+.|||.|||+|||+||.+||.+||++|||||++|++|||++.+||||||||||
T Consensus       356 SFvmS~sftnQvlAqIeLwt~p~~kY~~~V~~LPKklDE~VA~lHL~kl~~kLTkLt~~Qa~YlG~~~~gPfKpdhYRY  434 (434)
T KOG1370|consen  356 SFVMSNSFTNQVLAQIELWTAPEGKYKVGVYVLPKKLDEYVASLHLGKLGAKLTKLTDKQAKYLGLSKDGPFKPDHYRY  434 (434)
T ss_pred             ceEEecchHHHHHHHHHHhcCCCCccccceEecchhhHHHHHHhhhhhhchhhhhhhHHHHHhcCCCcCCCCCCCCCCC
Confidence            9999999999999999999999 79999999999999999999999999999999999999999999999999999999



>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF05221 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; InterPro: IPR000043 Adenosylhomocysteinase (S-adenosyl-L-homocysteine hydrolase, 3 Back     alignment and domain information
>PF05221 AdoHcyase: S-adenosyl-L-homocysteine hydrolase; InterPro: IPR000043 Adenosylhomocysteinase (S-adenosyl-L-homocysteine hydrolase, 3 Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>KOG1370|consensus Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>KOG0067|consensus Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2380|consensus Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG4230|consensus Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>KOG0089|consensus Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query718
3d64_A494 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 7e-84
3d64_A494 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 4e-39
3n58_A464 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 1e-80
3n58_A464 Crystal Structure Of S-Adenosyl-L-Homocysteine Hydr 1e-34
3ond_A488 Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Ho 3e-79
3ond_A488 Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Ho 2e-38
1li4_A432 Human S-Adenosylhomocysteine Hydrolase Complexed Wi 2e-77
1li4_A432 Human S-Adenosylhomocysteine Hydrolase Complexed Wi 3e-53
1li4_A432 Human S-Adenosylhomocysteine Hydrolase Complexed Wi 3e-45
3nj4_A435 Fluoro-Neplanocin A In Human S-Adenosylhomocysteine 2e-77
3nj4_A435 Fluoro-Neplanocin A In Human S-Adenosylhomocysteine 3e-53
3nj4_A435 Fluoro-Neplanocin A In Human S-Adenosylhomocysteine 3e-45
1b3r_A431 Rat Liver S-Adenosylhomocystein Hydrolase Length = 3e-76
1b3r_A431 Rat Liver S-Adenosylhomocystein Hydrolase Length = 1e-53
1b3r_A431 Rat Liver S-Adenosylhomocystein Hydrolase Length = 9e-47
1xwf_A431 K185n Mutated S-adenosylhomocysteine Hydrolase Leng 9e-76
1xwf_A431 K185n Mutated S-adenosylhomocysteine Hydrolase Leng 1e-53
1xwf_A431 K185n Mutated S-adenosylhomocysteine Hydrolase Leng 1e-46
1d4f_A431 Crystal Structure Of Recombinant Rat-Liver D244e Mu 9e-76
1d4f_A431 Crystal Structure Of Recombinant Rat-Liver D244e Mu 3e-53
1d4f_A431 Crystal Structure Of Recombinant Rat-Liver D244e Mu 9e-47
1v8b_A479 Crystal Structure Of A Hydrolase Length = 479 1e-71
1v8b_A479 Crystal Structure Of A Hydrolase Length = 479 2e-31
1a7a_A432 Structure Of Human Placental S-adenosylhomocysteine 7e-68
1a7a_A432 Structure Of Human Placental S-adenosylhomocysteine 4e-61
1a7a_A432 Structure Of Human Placental S-adenosylhomocysteine 3e-50
1a7a_A432 Structure Of Human Placental S-adenosylhomocysteine 5e-43
3g1u_A437 Crystal Structure Of Leishmania Major S- Adenosylho 1e-62
3g1u_A437 Crystal Structure Of Leishmania Major S- Adenosylho 1e-55
3g1u_A437 Crystal Structure Of Leishmania Major S- Adenosylho 2e-43
3g1u_A437 Crystal Structure Of Leishmania Major S- Adenosylho 3e-43
3h9u_A436 S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypa 2e-61
3h9u_A436 S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypa 4e-53
3h9u_A436 S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypa 9e-45
3h9u_A436 S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypa 9e-44
3dhy_A495 Crystal Structures Of Mycobacterium Tuberculosis S- 3e-59
3dhy_A495 Crystal Structures Of Mycobacterium Tuberculosis S- 7e-37
3ce6_A494 Crystal Structure Of Mycobacterium Tuberculosis S-A 3e-59
3ce6_A494 Crystal Structure Of Mycobacterium Tuberculosis S-A 7e-37
3gvp_A435 Human Sahh-Like Domain Of Human Adenosylhomocystein 4e-56
3gvp_A435 Human Sahh-Like Domain Of Human Adenosylhomocystein 3e-26
3gvp_A 435 Human Sahh-Like Domain Of Human Adenosylhomocystein 1e-24
3gvp_A435 Human Sahh-Like Domain Of Human Adenosylhomocystein 2e-23
3mtg_A444 Crystal Structure Of Human S-Adenosyl Homocysteine 9e-49
3mtg_A444 Crystal Structure Of Human S-Adenosyl Homocysteine 3e-47
3mtg_A444 Crystal Structure Of Human S-Adenosyl Homocysteine 5e-26
>pdb|3D64|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Burkholderia Pseudomallei Length = 494 Back     alignment and structure

Iteration: 1

Score = 308 bits (789), Expect = 7e-84, Method: Compositional matrix adjust. Identities = 168/315 (53%), Positives = 207/315 (65%), Gaps = 28/315 (8%) Query: 1 MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLL 60 +ADI LA WGRK + +AE EMPGL+ +R +Y AQ+ LKGARIAG LHMT+QT VLIETL Sbjct: 37 VADIALAGWGRKELNIAETEMPGLVQIRDEYKAQQPLKGARIAGSLHMTIQTGVLIETLK 96 Query: 61 ELGAEVQWSSCNIFSTQDHXXXXXXXXXXXXXXWKGETDEEYVWCIEQTLVFPDGKPLNM 120 LGA+V+W+SCNIFSTQDH +KGE+ +EY + +P+G+ NM Sbjct: 97 ALGADVRWASCNIFSTQDHAAAAIVEAGTPVFAFKGESLDEYWEFSHRIFEWPNGEFANM 156 Query: 121 ILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKP 180 ILDDGGD T L+ I G E V + P ++ K Sbjct: 157 ILDDGGDATLLL----------ILGSKAEKDRSV-----------IARPTNEEEVALFKS 195 Query: 181 LNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSV 240 + L+ G Y + L+ I+G++EETTTGVH LY+M K+ +L PA NVNDSV Sbjct: 196 IERHLEIDGSW-------YSKRLAHIKGVTEETTTGVHRLYQMEKDGRLPFPAFNVNDSV 248 Query: 241 TKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEI 300 TKSKFDNLYGCRESLVDG+KRATD+M+AGK+AVVAGYGDVGKGCAQSLR G+ V VTEI Sbjct: 249 TKSKFDNLYGCRESLVDGIKRATDVMIAGKIAVVAGYGDVGKGCAQSLRGLGATVWVTEI 308 Query: 301 DPINALQASMEGYEL 315 DPI ALQA+MEGY + Sbjct: 309 DPICALQAAMEGYRV 323
>pdb|3D64|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Burkholderia Pseudomallei Length = 494 Back     alignment and structure
>pdb|3N58|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Brucella Melitensis In Ternary Complex With Nad And Adenosine, Orthorhombic Form Length = 464 Back     alignment and structure
>pdb|3N58|A Chain A, Crystal Structure Of S-Adenosyl-L-Homocysteine Hydrolase From Brucella Melitensis In Ternary Complex With Nad And Adenosine, Orthorhombic Form Length = 464 Back     alignment and structure
>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Homocysteine Hydrolase In Complex With Adenosine Length = 488 Back     alignment and structure
>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-Adenosyl-L-Homocysteine Hydrolase In Complex With Adenosine Length = 488 Back     alignment and structure
>pdb|1LI4|A Chain A, Human S-Adenosylhomocysteine Hydrolase Complexed With Neplanocin Length = 432 Back     alignment and structure
>pdb|1LI4|A Chain A, Human S-Adenosylhomocysteine Hydrolase Complexed With Neplanocin Length = 432 Back     alignment and structure
>pdb|1LI4|A Chain A, Human S-Adenosylhomocysteine Hydrolase Complexed With Neplanocin Length = 432 Back     alignment and structure
>pdb|3NJ4|A Chain A, Fluoro-Neplanocin A In Human S-Adenosylhomocysteine Hydrolase Length = 435 Back     alignment and structure
>pdb|3NJ4|A Chain A, Fluoro-Neplanocin A In Human S-Adenosylhomocysteine Hydrolase Length = 435 Back     alignment and structure
>pdb|3NJ4|A Chain A, Fluoro-Neplanocin A In Human S-Adenosylhomocysteine Hydrolase Length = 435 Back     alignment and structure
>pdb|1B3R|A Chain A, Rat Liver S-Adenosylhomocystein Hydrolase Length = 431 Back     alignment and structure
>pdb|1B3R|A Chain A, Rat Liver S-Adenosylhomocystein Hydrolase Length = 431 Back     alignment and structure
>pdb|1B3R|A Chain A, Rat Liver S-Adenosylhomocystein Hydrolase Length = 431 Back     alignment and structure
>pdb|1XWF|A Chain A, K185n Mutated S-adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1XWF|A Chain A, K185n Mutated S-adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1XWF|A Chain A, K185n Mutated S-adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1D4F|A Chain A, Crystal Structure Of Recombinant Rat-Liver D244e Mutant S- Adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1D4F|A Chain A, Crystal Structure Of Recombinant Rat-Liver D244e Mutant S- Adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1D4F|A Chain A, Crystal Structure Of Recombinant Rat-Liver D244e Mutant S- Adenosylhomocysteine Hydrolase Length = 431 Back     alignment and structure
>pdb|1V8B|A Chain A, Crystal Structure Of A Hydrolase Length = 479 Back     alignment and structure
>pdb|1V8B|A Chain A, Crystal Structure Of A Hydrolase Length = 479 Back     alignment and structure
>pdb|1A7A|A Chain A, Structure Of Human Placental S-adenosylhomocysteine Hydrolase: Determination Of A 30 Selenium Atom Substructure From Data At A Single Wavelength Length = 432 Back     alignment and structure
>pdb|1A7A|A Chain A, Structure Of Human Placental S-adenosylhomocysteine Hydrolase: Determination Of A 30 Selenium Atom Substructure From Data At A Single Wavelength Length = 432 Back     alignment and structure
>pdb|1A7A|A Chain A, Structure Of Human Placental S-adenosylhomocysteine Hydrolase: Determination Of A 30 Selenium Atom Substructure From Data At A Single Wavelength Length = 432 Back     alignment and structure
>pdb|1A7A|A Chain A, Structure Of Human Placental S-adenosylhomocysteine Hydrolase: Determination Of A 30 Selenium Atom Substructure From Data At A Single Wavelength Length = 432 Back     alignment and structure
>pdb|3G1U|A Chain A, Crystal Structure Of Leishmania Major S- Adenosylhomocysteine Hydrolase Length = 437 Back     alignment and structure
>pdb|3G1U|A Chain A, Crystal Structure Of Leishmania Major S- Adenosylhomocysteine Hydrolase Length = 437 Back     alignment and structure
>pdb|3G1U|A Chain A, Crystal Structure Of Leishmania Major S- Adenosylhomocysteine Hydrolase Length = 437 Back     alignment and structure
>pdb|3G1U|A Chain A, Crystal Structure Of Leishmania Major S- Adenosylhomocysteine Hydrolase Length = 437 Back     alignment and structure
>pdb|3H9U|A Chain A, S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypanosoma Brucei Length = 436 Back     alignment and structure
>pdb|3H9U|A Chain A, S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypanosoma Brucei Length = 436 Back     alignment and structure
>pdb|3H9U|A Chain A, S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypanosoma Brucei Length = 436 Back     alignment and structure
>pdb|3H9U|A Chain A, S-Adenosyl Homocysteine Hydrolase (Sahh) From Trypanosoma Brucei Length = 436 Back     alignment and structure
>pdb|3DHY|A Chain A, Crystal Structures Of Mycobacterium Tuberculosis S-Adenosyl- Homocysteine Hydrolase In Ternary Complex With Substrate An Inhibitors Length = 495 Back     alignment and structure
>pdb|3DHY|A Chain A, Crystal Structures Of Mycobacterium Tuberculosis S-Adenosyl- Homocysteine Hydrolase In Ternary Complex With Substrate An Inhibitors Length = 495 Back     alignment and structure
>pdb|3CE6|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis S-Adenosyl-L- Homocysteine Hydrolase In Ternary Complex With Nad And Adenosine Length = 494 Back     alignment and structure
>pdb|3CE6|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis S-Adenosyl-L- Homocysteine Hydrolase In Ternary Complex With Nad And Adenosine Length = 494 Back     alignment and structure
>pdb|3GVP|A Chain A, Human Sahh-Like Domain Of Human Adenosylhomocysteinase 3 Length = 435 Back     alignment and structure
>pdb|3GVP|A Chain A, Human Sahh-Like Domain Of Human Adenosylhomocysteinase 3 Length = 435 Back     alignment and structure
>pdb|3GVP|A Chain A, Human Sahh-Like Domain Of Human Adenosylhomocysteinase 3 Length = 435 Back     alignment and structure
>pdb|3GVP|A Chain A, Human Sahh-Like Domain Of Human Adenosylhomocysteinase 3 Length = 435 Back     alignment and structure
>pdb|3MTG|A Chain A, Crystal Structure Of Human S-Adenosyl Homocysteine Hydrolase Protein Length = 444 Back     alignment and structure
>pdb|3MTG|A Chain A, Crystal Structure Of Human S-Adenosyl Homocysteine Hydrolase Protein Length = 444 Back     alignment and structure
>pdb|3MTG|A Chain A, Crystal Structure Of Human S-Adenosyl Homocysteine Hydrolase Protein Length = 444 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query718
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 1e-166
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 4e-72
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 5e-72
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 1e-65
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 9e-11
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 1e-153
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 2e-72
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 1e-60
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 3e-59
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 7e-11
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 1e-150
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 5e-72
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 4e-65
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 5e-62
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 2e-11
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 1e-148
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 1e-72
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 3e-71
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 2e-55
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 3e-11
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 1e-146
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 9e-73
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 7e-67
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 1e-56
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 4e-11
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 1e-118
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 4e-91
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 7e-73
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 3e-70
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 2e-65
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 6e-10
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 1e-117
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 1e-90
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 4e-72
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 7e-69
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 3e-59
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 7e-10
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 3e-13
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 4e-05
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 1e-04
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
 Score =  484 bits (1249), Expect = e-166
 Identities = 167/313 (53%), Positives = 205/313 (65%), Gaps = 28/313 (8%)

Query: 2   ADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLE 61
            DI LA+WGRK + +AE EMPGLMA R ++G  + LKGARI+G LHMT+QTAVLIETL  
Sbjct: 8   KDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKV 67

Query: 62  LGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNMI 121
           LGAEV+W+SCNIFSTQDHAAAAIAA G  V+A KGET EEY    +Q   +PDG+P NMI
Sbjct: 68  LGAEVRWASCNIFSTQDHAAAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMI 127

Query: 122 LDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVTKPL 181
           LDDGGD T  +                              E    V +   ++      
Sbjct: 128 LDDGGDATMYILIGAR------------------------AEAGEDVLSNPQSEEEEVLF 163

Query: 182 NMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVT 241
             I              + +  + I+G++EETTTGV+ LY++ K+  L  PAINVNDSVT
Sbjct: 164 AQIKKRMAATPG----FFTKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAINVNDSVT 219

Query: 242 KSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEID 301
           KSKFDN YGC+ESLVDG++R TD+M+AGKVAVV GYGDVGKG AQSL   G+RV VTE+D
Sbjct: 220 KSKFDNKYGCKESLVDGIRRGTDVMMAGKVAVVCGYGDVGKGSAQSLAGAGARVKVTEVD 279

Query: 302 PINALQASMEGYE 314
           PI ALQA+M+G+E
Sbjct: 280 PICALQAAMDGFE 292


>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Length = 464 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Length = 494 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Length = 488 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Length = 494 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Length = 479 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Length = 436 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Length = 435 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Length = 286 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query718
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 100.0
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 100.0
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 100.0
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 100.0
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 100.0
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 100.0
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 100.0
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 100.0
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 100.0
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 100.0
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 100.0
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 100.0
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 100.0
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 100.0
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 99.89
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.89
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.88
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 99.87
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.87
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.87
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.86
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.86
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 99.85
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 99.85
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.85
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 99.83
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.83
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 99.82
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.82
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 99.81
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 99.81
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 99.81
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.8
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 99.8
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 99.79
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 99.79
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.79
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.78
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 99.77
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 99.77
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.75
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 99.75
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.75
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.72
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.72
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.72
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.72
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 99.71
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.71
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.53
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.49
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 99.22
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 99.19
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 99.09
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 99.07
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 99.05
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 98.97
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.77
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 98.73
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.51
3fr7_A525 Putative ketol-acid reductoisomerase (OS05G057370 98.5
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 98.49
3p2o_A285 Bifunctional protein fold; structural genomics, ce 98.48
3l07_A285 Bifunctional protein fold; structural genomics, ID 98.45
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 98.44
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.44
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 98.4
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 98.39
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 98.39
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 98.39
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 98.35
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 98.33
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 98.32
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.32
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.31
3l6d_A306 Putative oxidoreductase; structural genomics, prot 98.31
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 98.29
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 98.28
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 98.26
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 98.23
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 98.21
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.2
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 98.2
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 97.5
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.18
3qha_A296 Putative oxidoreductase; seattle structural genomi 98.18
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 98.17
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 98.17
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 98.15
4ezb_A317 Uncharacterized conserved protein; structural geno 98.15
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 98.14
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 98.11
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 98.11
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 98.08
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 98.08
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 98.07
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 98.06
1vpd_A299 Tartronate semialdehyde reductase; structural geno 98.04
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 98.03
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 98.03
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 98.03
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 98.01
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.98
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 97.98
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.95
1yb4_A295 Tartronic semialdehyde reductase; structural genom 97.94
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.93
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 97.92
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 97.9
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 97.9
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 97.84
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.82
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 97.77
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 97.74
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 97.71
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 97.71
3ulk_A491 Ketol-acid reductoisomerase; branched-chain amino 97.7
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.7
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 97.69
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.64
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 97.63
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.59
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 97.59
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 97.59
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.58
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.58
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 97.56
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 97.56
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 97.56
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 97.53
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 97.53
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.53
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 97.48
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 97.48
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 97.47
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.47
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 97.46
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 97.46
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.46
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.45
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.45
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 97.45
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.45
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.45
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 97.43
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.42
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.4
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.39
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.39
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 97.38
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 97.35
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 97.35
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 97.32
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.31
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.31
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.27
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 97.25
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.25
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 97.24
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.22
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 97.21
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.21
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 97.18
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.17
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 97.17
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 97.15
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.14
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.12
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 97.11
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.11
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 97.09
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 97.09
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 97.09
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 97.08
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 97.08
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.07
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 97.07
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 97.07
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.06
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 97.04
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 97.02
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 97.01
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.99
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 96.98
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 96.97
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 96.97
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 96.97
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 96.96
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 96.95
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 96.94
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.94
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 96.93
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 96.9
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 96.9
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 96.86
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 96.83
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 96.81
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 96.81
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 96.81
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 96.8
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 96.79
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 96.79
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 96.79
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 96.78
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 96.76
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 96.74
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 96.71
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 96.7
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 96.69
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 96.67
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 96.66
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 96.65
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 96.64
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.62
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 96.61
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 96.61
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 96.61
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 96.6
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 96.6
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.59
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 96.57
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 96.56
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 96.55
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 96.54
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 96.54
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 96.53
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 96.52
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 96.51
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 96.5
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 96.5
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 96.5
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.49
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 96.49
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 96.49
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 96.46
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 96.46
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 96.44
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 96.43
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 96.43
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 96.4
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 96.39
4eye_A342 Probable oxidoreductase; structural genomics, niai 96.39
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 96.38
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.37
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 96.35
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 96.35
3fbg_A346 Putative arginate lyase; structural genomics, unkn 96.34
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 96.33
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.33
3sds_A353 Ornithine carbamoyltransferase, mitochondrial; str 96.29
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 96.28
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.28
1oth_A321 Protein (ornithine transcarbamoylase); transferase 96.28
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 96.27
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 96.27
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 96.26
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 96.25
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 96.23
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 96.22
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.22
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 96.21
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 96.2
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 96.18
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 96.18
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 96.18
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 96.17
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 96.16
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 96.15
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 96.15
2yfk_A418 Aspartate/ornithine carbamoyltransferase; transcar 96.15
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.13
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 96.12
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 96.12
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 96.11
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 96.1
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.1
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 96.08
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 96.07
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 96.07
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.06
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 96.05
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 96.04
3q98_A399 Transcarbamylase; rossmann fold, transferase; 2.00 96.04
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 96.03
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.03
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 96.03
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 96.01
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 96.01
3r9u_A315 Thioredoxin reductase; structural genomics, center 96.0
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 95.97
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 95.97
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 95.97
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 95.96
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 95.96
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 95.96
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 95.96
3gms_A340 Putative NADPH:quinone reductase; structural genom 95.95
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 95.94
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 95.9
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 95.9
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 95.9
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 95.89
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 95.89
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 95.88
4h31_A358 Otcase, ornithine carbamoyltransferase; structural 95.88
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 95.85
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 95.85
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.84
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 95.84
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 95.83
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 95.82
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 95.82
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 95.8
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 95.79
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 95.79
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 95.78
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 95.78
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 95.78
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 95.77
1js1_X324 Transcarbamylase; alpha/beta topology, two domains 95.77
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.76
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 95.75
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 95.73
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 95.73
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 95.73
3euw_A344 MYO-inositol dehydrogenase; protein structure init 95.72
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 95.72
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 95.7
3slk_A795 Polyketide synthase extender module 2; rossmann fo 95.7
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 95.7
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 95.7
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 95.7
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 95.7
4g65_A461 TRK system potassium uptake protein TRKA; structur 95.67
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 95.67
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 95.67
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 95.66
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 95.65
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 95.63
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 95.63
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 95.62
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 95.62
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 95.62
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 95.59
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 95.59
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 95.59
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 95.58
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 95.58
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 95.57
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 95.54
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 95.54
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 95.53
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 95.52
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 95.49
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 95.49
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 95.48
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 95.47
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 95.47
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 95.47
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 95.46
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 95.46
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 95.45
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.42
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 95.41
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 95.4
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 95.39
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 95.39
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 95.38
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 95.36
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 95.35
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 95.35
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 95.34
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 95.33
4fk1_A304 Putative thioredoxin reductase; structural genomic 95.33
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 95.33
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 95.32
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 95.31
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 95.3
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 95.24
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 95.24
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 95.22
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 95.22
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 95.2
4dna_A463 Probable glutathione reductase; structural genomic 95.2
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 95.17
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 95.17
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 95.16
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 95.16
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 95.16
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 95.14
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 95.13
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.11
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 95.11
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 95.1
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 95.09
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 95.06
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 95.05
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.05
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.04
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 95.04
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 95.04
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.01
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.0
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.0
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 94.99
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 94.98
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 94.96
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 94.95
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 94.95
1lnq_A336 MTHK channels, potassium channel related protein; 94.95
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 94.94
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 94.92
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 94.88
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 94.85
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 94.85
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 94.84
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 94.82
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 94.82
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 94.8
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 94.8
3krt_A456 Crotonyl COA reductase; structural genomics, prote 94.79
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 94.78
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 94.75
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 94.73
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 94.72
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 94.7
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 94.68
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 94.66
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 94.66
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 94.65
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 94.63
1fec_A490 Trypanothione reductase; redox-active center, oxid 94.6
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 94.52
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 94.47
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.43
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 94.42
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 94.4
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 94.38
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 94.36
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 94.35
1ydw_A362 AX110P-like protein; structural genomics, protein 94.33
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 94.32
4had_A350 Probable oxidoreductase protein; structural genomi 94.28
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 94.28
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 94.27
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 94.24
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 94.23
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.21
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 94.21
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 94.19
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 94.19
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 94.18
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 94.13
4gx0_A565 TRKA domain protein; membrane protein, ION channel 94.1
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 94.08
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 94.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 93.96
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 93.96
3tl2_A315 Malate dehydrogenase; center for structural genomi 93.93
3c85_A183 Putative glutathione-regulated potassium-efflux S 93.89
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 93.89
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 93.87
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 93.87
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 93.86
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 93.8
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 93.8
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 93.79
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 93.77
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 93.75
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 93.72
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 93.71
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 93.63
2duw_A145 Putative COA-binding protein; ligand binding prote 93.49
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 93.49
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 93.48
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 93.44
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 93.42
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 93.39
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 93.35
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 93.22
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 93.21
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 93.15
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 93.13
3ius_A286 Uncharacterized conserved protein; APC63810, silic 93.1
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 93.02
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 93.0
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 92.99
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 92.99
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.95
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 92.94
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 92.92
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 92.9
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 92.82
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 92.8
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 92.78
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 92.77
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 92.75
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 92.72
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 92.72
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 92.68
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
Probab=100.00  E-value=3.8e-134  Score=1107.76  Aligned_cols=453  Identities=59%  Similarity=0.907  Sum_probs=417.0

Q ss_pred             CCCccchHhhhhhHHHHHhhCchHHHHHHHhccCCCCCCcEEEEEeeccHhHHHHHHHHHHCCCEEEEeecCCCCCHHHH
Q psy7896           1 MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHA   80 (718)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~mp~l~~~~~~~~~~~pl~g~ri~~~lh~~~~ta~l~~~L~~~Ga~v~~~~~n~~stqd~~   80 (718)
                      |+||+||+|||++|+||++|||+||++|++|+++|||||+||++|+|||+|||+|+|||+++||||+|||||||||||||
T Consensus         7 v~d~~la~~G~~~i~~ae~~MP~L~~~r~~~~~~kPl~G~rI~~~lH~t~~TavlietL~a~GAev~~~~cN~~STqd~~   86 (464)
T 3n58_A            7 VKDISLADWGRKELDIAETEMPGLMAAREEFGKSQPLKGARISGSLHMTIQTAVLIETLKVLGAEVRWASCNIFSTQDHA   86 (464)
T ss_dssp             ESCGGGHHHHHHHHHHHHTTCHHHHHHHHHHTTTCTTTTCEEEEESCCSHHHHHHHHHHHHTTCEEEEECSSTTCCCHHH
T ss_pred             ccCchhHHHHHHHHHHHHhhCHHHHHHHHHHhccCCCCCCEEEEEEecHHHHHHHHHHHHHcCCeEEEecCCCCCCcHHH
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCeEEEecCCCHHHHHHHHHHHccCCCCCCceeEecCcchhHHHHHhhC-----hhhhhcccCCCcccchhHH
Q psy7896          81 AAAIAARGVAVYAWKGETDEEYVWCIEQTLVFPDGKPLNMILDDGGDLTNLVHEKY-----PQFLSEIRGISEETTTGVH  155 (718)
Q Consensus        81 aaal~~~gv~v~a~~~~~~~ey~~~~~~~~~~~~~~~~~~i~Ddggdl~~~~~~~~-----~~~~~~~~g~~eet~~g~~  155 (718)
                      ||||++.|||||||||||++|||||++++|+|+++.+||||+||||||++++|+..     +.+++.-      +..-.+
T Consensus        87 aaal~~~gi~v~A~kget~eey~~~~~~~l~~~~~~~p~~ilDDGgDl~~~~h~~~~~~~~~~~~~~~------~~~~~~  160 (464)
T 3n58_A           87 AAAIAATGTPVFAVKGETLEEYWTYTDQIFQWPDGEPSNMILDDGGDATMYILIGARAEAGEDVLSNP------QSEEEE  160 (464)
T ss_dssp             HHHHHHTTCCEEECTTCCHHHHHHHHHHTTCCTTSCCCSEEEESSSHHHHHHHHHHHHHTTCCCSSSC------CSHHHH
T ss_pred             HHHHHhcCCeEEEeCCCCHHHHHHHHHHHHcccCCCCCCEEEECchHHHHHHHhhhhhhcccccCCCC------CcHHHH
Confidence            99999999999999999999999999999999888778999999999999999432     1111111      111222


Q ss_pred             hHHHHHhhcccCCCccccCCCCCccceeeecccccccccccccccccccccccccccchhhhhhhHHHHhcCCccceEEE
Q psy7896         156 NLYKMFKENKLGVPAINVNDSVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAIN  235 (718)
Q Consensus       156 ~~~~~~~~~~l~~p~~~~~~s~~k~~~~~~d~ggyf~~~~~~~~~~~~~~~~Gv~E~T~sG~~rl~~~~~~g~l~~Pv~~  235 (718)
                      -|++.++..                           ....+++|+++.+++.|++|+|+|||||||+|+++|.|.|||+|
T Consensus       161 ~~~~~~~~~---------------------------~~~~~~~~~~~~~~i~G~~EeTtTGv~rL~~m~~~g~L~~Pvin  213 (464)
T 3n58_A          161 VLFAQIKKR---------------------------MAATPGFFTKQRAAIKGVTEETTTGVNRLYQLQKKGLLPFPAIN  213 (464)
T ss_dssp             HHHHHHHHH---------------------------HHHSTTHHHHHHHHCCEEEECSHHHHHHHHHHHHHTCCCSCEEE
T ss_pred             HHHHHHHHH---------------------------hhcCcchhHHHHhhccceeeccccchHHHHHHHHcCCCCCCEEe
Confidence            334444322                           22344678889999999999999999999999999999999999


Q ss_pred             ecCCcccccccccccchhhHHHHHhhhcccccCCcEEEEEecCCCChhHHHHHHhcCCeEEEeecCchhhhhhhhhhhhh
Q psy7896         236 VNDSVTKSKFDNLYGCRESLVDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYEL  315 (718)
Q Consensus       236 v~ds~~K~~fd~~~G~~es~~~~i~r~t~~~~~Gk~vvViGyG~vG~~~A~aLra~Gv~VtV~D~dp~r~v~AvaeGf~L  315 (718)
                      ||||++|++|||+|||+||+++++.|+++                                                   
T Consensus       214 Vnds~tK~~fDn~yG~~eslvdgI~Ratg---------------------------------------------------  242 (464)
T 3n58_A          214 VNDSVTKSKFDNKYGCKESLVDGIRRGTD---------------------------------------------------  242 (464)
T ss_dssp             CTTSHHHHTTHHHHHHHHHHHHHHHHHHC---------------------------------------------------
T ss_pred             eccHhhhhhhhhhhcchHHHHHHHHHhcC---------------------------------------------------
Confidence            99999999999999999999999998644                                                   


Q ss_pred             hHHHHHHHHHHhcccccccchhhhhhhcccccCcEEEEEecChhHHHHHHHHHhCCCEEEEEecCCccHHHHhhcCceec
Q psy7896         316 DEEVAALHLEHLGVKLTKLTEDQAKYLDIMLAGKVAVVAGYGDVGKGCAQSLRLFGSRVIVTEIDPINALQASMEGYEVT  395 (718)
Q Consensus       316 ~r~i~~~~l~~lgv~~~~~~~~~~~~~g~eL~GktVGIIG~G~IG~~vA~~l~~fGa~Viv~d~dp~~al~a~~~G~~v~  395 (718)
                                                  .++.||||+|+|+|+||+.+|++|++|||+|+++|++|.++.++.++|++++
T Consensus       243 ----------------------------~~L~GKTVgVIG~G~IGr~vA~~lrafGa~Viv~d~dp~~a~~A~~~G~~vv  294 (464)
T 3n58_A          243 ----------------------------VMMAGKVAVVCGYGDVGKGSAQSLAGAGARVKVTEVDPICALQAAMDGFEVV  294 (464)
T ss_dssp             ----------------------------CCCTTCEEEEECCSHHHHHHHHHHHHTTCEEEEECSSHHHHHHHHHTTCEEC
T ss_pred             ----------------------------CcccCCEEEEECcCHHHHHHHHHHHHCCCEEEEEeCCcchhhHHHhcCceec
Confidence                                        4577899999999999999999999999999999999988888888999999


Q ss_pred             CHHHHhccCcEEEEcCCCCCCcCHHHHhcCCCCeEEEEcCCCCccccHHHHhccccceeeecCCcccCccccchhhHHHH
Q psy7896         396 TMEEAAKEGGIFVTTTGCKDIIRGEHFLQMRDDAIVCNIGHFDCEIQVSWLDKNAVEKVNVKPQVSPTSRTKHLTTEALL  475 (718)
Q Consensus       396 ~Leell~~aDiIi~atgt~~lI~~e~l~~MK~gAiLIN~GRgd~Eid~~aL~~~~l~~~~v~P~V~v~s~e~~~~~eal~  475 (718)
                      ++++++++||||+++++|+++|++++|++||+|++|||+|||+.|+|.++|.+  ..+.+++|+|               
T Consensus       295 ~LeElL~~ADIVv~atgt~~lI~~e~l~~MK~GAILINvGRgdvEID~~aL~~--~~~~~ik~~v---------------  357 (464)
T 3n58_A          295 TLDDAASTADIVVTTTGNKDVITIDHMRKMKDMCIVGNIGHFDNEIQVAALRN--LKWTNVKPQV---------------  357 (464)
T ss_dssp             CHHHHGGGCSEEEECCSSSSSBCHHHHHHSCTTEEEEECSSSTTTBTCGGGTT--SEEEEEETTE---------------
T ss_pred             cHHHHHhhCCEEEECCCCccccCHHHHhcCCCCeEEEEcCCCCcccCHHHHHh--CccccccCCe---------------
Confidence            99999999999999999999999999999999999999999999999999986  5778899999               


Q ss_pred             hhhcccccccccccccCCcccccccccchhhcccchhhhHHHHhcChHHHHHHHHhcccccCCceEEEeeecchhhHHHH
Q psy7896         476 ATCNSLFKYSLVNTIHEAPTLLVHLSTDIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVL  555 (718)
Q Consensus       476 n~~~~~~~~nlv~~~h~~a~~~~Y~i~D~~La~~G~~kI~wa~~~MP~L~~Lr~~f~~~kpl~G~~i~~~lh~~~~Ta~L  555 (718)
                                                                                                      
T Consensus       358 --------------------------------------------------------------------------------  357 (464)
T 3n58_A          358 --------------------------------------------------------------------------------  357 (464)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHHcCCeEEeeccCcCCchHHHHHHHHhcCceEEEeeCCChHHHHHHHHHHhhcceecCCCCeEEEecCCccccccc
Q psy7896         556 IETLLELGAEVQWSSCNIFSTQDHAAAAIAARGVAVYAWKGETDEEYVWCIEQTLVDRYTLPNGNHIILLAEGRLVNLGC  635 (718)
Q Consensus       556 ~~~l~~~GA~v~~~~~nplstqd~vaaal~~~gi~v~a~~ge~~eey~~~~~~~l~~~~~~~~~~~~i~ddggdl~~~~~  635 (718)
                                                                              +.++++||..||+...|+||||+|
T Consensus       358 --------------------------------------------------------~~~~~~~g~~i~lLaeGrlvNL~~  381 (464)
T 3n58_A          358 --------------------------------------------------------DLIEFPDGKRLILLSEGRLLNLGN  381 (464)
T ss_dssp             --------------------------------------------------------EEEECTTSCEEEEEGGGSBHHHHH
T ss_pred             --------------------------------------------------------eEEEeCCCCEEEEEeCCceecccC
Confidence                                                                    555689999999999999999999


Q ss_pred             cCCCCcceechhHHhHHHHHHHHHhccCCCCCceeeCChhhHHHHHHHhhhhcCcccccCCHHHHhhcCCCCCCCCCCCC
Q psy7896         636 AMGHPSFVMSNSFTNQVLAQIELWTKHSQYPVGVYMLPKKLDEEVAALHLEHLGVKLTKLTEDQAKYLGLPIEGPYKPDH  715 (718)
Q Consensus       636 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  715 (718)
                      ++||||||||+||+||+|||+|||+++++|++|||.|||+|||+||++||++||++||+||++|++|||+|.+|||||||
T Consensus       382 a~GhP~~vm~~sf~~Q~la~~~l~~~~~~~~~~v~~lP~~lDe~VA~l~L~~~g~~l~~lt~~Q~~yl~~~~~gp~k~~~  461 (464)
T 3n58_A          382 ATGHPSFVMSASFTNQVLGQIELFTRTDAYKNEVYVLPKHLDEKVARLHLDKLGAKLTVLSEEQAAYIGVTPQGPFKSEH  461 (464)
T ss_dssp             SCCSCHHHHHHHHHHHHHHHHHHHHSGGGCCSSEECCCHHHHHHHHHHHHGGGTCCCCCCCHHHHHHHTCCTTSCCSCTT
T ss_pred             CCCChHHHHhHHHHHHHHHHHHHHhCccccCCCeeECCHHHHHHHHHHHHHHcCCEeccCCHHHHHHcCCCCCCCCCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCC
Q psy7896         716 YRY  718 (718)
Q Consensus       716 ~~~  718 (718)
                      |||
T Consensus       462 yry  464 (464)
T 3n58_A          462 YRY  464 (464)
T ss_dssp             CCC
T ss_pred             CCC
Confidence            999



>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 718
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 1e-93
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 9e-47
d1v8ba2313 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystei 5e-44
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 2e-89
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 1e-78
d1li4a2267 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystei 5e-45
d1v8ba1163 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolas 6e-45
d1v8ba1163 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolas 4e-31
d1v8ba1163 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolas 2e-11
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 1e-36
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 4e-27
d1li4a1163 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolas 4e-11
d1c1da1201 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {R 7e-05
d1pjqa1113 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 5e-04
d1hwxa1293 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow ( 0.003
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: S-adenosylhomocystein hydrolase
domain: S-adenosylhomocystein hydrolase
species: Plasmodium falciparum, isolate 3D7 [TaxId: 5833]
 Score =  291 bits (746), Expect = 1e-93
 Identities = 128/358 (35%), Positives = 183/358 (51%), Gaps = 70/358 (19%)

Query: 2   ADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLE 61
            DI LA +G+  + ++ENEMPGLM +R +YG  + LK A+I GCLHMTV+ A+LIETL +
Sbjct: 6   KDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIETLQK 65

Query: 62  LGAEVQWSSCNIFSTQDHAAAAI-AARGVAVYAWKGETDEEYVWCIEQTLVFPDGKP--L 118
           LGA+++W SCNI+ST D+AAAA+     V V+AWK ET EEY WC+E  L + DG     
Sbjct: 66  LGAQIRWCSCNIYSTADYAAAAVSTLENVTVFAWKNETLEEYWWCVESALTWGDGDDNGP 125

Query: 119 NMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVNDSVT 178
           +MI+DDGGD T LVH+                      LY+  ++N L  P    N+   
Sbjct: 126 DMIVDDGGDATLLVHKGVE----------------YEKLYE--EKNILPDPEKAKNEEER 167

Query: 179 KPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVND 238
             L ++ +          +K+     +I G+SEETTTGV  L KM K+N+L   AINVND
Sbjct: 168 CFLTLLKNSILKNP----KKWTNIAKKIIGVSEETTTGVLRLKKMDKQNELLFTAINVND 223

Query: 239 SVTKSKFDN------LYGCRESL--VDGLKRATDIMLAGKVAVVAGYGDVGKGCAQSLRL 290
           +VTK K+D+         C ++   +D  +         KV ++                
Sbjct: 224 AVTKQKYDHPAFVMSFSFCNQTFAQLDLWQNKDTNKYENKVYLLPK-------------- 269

Query: 291 FGSRVIVTEIDPINALQASMEGYELDEEVAALHLEHLGVKLTKLTEDQAKYLDIMLAG 348
                                   LDE+VA  HL+ L   LT+L ++Q ++L +  +G
Sbjct: 270 -----------------------HLDEKVALYHLKKLNASLTELDDNQCQFLGVNKSG 304


>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 313 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 267 Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 163 Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 163 Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 163 Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 163 Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Length = 201 Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Length = 113 Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Length = 293 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query718
d1v8ba2313 S-adenosylhomocystein hydrolase {Plasmodium falcip 100.0
d1li4a2267 S-adenosylhomocystein hydrolase {Human (Homo sapie 100.0
d1v8ba2313 S-adenosylhomocystein hydrolase {Plasmodium falcip 100.0
d1li4a2267 S-adenosylhomocystein hydrolase {Human (Homo sapie 100.0
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 100.0
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 100.0
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 99.85
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 99.85
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.84
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.83
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.82
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.81
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.8
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.79
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 98.7
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.67
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 98.65
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 98.58
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.4
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 98.23
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 98.22
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 98.19
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 98.16
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 98.15
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 98.15
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 98.11
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 98.11
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.04
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 98.01
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.98
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.87
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.86
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.81
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 97.77
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.77
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.71
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.67
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.67
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.63
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.58
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 97.52
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 97.5
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.44
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 97.4
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.37
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 97.34
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 97.33
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.3
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 97.28
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 97.28
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.26
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 97.2
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 97.2
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 97.2
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.19
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.15
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 97.15
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 97.14
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 96.97
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.96
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 96.95
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.94
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.91
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.8
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.72
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 96.72
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.71
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.65
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.64
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.63
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 96.56
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.5
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.45
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.37
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.37
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 96.35
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 96.33
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.32
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.3
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.28
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 96.27
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.25
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 96.23
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.2
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.07
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.04
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 96.03
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.02
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 95.99
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.97
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.87
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.87
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.83
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.81
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.81
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.7
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 95.68
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.65
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.56
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 95.54
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.46
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 95.46
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.43
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 95.37
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.34
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.33
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 95.32
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.3
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.26
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.22
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 95.21
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 95.21
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 95.19
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.18
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.16
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.16
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.14
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.14
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.13
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.05
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.04
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.03
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 95.01
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.99
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.98
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.95
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 94.94
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 94.9
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.89
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 94.89
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.88
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.87
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 94.86
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.83
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.72
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.7
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 94.67
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 94.66
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.63
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 94.62
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.62
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.56
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.54
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.53
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 94.53
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.5
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.47
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.45
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.45
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 94.43
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 94.41
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 94.39
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 94.39
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 94.36
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 94.28
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 94.26
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 94.24
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 94.17
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 94.14
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 94.12
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.07
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 94.06
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.04
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.03
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.03
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.01
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.0
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 93.97
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 93.91
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 93.9
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 93.85
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 93.83
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.83
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.75
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 93.75
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.75
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 93.69
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 93.68
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 93.58
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 93.58
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.53
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 93.5
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.41
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 93.28
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 93.23
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.21
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 93.2
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 93.19
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 93.17
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 93.15
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 93.01
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.88
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 92.83
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.8
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 92.79
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 92.79
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.73
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.72
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 92.7
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 92.65
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 92.58
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 92.51
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 92.5
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 92.49
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 92.47
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 92.46
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 92.42
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 92.38
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 92.18
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 92.11
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 92.08
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 92.03
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 92.01
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.98
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 91.91
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 91.89
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 91.87
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 91.84
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 91.84
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 91.79
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 91.78
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 91.72
d1qp8a2121 Putative formate dehydrogenase {Archaeon Pyrobacul 91.64
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.61
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 91.61
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 91.59
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 91.56
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.53
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 91.53
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 91.52
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 91.47
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.46
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 91.39
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 91.35
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 91.34
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 91.32
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 91.31
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 91.29
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 91.25
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 91.12
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 91.09
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 91.05
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 91.04
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 90.98
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 90.96
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 90.91
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 90.9
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 90.88
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 90.82
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.81
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 90.79
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 90.78
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 90.77
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 90.71
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 90.66
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 90.48
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 90.4
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 90.38
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 90.22
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 90.2
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 90.18
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 90.11
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 90.02
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 90.0
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 89.99
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 89.94
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 89.88
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 89.87
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 89.86
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 89.85
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 89.85
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 89.72
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 89.71
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.62
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 89.47
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 89.37
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 89.34
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 89.32
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 89.26
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 89.19
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 89.19
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 89.14
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 89.11
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 89.1
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 89.05
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 88.99
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 88.94
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 88.89
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 88.89
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 88.82
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 88.81
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 88.73
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 88.71
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 88.63
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 88.63
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 88.41
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 88.31
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 88.3
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 88.29
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 88.13
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 88.11
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 88.07
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 87.99
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 87.98
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 87.92
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 87.86
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 87.75
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 87.72
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 87.71
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 87.6
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 87.54
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 87.48
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 87.42
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 87.35
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 87.24
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 87.19
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 87.15
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 87.13
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 87.08
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 86.98
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 86.88
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 86.85
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 86.82
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 86.79
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 86.67
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 86.37
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 86.28
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 86.27
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 86.22
d1js1x2161 Transcarbamylase-like protein {Bacteroides fragili 86.2
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 86.05
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 86.05
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 86.0
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 85.94
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 85.86
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 85.72
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 85.69
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 85.68
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 85.66
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 85.64
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 85.58
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 85.51
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 85.49
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 85.39
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 85.39
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 85.34
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 85.2
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 85.2
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 85.17
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 85.15
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 85.14
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 85.07
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 85.0
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 84.97
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 84.97
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 84.92
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 84.89
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 84.88
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 84.88
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 84.8
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 84.71
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 84.64
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 84.56
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 84.51
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 84.43
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 84.39
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 84.35
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 84.33
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 84.31
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 84.27
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 84.23
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 84.03
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 83.99
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 83.99
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 83.91
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 83.87
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 83.83
d2naca2186 Formate dehydrogenase {Pseudomonas sp., strain 101 83.77
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 83.73
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 83.72
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 83.67
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 83.59
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 83.49
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 83.43
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 83.36
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 83.09
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 83.06
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 83.06
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 83.05
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 82.61
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 82.61
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 82.12
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 81.91
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 81.86
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 81.31
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 81.27
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 81.03
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 80.92
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 80.85
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 80.84
d1gdha2129 D-glycerate dehydrogenase {Hyphomicrobium methylov 80.64
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 80.57
d1id1a_153 Rck domain from putative potassium channel Kch {Es 80.52
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 80.5
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 80.49
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 80.44
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 80.36
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 80.18
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 80.17
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 80.16
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 80.14
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 80.13
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: S-adenosylhomocystein hydrolase
domain: S-adenosylhomocystein hydrolase
species: Plasmodium falciparum, isolate 3D7 [TaxId: 5833]
Probab=100.00  E-value=3.6e-92  Score=738.35  Aligned_cols=222  Identities=49%  Similarity=0.774  Sum_probs=190.5

Q ss_pred             CCCccchHhhhhhHHHHHhhCchHHHHHHHhccCCCCCCcEEEEEeeccHhHHHHHHHHHHCCCEEEEeecCCCCCHHHH
Q psy7896           1 MADIKLAEWGRKTIIMAENEMPGLMALRRKYGAQKILKGARIAGCLHMTVQTAVLIETLLELGAEVQWSSCNIFSTQDHA   80 (718)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~mp~l~~~~~~~~~~~pl~g~ri~~~lh~~~~ta~l~~~L~~~Ga~v~~~~~n~~stqd~~   80 (718)
                      ||||+||+|||++|+||++|||+||++|++|+.+|||||+||++|||||+|||+|++||+++||+|+|||||||||||||
T Consensus         5 VkDisLA~~G~~~IewAe~eMP~L~alr~~~~~~kPlkG~rIagcLHmt~qTAvLietL~~~GAeV~~~scNp~STQD~v   84 (313)
T d1v8ba2           5 VKDISLAPFGKMQMEISENEMPGLMRIREEYGKDQPLKNAKITGCLHMTVECALLIETLQKLGAQIRWCSCNIYSTADYA   84 (313)
T ss_dssp             CSCGGGHHHHHHHHHHHGGGCHHHHHHHHHSTTTCTTTTCEEEEESCCSHHHHHHHHHHHHTTCEEEEECSSSSCCCHHH
T ss_pred             cCChhhhHHhHHHHHHHHHHCHHHHHHHHHHhccCCCCCCEEEEEEccHHHHHHHHHHHHHhCCeeEEeccCCcccchHH
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHh-CCCeEEEecCCCHHHHHHHHHHHccCCCCC--CceeEecCcchhHHHHHhhChhhhhcccCCCcccchhHHhH
Q psy7896          81 AAAIAA-RGVAVYAWKGETDEEYVWCIEQTLVFPDGK--PLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNL  157 (718)
Q Consensus        81 aaal~~-~gv~v~a~~~~~~~ey~~~~~~~~~~~~~~--~~~~i~Ddggdl~~~~~~~~~~~~~~~~g~~eet~~g~~~~  157 (718)
                      ||||++ .||+||||||||.+|||||++++|.|+|+.  +||||+|||||||+++|++...                .|+
T Consensus        85 AAAl~~~~gi~VfAwkGet~eey~~~i~~~L~~~dg~~~~P~~IlDDGgDlt~~vh~g~~~----------------E~l  148 (313)
T d1v8ba2          85 AAAVSTLENVTVFAWKNETLEEYWWCVESALTWGDGDDNGPDMIVDDGGDATLLVHKGVEY----------------EKL  148 (313)
T ss_dssp             HHHHTTSTTEEEECCTTCCHHHHHHHHHHHHCCSSSSSCSCSEEEESSSHHHHHHHHHHHH----------------HHH
T ss_pred             HHHhhccCCceEEEecCCCHHHHHHHHHHHHhcCCCCCCCCcEEeehhHHHHHHHHhcchh----------------ccc
Confidence            999987 799999999999999999999999998763  5699999999999999975421                244


Q ss_pred             HHHHhhcccCCCccccCCCCCccceeeecccccccccccccccccccccccccccchhhhhhhHHHHhcCCccceEEEec
Q psy7896         158 YKMFKENKLGVPAINVNDSVTKPLNMILDDGGDLTNLVHEKYPQFLSEIRGISEETTTGVHNLYKMFKENKLGVPAINVN  237 (718)
Q Consensus       158 ~~~~~~~~l~~p~~~~~~s~~k~~~~~~d~ggyf~~~~~~~~~~~~~~~~Gv~E~T~sG~~rl~~~~~~g~l~~Pv~~v~  237 (718)
                      |.  +.+.+..|..++|++.. ....++.  +.+ ...+.+|+...+++.|++|+|++||+||++|.++|+|.||+++||
T Consensus       149 ~~--~~~~lp~p~~~~n~~~~-~~~~~lk--~~~-~~~~~~~~~~~~~i~GvsEETTTGV~RL~~m~~~g~L~fPainVN  222 (313)
T d1v8ba2         149 YE--EKNILPDPEKAKNEEER-CFLTLLK--NSI-LKNPKKWTNIAKKIIGVSEETTTGVLRLKKMDKQNELLFTAINVN  222 (313)
T ss_dssp             HH--HHCCCCCGGGCSSHHHH-HHHHHHH--HHH-TTCTTHHHHHHTTCCEEEECSHHHHHHHHHHHHTTCCCSEEEECT
T ss_pred             cc--cccccCCCCCCCCHHHH-HHHHHHH--HHH-hhCcHHHHHhhhcEEEEeCCCCccHHhHHHHHHcCcceeeeEecC
Confidence            43  56677666655555311 1100010  011 112367889999999999999999999999999999999999999


Q ss_pred             CCccccc
Q psy7896         238 DSVTKSK  244 (718)
Q Consensus       238 ds~~K~~  244 (718)
                      |+++|++
T Consensus       223 DsvtK~~  229 (313)
T d1v8ba2         223 DAVTKQK  229 (313)
T ss_dssp             TSHHHHT
T ss_pred             cccCHHH
Confidence            9998875



>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba2 c.23.12.3 (A:4-234,A:398-479) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js1x2 c.78.1.1 (X:164-324) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure