Psyllid ID: psy78


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520---
MFFQLILMVSMQIISFIIVHKFAWFEPFVYTNAISYSCYENYAVFSISMFQYIILAITFSQGKPYRTPIYKNKLFILSIIIMTWVCIYITLIPSEFIIQFLQLRFPPNMQFPLIVIYLAICNFVLSLFIENFIIHYLLMIKFKRWSNDYKSCKYIGIENELDSNYMWPKLSSDPEPNYEILRGRSLWDIVIKSLDIITIVIPPALPATMTVGKLYALTRLKKYNISCINSRVINLMTVGKLYALTRLKKYNISCINSRVINVSGSINCVCFDKMFESTGWTLEEPMKFVPENIVSVLSEYTEQGYRVIALASRTLSIEDYKHLNYMKREDIEKDLEFLGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGISLSEAESPID
cHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHEEcccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHcHHHHHHcccccccccccccccccccccccccHHHcccccccEEEccccccHHHHHHHHHHHHHHccccEEEEcccEEEEcccccEEEEEEEEEEEEccccEEEEEEccccccEEEEEEccccHHHHHccccccccHHHHHHHHHHHcccEEEEEEEEEcccccHHHHHHHcHHHHHcccccccEEEEEcccccccHHHHHHHHHccccEEEEEccHHHHHHHHHHHccccccccEEEEEEccccccccccEEEEEEccccccccccccccccccHHHHccccccEEEEEEHHHHHHHHHHcccHHHHHHcccEEEEccccccHHHHHHHHHHcccEEEEEcccccccHHHHHccccccccccccccc
cHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHEEEEHHHHHHHEEEHEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEHHHccccccccccccccccccEccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccEEccccEEEEEEcccccEEEEEcccccEEEEEcccHHHHHHHccHEEEcccEccccHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccccccccEEEEEEEEcccccHHccHHHHHHHHcccEEEEEccccHHHHHHHHHccccEcccccEEEEEcccccccHHHHccccccccccccccEEEEcccccHHHcccccccEcEcccHHHHHHHHHHcHHHHHHHccccEEEEEccHHHHHHHHHHHHHcccEEEEEcccccccHHHHHccEEEEEcccccccc
MFFQLILMVSMQIISFIIVhkfawfepfvytnaisyscyeNYAVFSISMFQYIILAITfsqgkpyrtpiyknkLFILSIIIMTWVCIYITLIPSEFIIQFLqlrfppnmqfPLIVIYLAICNFVLSLFIENFIIHYLLMIKFKRWsndyksckyigieneldsnymwpklssdpepnyeilrgrsLWDIVIKSLDIitivippalpatmtVGKLYALTRLKKYNISCINSRVINLMTVGKLYALTRLKKYNISCINSRVINVSGSINCVCFDkmfestgwtleepmkfvpENIVSVLSEYTEQGYRVIALASRTLSIEDYKHLNYMKREDIEKDLEFLGLIILenrlkpqtEGVIKELKDARVKVVMITGDNIQTAISVAkecgiidpgetvvdvsavpgglkecpkvyfTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMcgdgandcGALRAAHagislseaespid
MFFQLILMVSMQIISFIIVHKFAWFEPFVYTNAISYSCYENYAVFSISMFQYIILAITFSQGKPYRTPIYKNKLFILSIIIMTWVCIYITLIPSEFIIQFLQLRFPPNMQFPLIVIYLAICNFVLSLFIENFIIHYLLMIKFKRWSNDYKSCKYIGIENELDSNYMWPKLSSDPEPNYEILRGRSLWDIVIKSLDIITIvippalpatMTVGKLYALTRLKKYNISCINSRVINLMTVGKLYALTRLKKYNISCINSRVINVSGSINCVCFDKMFESTGWTLEEPMKFVPENIVSVLSEYTEQGYRVIALasrtlsiedyKHLNYMKREDIEKDLEFLGLIILenrlkpqtegvIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSaiqtkakklnyskteeelglssgayKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAgislseaespid
MFFQLILMVSMQIISFIIVHKFAWFEPFVYTNAISYSCYENYAVFSISMFQYIILAITFSQGKPYRTPIYKNKLFILSIIIMTWVCIYITLIPSEFIIQFLQLRFPPNMQFPLIVIYLAICNFVLSLFIENFIIHYLLMIKFKRWSNDYKSCKYIGIENELDSNYMWPKLSSDPEPNYEILRGRSLWDIVIKSLDIITIVIPPALPATMTVGKLYALTRLKKYNISCINSRVINLMTVGKLYALTRLKKYNISCINSRVINVSGSINCVCFDKMFESTGWTLEEPMKFVPENIVSVLSEYTEQGYRVIALASRTLSIEDYKHLNYMKREDIEKDLEFLGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDqkqqlvlelqqlGYYVAMCGDGANDCGALRAAHAGISLSEAESPID
*FFQLILMVSMQIISFIIVHKFAWFEPFVYTNAISYSCYENYAVFSISMFQYIILAITFSQGKPYRTPIYKNKLFILSIIIMTWVCIYITLIPSEFIIQFLQLRFPPNMQFPLIVIYLAICNFVLSLFIENFIIHYLLMIKFKRWSNDYKSCKYIGIENELDSNYMWPKLSS**EPNYEILRGRSLWDIVIKSLDIITIVIPPALPATMTVGKLYALTRLKKYNISCINSRVINLMTVGKLYALTRLKKYNISCINSRVINVSGSINCVCFDKMFESTGWTLEEPMKFVPENIVSVLSEYTEQGYRVIALASRTLSIEDYKHLNYMKREDIEKDLEFLGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAG***********
MFFQLILMVSMQIISFIIVHKFAWFEPFVYTNAISYSCYENYAVFSISMFQYIILAITFSQGKPYRTPIYKNKLFILSIIIMTWVCIYITLIPSEFIIQFLQLRFPPNMQFPLIVIYLAICNFVLSLFIENFIIHYLLMIKFKRW***************LDSNYMWPKLSSDPEPNYEILRGRSLWDIVIKSLDIITIVIPPALPATMTVGKLYALTRLKKYNISCINS***********YALTRLKKYNISCI*******SGSINCVCFDKMFESTGWTLEEPMKFVPENIVSVLSEYTEQGYRVIALASRTLSIEDYKHLNYMKREDIEKDLEFLGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSA****************LGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGISLSEA*S***
MFFQLILMVSMQIISFIIVHKFAWFEPFVYTNAISYSCYENYAVFSISMFQYIILAITFSQGKPYRTPIYKNKLFILSIIIMTWVCIYITLIPSEFIIQFLQLRFPPNMQFPLIVIYLAICNFVLSLFIENFIIHYLLMIKFKRWSNDYKSCKYIGIENELDSNYMWPKLSSDPEPNYEILRGRSLWDIVIKSLDIITIVIPPALPATMTVGKLYALTRLKKYNISCINSRVINLMTVGKLYALTRLKKYNISCINSRVINVSGSINCVCFDKMFESTGWTLEEPMKFVPENIVSVLSEYTEQGYRVIALASRTLSIEDYKHLNYMKREDIEKDLEFLGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGIS*********
MFFQLILMVSMQIISFIIVHKFAWFEPFVYTNAISYSCYENYAVFSISMFQYIILAITFSQGKPYRTPIYKNKLFILSIIIMTWVCIYITLIPSEFIIQFLQLRFPPNMQFPLIVIYLAICNFVLSLFIENFIIHYLLMIKFKRWSNDYKSCKYIGIENELDSNYMWPKLSSDPEPNYEILRGRSLWDIVIKSLDIITIVIPPALPATMTVGKLYALTRLKKYNISCINSRVINLMTVGKLYALTRLKKYNISCINSRVINVSGSINCVCFDKMFESTGWTLEEPMKFVPENIVSVLSEYTEQGYRVIALASRTLSIEDYKHLNYMKREDIEKDLEFLGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGISLSEAE****
iHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFFQLILMVSMQIISFIIVHKFAWFEPFVYTNAISYSCYENYAVFSISMFQYIILAITFSQGKPYRTPIYKNKLFILSIIIMTWVCIYITLIPSEFIIQFLQLRFPPNMQFPLIVIYLAICNFVLSLFIENFIIHYLLMIKFKRWSNDYKSCKYIGIENELDSNYMWPKLSSDPEPNYEILRGRSLWDIVIKSLDIITIVIPPALPATMTVGKLYALTRLKKYNISCINSRVINLMTVGKLYALTRLKKYNISCINSRVINVSGSINCVCFDKMFESTGWTLEEPMKFVPENIVSVLSEYTEQGYRVIALASRTLSIEDYKHLNYMKREDIEKDLEFLGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGISLSEAESPID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query523
MGI|MGI:2685387 1219 Atp13a3 "ATPase type 13A3" [Mu 0.445 0.191 0.400 4.6e-61
UNIPROTKB|H0Y4Z2576 ATP13A4 "Probable cation-trans 0.443 0.402 0.432 1.8e-60
UNIPROTKB|E1C7N6 1223 ATP13A3 "Uncharacterized prote 0.447 0.191 0.404 2.2e-59
UNIPROTKB|G3V677 1219 LOC678704 "RCG36659, isoform C 0.445 0.191 0.400 1.2e-58
RGD|1590881 1249 Atp13a3 "ATPase type 13A3" [Ra 0.445 0.186 0.400 1.4e-58
UNIPROTKB|Q4VNC0 1218 ATP13A5 "Probable cation-trans 0.443 0.190 0.457 5.1e-58
UNIPROTKB|E1BG26 1226 ATP13A3 "Uncharacterized prote 0.441 0.188 0.405 4.9e-57
UNIPROTKB|Q4VNC1 1196 ATP13A4 "Probable cation-trans 0.443 0.193 0.432 7.5e-57
MGI|MGI:2444068 1216 Atp13a5 "ATPase type 13A5" [Mu 0.443 0.190 0.451 1.2e-56
UNIPROTKB|F1N272 1197 ATP13A4 "Uncharacterized prote 0.441 0.192 0.417 2.1e-56
MGI|MGI:2685387 Atp13a3 "ATPase type 13A3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 458 (166.3 bits), Expect = 4.6e-61, Sum P(4) = 4.6e-61
 Identities = 97/242 (40%), Positives = 152/242 (62%)

Query:   289 VPENIVSVLSEYTEQGYRVIALASRTLSIEDYKH-LNYMKREDIEKDLEFLGLIILENRL 347
             VP +   VL +YT+QG+RVIALA R L  +   H + ++ R+ IE +++F+GLII++N+L
Sbjct:   663 VPVDFEKVLEDYTKQGFRVIALAHRKLESKLTWHKVQHISRDAIENNMDFMGLIIMQNKL 722

Query:   348 KPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPK 407
             K +T  V+++L  A ++ VM+TGDN+ TA+SVA++CG+I P + V+   A+P    +  K
Sbjct:   723 KQETPAVLEDLHKANIRTVMVTGDNMLTAVSVARDCGMILPQDKVIIAEALPPKDGKVAK 782

Query:   408 V--YFT-----VSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPEL 460
             +  ++T      S  SAI ++A  +  +    E  L    Y FA+ GKS+ +I +   +L
Sbjct:   783 INWHYTDSLSQCSESSAIDSEAIPIKLAHDSLE-DLEVTRYHFAMNGKSFSVILEHFQDL 841

Query:   461 IPRIIVKGAIFARMSSDXXXXXXXXXXXXGYYVAMCGDGANDCGALRAAHAGISLSEAES 520
             +P++++ G +FARM+ D             Y+V MCGDGANDCGAL+ AH GISLSE E+
Sbjct:   842 VPKLMLHGTVFARMAPDQKTQLVEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELEA 901

Query:   521 PI 522
              +
Sbjct:   902 SV 903


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003674 "molecular_function" evidence=ND
GO:0005524 "ATP binding" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0006812 "cation transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0019829 "cation-transporting ATPase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|H0Y4Z2 ATP13A4 "Probable cation-transporting ATPase 13A4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7N6 ATP13A3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3V677 LOC678704 "RCG36659, isoform CRA_c" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1590881 Atp13a3 "ATPase type 13A3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4VNC0 ATP13A5 "Probable cation-transporting ATPase 13A5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BG26 ATP13A3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q4VNC1 ATP13A4 "Probable cation-transporting ATPase 13A4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2444068 Atp13a5 "ATPase type 13A5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N272 ATP13A4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query523
TIGR01657 1054 TIGR01657, P-ATPase-V, P-type ATPase of unknown pu 2e-71
COG0474 917 COG0474, MgtA, Cation transport ATPase [Inorganic 4e-42
TIGR01494543 TIGR01494, ATPase_P-type, ATPase, P-type (transpor 8e-27
TIGR01116 917 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic retic 8e-19
TIGR016571054 TIGR01657, P-ATPase-V, P-type ATPase of unknown pu 1e-16
TIGR01652 1057 TIGR01652, ATPase-Plipid, phospholipid-translocati 4e-15
TIGR01522 884 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium- 5e-15
TIGR01657 1054 TIGR01657, P-ATPase-V, P-type ATPase of unknown pu 6e-14
TIGR01524 867 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating 2e-13
TIGR01523 1053 TIGR01523, ATPase-IID_K-Na, potassium and/or sodiu 8e-13
TIGR01517 944 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium- 4e-12
TIGR01494543 TIGR01494, ATPase_P-type, ATPase, P-type (transpor 5e-12
TIGR01106 997 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux 4e-11
PRK15122 903 PRK15122, PRK15122, magnesium-transporting ATPase; 5e-10
PRK10517 902 PRK10517, PRK10517, magnesium-transporting ATPase 6e-10
TIGR01647 754 TIGR01647, ATPase-IIIA_H, plasma-membrane proton-e 2e-09
COG2217713 COG2217, ZntA, Cation transport ATPase [Inorganic 4e-09
pfam00702187 pfam00702, Hydrolase, haloacid dehalogenase-like h 6e-09
TIGR01511572 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-trans 3e-07
COG2217713 COG2217, ZntA, Cation transport ATPase [Inorganic 5e-07
TIGR01525556 TIGR01525, ATPase-IB_hvy, heavy metal translocatin 1e-06
TIGR01525556 TIGR01525, ATPase-IB_hvy, heavy metal translocatin 1e-06
TIGR01511572 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-trans 3e-06
TIGR01512536 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb 7e-06
PRK11033741 PRK11033, zntA, zinc/cadmium/mercury/lead-transpor 3e-05
COG2216681 COG2216, KdpB, High-affinity K+ transport system, 8e-05
PRK13582205 PRK13582, thrH, phosphoserine phosphatase; Provisi 2e-04
PLN03190 1178 PLN03190, PLN03190, aminophospholipid translocase; 2e-04
TIGR02137203 TIGR02137, HSK-PSP, phosphoserine phosphatase/homo 3e-04
TIGR01497675 TIGR01497, kdpB, K+-transporting ATPase, B subunit 7e-04
COG4087152 COG4087, COG4087, Soluble P-type ATPase [General f 0.001
PRK01122679 PRK01122, PRK01122, potassium-transporting ATPase 0.001
TIGR01512536 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb 0.002
pfam00122222 pfam00122, E1-E2_ATPase, E1-E2 ATPase 0.002
PRK10671834 PRK10671, copA, copper exporting ATPase; Provision 0.002
>gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
 Score =  245 bits (628), Expect = 2e-71
 Identities = 102/237 (43%), Positives = 146/237 (61%), Gaps = 5/237 (2%)

Query: 289 VPENIVSVLSEYTEQGYRVIALASRTLSIEDYKHLNYMKREDIEKDLEFLGLIILENRLK 348
           VP +   VL  YT +GYRV+ALA + L     +    + R+ +E +L FLG I+ EN LK
Sbjct: 599 VPSDYQEVLKSYTREGYRVLALAYKELPKLTLQKAQDLSRDAVESNLTFLGFIVFENPLK 658

Query: 349 PQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKV 408
           P T+ VIKELK A ++ VMITGDN  TA+ VA+ECGI++P  T++   A P    +  ++
Sbjct: 659 PDTKEVIKELKRASIRTVMITGDNPLTAVHVARECGIVNPSNTLILAEAEPPESGKPNQI 718

Query: 409 YFTV-SGVSAIQTKAKK--LNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPRII 465
            F V   +    T+ +        + E+L  S   Y  A++GK++ +++   PEL+ R++
Sbjct: 719 KFEVIDSIPFASTQVEIPYPLGQDSVEDLLASR--YHLAMSGKAFAVLQAHSPELLLRLL 776

Query: 466 VKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGISLSEAESPI 522
               +FARM+ DQK+ LV  LQ+L Y V MCGDGANDCGAL+ A  GISLSEAE+ +
Sbjct: 777 SHTTVFARMAPDQKETLVELLQKLDYTVGMCGDGANDCGALKQADVGISLSEAEASV 833


These P-type ATPases form a distinct clade but the substrate of their pumping activity has yet to be determined. This clade has been designated type V in. Length = 1054

>gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233438 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>gnl|CDD|233277 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>gnl|CDD|233509 TIGR01652, ATPase-Plipid, phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>gnl|CDD|130587 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|130586 TIGR01523, ATPase-IID_K-Na, potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>gnl|CDD|188151 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|233438 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>gnl|CDD|130176 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>gnl|CDD|237914 PRK15122, PRK15122, magnesium-transporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|236705 PRK10517, PRK10517, magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>gnl|CDD|233506 TIGR01647, ATPase-IIIA_H, plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|233445 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233447 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|233447 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|233445 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|211664 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>gnl|CDD|225126 COG2216, KdpB, High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237437 PRK13582, thrH, phosphoserine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215623 PLN03190, PLN03190, aminophospholipid translocase; Provisional Back     alignment and domain information
>gnl|CDD|162723 TIGR02137, HSK-PSP, phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>gnl|CDD|130561 TIGR01497, kdpB, K+-transporting ATPase, B subunit Back     alignment and domain information
>gnl|CDD|226572 COG4087, COG4087, Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234905 PRK01122, PRK01122, potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|211664 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>gnl|CDD|215733 pfam00122, E1-E2_ATPase, E1-E2 ATPase Back     alignment and domain information
>gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 523
KOG0208|consensus 1140 100.0
TIGR01657 1054 P-ATPase-V P-type ATPase of unknown pump specifici 100.0
KOG0204|consensus 1034 100.0
COG0474 917 MgtA Cation transport ATPase [Inorganic ion transp 100.0
KOG0202|consensus 972 100.0
KOG0209|consensus 1160 100.0
PRK15122 903 magnesium-transporting ATPase; Provisional 100.0
PRK10517 902 magnesium-transporting ATPase MgtA; Provisional 100.0
TIGR01524 867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 100.0
TIGR01517 941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 100.0
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 100.0
TIGR01647 755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 100.0
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 100.0
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 100.0
PRK01122 679 potassium-transporting ATPase subunit B; Provision 100.0
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 100.0
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 100.0
PRK14010 673 potassium-transporting ATPase subunit B; Provision 100.0
KOG0203|consensus 1019 100.0
TIGR01497 675 kdpB K+-transporting ATPase, B subunit. One sequen 100.0
KOG0207|consensus 951 99.98
TIGR01652 1057 ATPase-Plipid phospholipid-translocating P-type AT 99.98
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 99.97
PRK10671834 copA copper exporting ATPase; Provisional 99.96
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 99.96
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 99.95
KOG0210|consensus 1051 99.95
KOG0206|consensus 1151 99.95
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 99.95
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 99.94
PLN03190 1178 aminophospholipid translocase; Provisional 99.94
KOG0205|consensus 942 99.92
COG2216 681 KdpB High-affinity K+ transport system, ATPase cha 99.91
KOG0208|consensus1140 99.81
KOG0209|consensus1160 99.79
PRK10513270 sugar phosphate phosphatase; Provisional 99.76
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 99.74
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 99.74
PRK10976266 putative hydrolase; Provisional 99.71
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.68
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 99.67
PLN02887580 hydrolase family protein 99.66
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 99.65
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 99.64
PRK01158230 phosphoglycolate phosphatase; Provisional 99.62
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 99.62
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 99.61
TIGR016571054 P-ATPase-V P-type ATPase of unknown pump specifici 99.6
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 99.6
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.57
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 99.56
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 99.49
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 99.46
COG4087152 Soluble P-type ATPase [General function prediction 99.44
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 99.43
PTZ00174247 phosphomannomutase; Provisional 99.41
PLN02382 413 probable sucrose-phosphatase 99.41
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 99.37
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 99.34
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 99.3
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 99.13
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 99.12
PRK11133322 serB phosphoserine phosphatase; Provisional 99.12
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 99.07
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.02
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 98.99
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 98.94
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 98.87
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.8
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 98.71
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 98.69
PLN02423245 phosphomannomutase 98.69
KOG1615|consensus227 98.62
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 98.55
PRK13582205 thrH phosphoserine phosphatase; Provisional 98.55
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 98.55
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 98.47
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 98.41
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 98.41
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.4
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 98.4
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 98.31
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 98.26
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 98.26
PLN02954224 phosphoserine phosphatase 98.13
PLN02580384 trehalose-phosphatase 98.11
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 98.03
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 98.02
COG0546220 Gph Predicted phosphatases [General function predi 97.99
PRK08238 479 hypothetical protein; Validated 97.98
PRK13222226 phosphoglycolate phosphatase; Provisional 97.95
PRK11590211 hypothetical protein; Provisional 97.95
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 97.92
PRK13223272 phosphoglycolate phosphatase; Provisional 97.78
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 97.77
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 97.76
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 97.69
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 97.68
PRK13288214 pyrophosphatase PpaX; Provisional 97.6
PRK13226229 phosphoglycolate phosphatase; Provisional 97.53
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 97.53
PLN03017366 trehalose-phosphatase 97.47
PF00122230 E1-E2_ATPase: E1-E2 ATPase p-type cation-transport 97.44
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 97.44
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 97.44
PHA02530300 pseT polynucleotide kinase; Provisional 97.42
COG4359220 Uncharacterized conserved protein [Function unknow 97.33
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 97.3
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 97.25
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 97.21
PLN02770248 haloacid dehalogenase-like hydrolase family protei 97.2
PRK13225273 phosphoglycolate phosphatase; Provisional 97.2
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 97.17
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 97.16
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 97.08
PRK14988224 GMP/IMP nucleotidase; Provisional 96.98
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 96.97
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 96.96
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 96.95
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 96.88
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 96.86
PRK11587218 putative phosphatase; Provisional 96.84
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 96.83
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 96.81
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 96.77
PLN02575381 haloacid dehalogenase-like hydrolase 96.74
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 96.74
PLN02779286 haloacid dehalogenase-like hydrolase family protei 96.73
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 96.61
KOG3120|consensus256 96.59
TIGR01675229 plant-AP plant acid phosphatase. This model explic 96.53
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 96.46
PLN02940 382 riboflavin kinase 96.43
PRK06769173 hypothetical protein; Validated 96.33
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 96.3
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 96.3
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 96.29
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 96.24
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 96.24
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 96.08
PLN02151354 trehalose-phosphatase 95.92
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 95.85
PLN02645311 phosphoglycolate phosphatase 95.8
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 95.79
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 95.76
PRK09449224 dUMP phosphatase; Provisional 95.61
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 95.59
PLN02811220 hydrolase 95.56
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 95.41
PF00689182 Cation_ATPase_C: Cation transporting ATPase, C-ter 95.38
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 95.16
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 95.04
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 94.97
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 94.94
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 94.9
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 94.79
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 94.77
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 94.68
PF02358235 Trehalose_PPase: Trehalose-phosphatase; InterPro: 94.37
PLN02177 497 glycerol-3-phosphate acyltransferase 94.28
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 93.76
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 93.75
COG4030315 Uncharacterized protein conserved in archaea [Func 93.64
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 93.55
PRK10444248 UMP phosphatase; Provisional 93.54
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 93.35
TIGR01684301 viral_ppase viral phosphatase. These proteins also 93.34
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 93.28
PHA02597197 30.2 hypothetical protein; Provisional 93.19
TIGR024681050 sucrsPsyn_pln sucrose phosphate synthase/possible 93.19
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 93.09
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 92.98
TIGR01106997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 92.8
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 92.75
PRK10563221 6-phosphogluconate phosphatase; Provisional 92.38
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 92.19
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 92.1
COG0637221 Predicted phosphatase/phosphohexomutase [General f 91.76
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 91.62
TIGR01517941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 91.54
PHA03398303 viral phosphatase superfamily protein; Provisional 91.01
COG0474917 MgtA Cation transport ATPase [Inorganic ion transp 90.66
TIGR01524867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 90.14
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 90.01
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 89.77
COG0241181 HisB Histidinol phosphatase and related phosphatas 88.68
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 87.89
PRK10748238 flavin mononucleotide phosphatase; Provisional 87.54
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 86.66
COG3700237 AphA Acid phosphatase (class B) [General function 86.57
PLN03063797 alpha,alpha-trehalose-phosphate synthase (UDP-form 86.29
PRK10517902 magnesium-transporting ATPase MgtA; Provisional 85.89
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 84.42
KOG4383|consensus 1354 84.22
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 82.46
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 81.39
PRK15122903 magnesium-transporting ATPase; Provisional 80.43
TIGR01522884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 80.14
>KOG0208|consensus Back     alignment and domain information
Probab=100.00  E-value=8.5e-49  Score=411.11  Aligned_cols=317  Identities=49%  Similarity=0.788  Sum_probs=276.9

Q ss_pred             eeecCCchHHHHHHHHhheeeccCCCChhHHHHHHHHHHHHHhhcccccccccceeeeeeehhhhhhhccccceeeecCC
Q psy78           179 EILRGRSLWDIVIKSLDIITIVIPPALPATMTVGKLYALTRLKKYNISCINSRVINLMTVGKLYALTRLKKYNISCINSR  258 (523)
Q Consensus       179 ~~~~~~~~~~~~~~~~~vlv~~~P~aLp~~~~~~~~~~~~~l~k~~~~~~~~~t~~~m~v~~~~~~~~~~~~~il~~~~~  258 (523)
                      ....|.++...++++++++++.+|||||++++++..+|..||+|+                           ||+|.+|.
T Consensus       408 l~~~g~~~~~iiirsLDliTi~VPPALPAaltvG~~~a~~RLkkk---------------------------~IfCisP~  460 (1140)
T KOG0208|consen  408 LNLLGVPLKTIIIRSLDLITIVVPPALPAALTVGIIYAQSRLKKK---------------------------GIFCISPQ  460 (1140)
T ss_pred             HHHcCCCHHHHhhhhhcEEEEecCCCchhhhhHHHHHHHHHHHhc---------------------------CeEEcCcc
Confidence            345788999999999999999999999999999999999999999                           99999999


Q ss_pred             ccccCCceeEEeecc-----------------------------------------------------------------
Q psy78           259 VINVSGSINCVCFDK-----------------------------------------------------------------  273 (523)
Q Consensus       259 ~~~~~~~v~~v~fDK-----------------------------------------------------------------  273 (523)
                      +++.+|+++++||||                                                                 
T Consensus       461 rIn~~G~i~~~cFDKTGTLTEdGLDl~gv~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~a~atCHSL~~  540 (1140)
T KOG0208|consen  461 RINLCGKLNLVCFDKTGTLTEDGLDLWGVVPVERNVDDGPELKVVTEDSLQLFYKLSLRSSSLPMGNLVAAMATCHSLTL  540 (1140)
T ss_pred             ceeecceeeEEEEcCCCcccccceeEEEEEeccccccccchhhhhhhhhccceeeccccccCCchHHHHHHHhhhceeEE
Confidence            999999999999999                                                                 


Q ss_pred             -------------ccccccccccCCC------------------------------------------------------
Q psy78           274 -------------MFESTGWTLEEPM------------------------------------------------------  286 (523)
Q Consensus       274 -------------~~~~~~~~~~~~~------------------------------------------------------  286 (523)
                                   +|+.++|..++.+                                                      
T Consensus       541 v~g~l~GDPLdlkmfe~t~w~~ee~~~~~~~~~~~~~~~p~v~~p~~~~~~~~t~~~~~~~si~k~feF~S~LrRMSVIv  620 (1140)
T KOG0208|consen  541 VDGTLVGDPLDLKMFESTGWVYEEADIEDEATREFNTLIPTVVRPPENAFNQSTECGEGEISIVKQFEFSSALRRMSVIV  620 (1140)
T ss_pred             eCCeeccCceeeeeeeccceEEEeccccchhhhhhCCccCCEeCCCcccccCCCcCCCcceEEEEecccchhhheEEEEE
Confidence                         7788888764421                                                      


Q ss_pred             -------------------------CcchhHHHHHHHHHhhccCeEEEEEEecCCch-hHHHhhhcchhhhhccceeeee
Q psy78           287 -------------------------KFVPENIVSVLSEYTEQGYRVIALASRTLSIE-DYKHLNYMKREDIEKDLEFLGL  340 (523)
Q Consensus       287 -------------------------~~~~~~~~~~~~~~~~~G~r~l~~a~k~l~~~-~~~~~~~~~~~~~e~dl~~lG~  340 (523)
                                               +++|+++++.+++|+.+|+|++++|+|.++.. +.+.+. .+|+.+|+|++|+|+
T Consensus       621 ~~~~e~~~~~ftKGaPE~I~~ic~p~tvP~dy~evl~~Yt~~GfRVIAlA~K~L~~~~~~~~~~-~~Rd~vEs~l~FlGL  699 (1140)
T KOG0208|consen  621 STGGEDKMMVFTKGAPESIAEICKPETVPADYQEVLKEYTHQGFRVIALASKELETSTLQKAQK-LSRDTVESNLEFLGL  699 (1140)
T ss_pred             ecCCCCceEeeccCCHHHHHHhcCcccCCccHHHHHHHHHhCCeEEEEEecCccCcchHHHHhh-ccHhhhhccceeeEE
Confidence                                     06789999999999999999999999999865 444444 899999999999999


Q ss_pred             eeeccCCCcchHHHHHHHHhCCCcEEEEcCCCHhhHHHHHHHcCccCCCCeEEEeecCCCCCCCCCceEEEecCcchhhh
Q psy78           341 IILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSAIQT  420 (523)
Q Consensus       341 i~~~d~lr~~t~~aI~~Lk~~Gi~vvi~TGr~~~~a~~ia~~lgi~~~~~~~i~~ng~~~~~~~~~~~~~~~~~~~~~~~  420 (523)
                      +.+++++|++++.+|++|.++.|+++|+|||+..||..+|++||+..+..+++...-...+.....++.|...+.+....
T Consensus       700 iVmeNkLK~~T~~VI~eL~~AnIRtVMcTGDNllTaisVakeCgmi~p~~~v~~~~~~~~~~~~~~~i~w~~ve~~~~~~  779 (1140)
T KOG0208|consen  700 IVMENKLKEETKRVIDELNRANIRTVMCTGDNLLTAISVAKECGMIEPQVKVIIPELEPPEDDSIAQIVWLCVESQTQFL  779 (1140)
T ss_pred             EEeecccccccHHHHHHHHhhcceEEEEcCCchheeeehhhcccccCCCCeEEEEeccCCccCCCceeEEEEccCccccC
Confidence            99999999999999999999999999999999999999999999999988888887776666666777777665554443


Q ss_pred             hhhhcccCchhhh---hccCCCceEEEEecccHHHHHhhCcchHhhhhcccEEEEcCChHhHHHHHHHHHHCCCEEEEEc
Q psy78           421 KAKKLNYSKTEEE---LGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCG  497 (523)
Q Consensus       421 ~~~~~~~~~~~~~---~~~~~~~~~l~i~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~p~~K~~~i~~L~~~~~~V~a~G  497 (523)
                      +............   +......++++++|+.+..+.+.+++.+..+..+..+|||++|.||.+.|+.+|+.+..|+|+|
T Consensus       780 ~~~~~~~~~~~~~~~~d~~~~~~yhlA~sG~~f~~i~~~~~~l~~~Il~~~~VfARMsP~qK~~Lie~lQkl~y~VgfCG  859 (1140)
T KOG0208|consen  780 DPKEPDPDLASVKLSLDVLSEKDYHLAMSGKTFQVILEHFPELVPKILLKGTVFARMSPDQKAELIEALQKLGYKVGFCG  859 (1140)
T ss_pred             CCCccCccccCCccChhhhccceeEEEecCchhHHHHhhcHHHHHHHHhcCeEEeecCchhHHHHHHHHHhcCcEEEecC
Confidence            3322222111111   3344567899999999999998889999999999999999999999999999999999999999


Q ss_pred             CChhhHHHHHhCCccEEecccCCCCC
Q psy78           498 DGANDCGALRAAHAGISLSEAESPID  523 (523)
Q Consensus       498 DG~ND~~MLk~A~vGIAMgna~~~va  523 (523)
                      ||.||+.+||+||+||+.+.|++++|
T Consensus       860 DGANDCgALKaAdvGISLSeaEASvA  885 (1140)
T KOG0208|consen  860 DGANDCGALKAADVGISLSEAEASVA  885 (1140)
T ss_pred             CCcchhhhhhhcccCcchhhhhHhhc
Confidence            99999999999999999999999887



>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>KOG0204|consensus Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0202|consensus Back     alignment and domain information
>KOG0209|consensus Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>KOG0203|consensus Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>KOG0207|consensus Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>KOG0210|consensus Back     alignment and domain information
>KOG0206|consensus Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>KOG0205|consensus Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0208|consensus Back     alignment and domain information
>KOG0209|consensus Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>KOG1615|consensus Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PF00122 E1-E2_ATPase: E1-E2 ATPase p-type cation-transporting ATPase superfamily signature H+-transporting ATPase (proton pump) signature sodium/potassium-transporting ATPase signature; InterPro: IPR008250 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>KOG3120|consensus Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PF00689 Cation_ATPase_C: Cation transporting ATPase, C-terminus; InterPro: IPR006068 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG4383|consensus Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query523
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 2e-29
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 3e-29
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 3e-27
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 4e-26
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 5e-25
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 1e-10
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 2e-05
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 2e-10
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 7e-07
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 5e-10
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 2e-04
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 1e-09
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 4e-06
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 1e-09
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 6e-04
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
3gwi_A170 Magnesium-transporting ATPase, P-type 1; P-type AT 1e-05
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 3e-05
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Length = 1028 Back     alignment and structure
 Score =  122 bits (308), Expect = 2e-29
 Identities = 52/230 (22%), Positives = 86/230 (37%), Gaps = 38/230 (16%)

Query: 291 ENIVSVLSEYTEQGYRVIALASRTLSIEDYKH---LNYMKREDIEKDLEFLGLIILENRL 347
           E   +   E    G RV+      L  + Y      +  +      DL F+GL+ + +  
Sbjct: 541 EAFQNAYLELGGLGERVLGFCHFALPEDKYNEGYPFDADEPNFPTTDLCFVGLMAMIDPP 600

Query: 348 KPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPK 407
           +      + + + A +KV+M+TGD+  TA ++AK  GII  G   ++  A          
Sbjct: 601 RAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETIEDIAARLN------ 654

Query: 408 VYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIR---DQMPELIPRI 464
                                           A    V G   +L     + + +++   
Sbjct: 655 ----------------------IPIGQVNPRDAKACVVHGS--DLKDLSTEVLDDILHY- 689

Query: 465 IVKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGIS 514
                +FAR S  QK  +V   Q+ G  VA+ GDG ND  AL+ A  G++
Sbjct: 690 -HTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVA 738


>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2xzb_A 1iwc_A 1iwf_A Length = 1034 Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Length = 995 Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Length = 280 Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Length = 280 Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Length = 263 Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Length = 263 Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Length = 287 Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Length = 287 Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Length = 736 Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Length = 736 Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 645 Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 645 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3gwi_A Magnesium-transporting ATPase, P-type 1; P-type ATPase, nucleotide binding, ATP binding, MGTA, membra protein, cell inner membrane; 1.60A {Escherichia coli} Length = 170 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Length = 206 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query523
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 100.0
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 100.0
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 100.0
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 100.0
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 100.0
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 100.0
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 100.0
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 100.0
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 99.62
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 99.69
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 99.64
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.61
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 99.61
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.6
3dao_A283 Putative phosphatse; structural genomics, joint ce 99.58
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 99.55
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 99.54
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 99.5
1l6r_A227 Hypothetical protein TA0175; structural genomics, 99.49
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 99.49
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 99.49
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 99.48
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 99.47
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 99.47
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 99.44
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 99.44
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 99.43
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 99.39
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 99.38
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 99.38
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 99.35
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 99.34
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 99.31
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 99.29
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 99.23
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 99.22
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.2
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 99.19
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 99.17
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.1
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.08
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.05
3mmz_A176 Putative HAD family hydrolase; structural genomics 98.99
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 98.97
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 98.94
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 98.93
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 98.91
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 98.84
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 98.79
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 98.77
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.74
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.73
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 98.69
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 98.67
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.65
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 98.63
3fvv_A232 Uncharacterized protein; unknown function, structu 98.62
1te2_A226 Putative phosphatase; structural genomics, phospha 98.6
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 98.55
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 98.51
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 98.51
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 98.5
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 98.5
4gxt_A385 A conserved functionally unknown protein; structur 98.5
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 98.49
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 98.49
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 98.48
1y8a_A332 Hypothetical protein AF1437; structural genomics, 98.47
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 98.46
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 98.46
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 98.43
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 98.42
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.42
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 98.42
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 98.4
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 98.38
3sd7_A240 Putative phosphatase; structural genomics, haloaci 98.33
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 98.33
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 98.31
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 98.31
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 98.3
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 98.28
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 98.25
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 98.25
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 98.25
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 98.24
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.23
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 98.23
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 98.23
2hsz_A243 Novel predicted phosphatase; structural genomics, 98.22
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 98.19
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 98.16
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 98.15
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 98.14
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 98.14
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 98.12
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 98.12
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 98.12
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 98.1
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 98.09
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 98.08
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 98.07
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 98.07
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 98.06
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 98.04
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.03
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 98.03
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 98.03
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 98.03
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 98.0
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 98.0
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 97.99
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 97.97
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 97.92
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 97.86
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 97.86
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 97.83
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 97.83
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 97.81
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 97.78
2o2x_A218 Hypothetical protein; structural genomics, joint c 97.75
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 97.7
3ib6_A189 Uncharacterized protein; structural genomics, unkn 97.56
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 97.38
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 97.28
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 97.27
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 97.27
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 97.23
3gwi_A170 Magnesium-transporting ATPase, P-type 1; P-type AT 97.22
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 97.16
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 97.09
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.93
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 96.88
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 96.8
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 96.76
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 96.75
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 96.73
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 96.72
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 96.62
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 96.49
2zg6_A220 Putative uncharacterized protein ST2620, probable 96.31
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 96.12
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 95.99
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 95.91
2p11_A231 Hypothetical protein; putative haloacid dehalogena 95.8
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 95.19
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 95.07
3ixz_A1034 Potassium-transporting ATPase alpha; ION pump, H+, 93.28
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 93.07
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 92.61
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 92.5
2zxe_A1028 Na, K-ATPase alpha subunit; membrane protein, ION 91.26
3n28_A 335 Phosphoserine phosphatase; HAD family hydrolase, s 90.18
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 89.96
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 87.94
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 86.75
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 86.33
3ar4_A995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 85.65
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 83.56
1svj_A156 Potassium-transporting ATPase B chain; alpha-beta 82.65
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 80.92
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
Probab=100.00  E-value=5.5e-37  Score=349.90  Aligned_cols=309  Identities=24%  Similarity=0.297  Sum_probs=208.9

Q ss_pred             ecCCchHHHHHHHHhheeeccCCCChhHHHHHHHHHHHHHhhcccc----------------cccc---cceeeeeeehh
Q psy78           181 LRGRSLWDIVIKSLDIITIVIPPALPATMTVGKLYALTRLKKYNIS----------------CINS---RVINLMTVGKL  241 (523)
Q Consensus       181 ~~~~~~~~~~~~~~~vlv~~~P~aLp~~~~~~~~~~~~~l~k~~~~----------------~~~~---~t~~~m~v~~~  241 (523)
                      +.+.++.+++.+++++++++||||||+++|++++.|+.||+|+|++                |+++   +|+|+|+|.++
T Consensus       322 ~~~~~~~~~~~~~i~l~v~~iPe~Lp~~vti~la~~~~rmak~~~lvr~l~avE~LG~v~~IcsDKTGTLT~n~m~v~~~  401 (1034)
T 3ixz_A          322 CIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHL  401 (1034)
T ss_pred             HhcchHHHHHHHHHHHHHheeccccHHHHHHHHHHHHHHHhhCCeEecChHHHHhhcCCcEEEcCCCCCcccCeEEEEEE
Confidence            4678899999999999999999999999999999999999999974                3444   89999999998


Q ss_pred             hhhhhcc------------------------ccceeeecCCc-------------------------------------c
Q psy78           242 YALTRLK------------------------KYNISCINSRV-------------------------------------I  260 (523)
Q Consensus       242 ~~~~~~~------------------------~~~il~~~~~~-------------------------------------~  260 (523)
                      |..+...                        ....+|.+...                                     .
T Consensus       402 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~lc~~a~~~~~~~~~~~~~~~~~gdp~e~All~~~~~~~~~~~~~~  481 (1034)
T 3ixz_A          402 WFDNHIHSADTTEDQSGQTFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMGYR  481 (1034)
T ss_pred             EECCccccccCcccccccccCcCCHHHHHHHHHHHHhccceeccCcCCCcccCceeccCchHHHHHHHHHHhCCChHHHH
Confidence            7643221                        01112211100                                     0


Q ss_pred             ccCCceeEEeecccccc--ccccccC-------------CC-------------------CcchhHHHHHHHHHhhccCe
Q psy78           261 NVSGSINCVCFDKMFES--TGWTLEE-------------PM-------------------KFVPENIVSVLSEYTEQGYR  306 (523)
Q Consensus       261 ~~~~~v~~v~fDK~~~~--~~~~~~~-------------~~-------------------~~~~~~~~~~~~~~~~~G~r  306 (523)
                      +...++..+.||...+.  +-....+             ++                   ++.++.+.+..++++++|+|
T Consensus       482 ~~~~~~~~~pF~s~rk~m~~v~~~~~~~~~~~~l~~KGApe~il~~c~~~~~~~~~~~l~~~~~~~~~~~~~~~a~~G~R  561 (1034)
T 3ixz_A          482 ERFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHVLVMKGAPERVLERCSSILIKGQELPLDEQWREAFQTAYLSLGGLGER  561 (1034)
T ss_pred             HhCcceEEeeecCCCceEEEEEEecCCCCccEEEEEeCChHHHHHHhHHhhcCCceecCCHHHHHHHHHHHHHHHhcCcH
Confidence            01122344445541110  0000000             00                   12235567788899999999


Q ss_pred             EEEEEEecCCchhHHHhhh---cchhhhhccceeeeeeeeccCCCcchHHHHHHHHhCCCcEEEEcCCCHhhHHHHHHHc
Q psy78           307 VIALASRTLSIEDYKHLNY---MKREDIEKDLEFLGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKEC  383 (523)
Q Consensus       307 ~l~~a~k~l~~~~~~~~~~---~~~~~~e~dl~~lG~i~~~d~lr~~t~~aI~~Lk~~Gi~vvi~TGr~~~~a~~ia~~l  383 (523)
                      |+++|+|.++.+.......   ...+..|+|++|+|+++++|++|+++++||++|+++||+++|+|||++.++.++++++
T Consensus       562 vLa~A~~~l~~~~~~~~~~~~~~~~~~~e~~l~~lGlv~i~Dp~r~~~~~aI~~l~~aGI~vvmiTGd~~~tA~~ia~~l  641 (1034)
T 3ixz_A          562 VLGFCQLYLSEKDYPPGYAFDVEAMNFPTSGLSFAGLVSMIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASV  641 (1034)
T ss_pred             hheEeEEecChhhcccccccchhhhhccccCcEEEEEEeccCCCchhHHHHHHHHHHcCCeEEEEeCCCHHHHHHHHHHc
Confidence            9999999987542211110   1223468999999999999999999999999999999999999999999999999999


Q ss_pred             CccCCCCeEEEeecCCCCCCCCCceEEEecCcchhhhhhhhcccCchhhhhccCCCceEEEEecccHHHHHhhCcchHhh
Q psy78           384 GIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPR  463 (523)
Q Consensus       384 gi~~~~~~~i~~ng~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~l~~~~~~~~~~  463 (523)
                      |+..++...+.                         .........   .............+++..+..+.+   +.+..
T Consensus       642 gi~~~~~~~i~-------------------------~~~~~~~~~---~~~~~~~~~~~~~~~g~~l~~~~~---~~l~~  690 (1034)
T 3ixz_A          642 GIISEGSETVE-------------------------DIAARLRVP---VDQVNRKDARACVINGMQLKDMDP---SELVE  690 (1034)
T ss_pred             CCCCCCchHHH-------------------------HHHHhhCcc---chhccccccceeEEecHhhhhCCH---HHHHH
Confidence            99753221100                         000000000   000001112234455554433221   12222


Q ss_pred             hhc--ccEEEEcCChHhHHHHHHHHHHCCCEEEEEcCChhhHHHHHhCCccEEec-ccCC
Q psy78           464 IIV--KGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGISLS-EAES  520 (523)
Q Consensus       464 ~~~--~~~v~~~~~p~~K~~~i~~L~~~~~~V~a~GDG~ND~~MLk~A~vGIAMg-na~~  520 (523)
                      ...  ...+++|++|++|..+++.+++.++.|+|+|||.||++||+.||+||||| ||.+
T Consensus       691 ~~~~~~~~v~ar~~P~~K~~iv~~lq~~g~~V~a~GDG~ND~~mLk~A~vGIAMg~ng~d  750 (1034)
T 3ixz_A          691 ALRTHPEMVFARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSPALKKADIGVAMGIAGSD  750 (1034)
T ss_pred             HHHhCCceEEEecCHHHHHHHHHHHHHcCCEEEEECCcHHhHHHHHHCCeeEEeCCccCH
Confidence            222  22589999999999999999999999999999999999999999999999 7654



>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3gwi_A Magnesium-transporting ATPase, P-type 1; P-type ATPase, nucleotide binding, ATP binding, MGTA, membra protein, cell inner membrane; 1.60A {Escherichia coli} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>1svj_A Potassium-transporting ATPase B chain; alpha-beta sandwich, hydrolase; NMR {Escherichia coli} SCOP: d.220.1.1 PDB: 1u7q_A 2a00_A* 2a29_A* Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 523
d1wpga2168 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, ca 2e-15
d1qyia_380 c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 2e-11
d1wpga3239 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryc 3e-06
d1q3ia_214 d.220.1.1 (A:) Sodium/potassium-transporting ATPas 4e-06
d1wr8a_230 c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa 6e-05
d2b8ea1135 c.108.1.7 (A:416-434,A:548-663) Cation-transportin 2e-04
d2b8ea1135 c.108.1.7 (A:416-434,A:548-663) Cation-transportin 0.001
d1l6ra_225 c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa 3e-04
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 168 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Meta-cation ATPase, catalytic domain P
domain: Calcium ATPase, catalytic domain P
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
 Score = 72.1 bits (176), Expect = 2e-15
 Identities = 42/185 (22%), Positives = 64/185 (34%), Gaps = 51/185 (27%)

Query: 334 DLEFLGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVV 393
           D          +  + +  G I+  +DA ++V+MITGDN  TAI++ +  GI    E V 
Sbjct: 8   DKTGTLTTNQLDPPRKEVMGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVA 67

Query: 394 DVSAVPGGLKECPKVYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELI 453
           D +                                                 TG+ ++ +
Sbjct: 68  DRA------------------------------------------------YTGREFDDL 79

Query: 454 RDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGI 513
                    R       FAR+    K ++V  LQ      AM GDG ND  AL+ A  GI
Sbjct: 80  PLAEQREACRRAC---CFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGI 136

Query: 514 SLSEA 518
           ++   
Sbjct: 137 AMGSG 141


>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 Back     information, alignment and structure
>d1wpga3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 239 Back     information, alignment and structure
>d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} Length = 214 Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 135 Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 135 Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query523
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 99.88
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 99.85
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 99.68
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.62
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 99.61
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 99.57
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 99.57
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 99.57
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.56
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.55
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 99.52
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 99.52
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 99.51
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 99.38
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 99.19
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 99.18
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.09
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 99.07
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.03
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 98.97
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 98.78
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.78
d1wpga4472 Calcium ATPase, transmembrane domain M {Rabbit (Or 98.27
d1q3ia_214 Sodium/potassium-transporting ATPase alpha chain { 98.11
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 97.81
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 97.67
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 97.53
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 97.4
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 97.32
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 97.16
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 97.08
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.01
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 96.96
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 96.95
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 96.78
d1wpga3239 Calcium ATPase {Rabbit (Oryctolagus cuniculus) [Ta 96.77
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 96.75
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 96.73
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 96.63
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 96.38
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 96.14
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 96.06
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 95.91
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 95.84
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 95.55
d1wpga4472 Calcium ATPase, transmembrane domain M {Rabbit (Or 95.54
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 95.52
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 95.13
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 94.6
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 94.05
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 94.03
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 93.44
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 92.26
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 91.68
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 90.54
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 88.62
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Meta-cation ATPase, catalytic domain P
domain: Calcium ATPase, catalytic domain P
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Probab=99.88  E-value=4.3e-23  Score=182.96  Aligned_cols=131  Identities=31%  Similarity=0.420  Sum_probs=101.7

Q ss_pred             eeeeeeccCCCcchHHHHHHHHhCCCcEEEEcCCCHhhHHHHHHHcCccCCCCeEEEeecCCCCCCCCCceEEEecCcch
Q psy78           338 LGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSA  417 (523)
Q Consensus       338 lG~i~~~d~lr~~t~~aI~~Lk~~Gi~vvi~TGr~~~~a~~ia~~lgi~~~~~~~i~~ng~~~~~~~~~~~~~~~~~~~~  417 (523)
                      ..++..-||+|++++++|+.||++|++++|+|||+..++..+|+++|+..++..+.                        
T Consensus        12 ~~~~~~~Dp~R~~~~~~I~~l~~~GI~v~miTGD~~~tA~~ia~~~Gi~~~~~~v~------------------------   67 (168)
T d1wpga2          12 TLTTNQLDPPRKEVMGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVA------------------------   67 (168)
T ss_dssp             TTBCCCECCBCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHTTSSCTTCCCT------------------------
T ss_pred             EEEEEecCCCchhHHHHHHHHHHCcCEEEEECCCCHHHHHHHHHHcCCCCCccccc------------------------
Confidence            33344449999999999999999999999999999999999999999975433210                        


Q ss_pred             hhhhhhhcccCchhhhhccCCCceEEEEecccHHHHHhhCcchHhhhhcccEEEEcCChHhHHHHHHHHHHCCCEEEEEc
Q psy78           418 IQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCG  497 (523)
Q Consensus       418 ~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~p~~K~~~i~~L~~~~~~V~a~G  497 (523)
                                              ...+++++++   ............+..+++|++|++|..+++.+++.++.|+|+|
T Consensus        68 ------------------------~~~~~~~~~~---~~~~~~~~~~~~~~~v~ar~~p~~K~~lv~~l~~~g~~Va~vG  120 (168)
T d1wpga2          68 ------------------------DRAYTGREFD---DLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTG  120 (168)
T ss_dssp             ------------------------TTEEEHHHHH---HSCHHHHHHHHHHCCEEESCCHHHHHHHHHHHHHTTCCEEEEE
T ss_pred             ------------------------cccccccccc---hhhHHHHhhhhhhhhhhhccchhHHHHHHHHHHhcccceeEEe
Confidence                                    0011222221   1111222333445579999999999999999999999999999


Q ss_pred             CChhhHHHHHhCCccEEecccC
Q psy78           498 DGANDCGALRAAHAGISLSEAE  519 (523)
Q Consensus       498 DG~ND~~MLk~A~vGIAMgna~  519 (523)
                      ||.||++||+.||+||||+++.
T Consensus       121 DG~nD~~AL~~AdvGIa~~~gt  142 (168)
T d1wpga2         121 DGVNDAPALKKAEIGIAMGSGT  142 (168)
T ss_dssp             CSGGGHHHHHHSSEEEEETTSC
T ss_pred             cCCCCHHHHHhCCEEEEecccc
Confidence            9999999999999999999754



>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpga3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure