Psyllid ID: psy78
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
No hits with e-value below 0.001 by BLAST
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 523 | ||||||
| MGI|MGI:2685387 | 1219 | Atp13a3 "ATPase type 13A3" [Mu | 0.445 | 0.191 | 0.400 | 4.6e-61 | |
| UNIPROTKB|H0Y4Z2 | 576 | ATP13A4 "Probable cation-trans | 0.443 | 0.402 | 0.432 | 1.8e-60 | |
| UNIPROTKB|E1C7N6 | 1223 | ATP13A3 "Uncharacterized prote | 0.447 | 0.191 | 0.404 | 2.2e-59 | |
| UNIPROTKB|G3V677 | 1219 | LOC678704 "RCG36659, isoform C | 0.445 | 0.191 | 0.400 | 1.2e-58 | |
| RGD|1590881 | 1249 | Atp13a3 "ATPase type 13A3" [Ra | 0.445 | 0.186 | 0.400 | 1.4e-58 | |
| UNIPROTKB|Q4VNC0 | 1218 | ATP13A5 "Probable cation-trans | 0.443 | 0.190 | 0.457 | 5.1e-58 | |
| UNIPROTKB|E1BG26 | 1226 | ATP13A3 "Uncharacterized prote | 0.441 | 0.188 | 0.405 | 4.9e-57 | |
| UNIPROTKB|Q4VNC1 | 1196 | ATP13A4 "Probable cation-trans | 0.443 | 0.193 | 0.432 | 7.5e-57 | |
| MGI|MGI:2444068 | 1216 | Atp13a5 "ATPase type 13A5" [Mu | 0.443 | 0.190 | 0.451 | 1.2e-56 | |
| UNIPROTKB|F1N272 | 1197 | ATP13A4 "Uncharacterized prote | 0.441 | 0.192 | 0.417 | 2.1e-56 |
| MGI|MGI:2685387 Atp13a3 "ATPase type 13A3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Score = 458 (166.3 bits), Expect = 4.6e-61, Sum P(4) = 4.6e-61
Identities = 97/242 (40%), Positives = 152/242 (62%)
Query: 289 VPENIVSVLSEYTEQGYRVIALASRTLSIEDYKH-LNYMKREDIEKDLEFLGLIILENRL 347
VP + VL +YT+QG+RVIALA R L + H + ++ R+ IE +++F+GLII++N+L
Sbjct: 663 VPVDFEKVLEDYTKQGFRVIALAHRKLESKLTWHKVQHISRDAIENNMDFMGLIIMQNKL 722
Query: 348 KPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPK 407
K +T V+++L A ++ VM+TGDN+ TA+SVA++CG+I P + V+ A+P + K
Sbjct: 723 KQETPAVLEDLHKANIRTVMVTGDNMLTAVSVARDCGMILPQDKVIIAEALPPKDGKVAK 782
Query: 408 V--YFT-----VSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPEL 460
+ ++T S SAI ++A + + E L Y FA+ GKS+ +I + +L
Sbjct: 783 INWHYTDSLSQCSESSAIDSEAIPIKLAHDSLE-DLEVTRYHFAMNGKSFSVILEHFQDL 841
Query: 461 IPRIIVKGAIFARMSSDXXXXXXXXXXXXGYYVAMCGDGANDCGALRAAHAGISLSEAES 520
+P++++ G +FARM+ D Y+V MCGDGANDCGAL+ AH GISLSE E+
Sbjct: 842 VPKLMLHGTVFARMAPDQKTQLVEALQNVDYFVGMCGDGANDCGALKRAHGGISLSELEA 901
Query: 521 PI 522
+
Sbjct: 902 SV 903
|
|
| UNIPROTKB|H0Y4Z2 ATP13A4 "Probable cation-transporting ATPase 13A4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C7N6 ATP13A3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V677 LOC678704 "RCG36659, isoform CRA_c" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1590881 Atp13a3 "ATPase type 13A3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4VNC0 ATP13A5 "Probable cation-transporting ATPase 13A5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BG26 ATP13A3 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4VNC1 ATP13A4 "Probable cation-transporting ATPase 13A4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2444068 Atp13a5 "ATPase type 13A5" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N272 ATP13A4 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 523 | |||
| TIGR01657 | 1054 | TIGR01657, P-ATPase-V, P-type ATPase of unknown pu | 2e-71 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 4e-42 | |
| TIGR01494 | 543 | TIGR01494, ATPase_P-type, ATPase, P-type (transpor | 8e-27 | |
| TIGR01116 | 917 | TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic retic | 8e-19 | |
| TIGR01657 | 1054 | TIGR01657, P-ATPase-V, P-type ATPase of unknown pu | 1e-16 | |
| TIGR01652 | 1057 | TIGR01652, ATPase-Plipid, phospholipid-translocati | 4e-15 | |
| TIGR01522 | 884 | TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium- | 5e-15 | |
| TIGR01657 | 1054 | TIGR01657, P-ATPase-V, P-type ATPase of unknown pu | 6e-14 | |
| TIGR01524 | 867 | TIGR01524, ATPase-IIIB_Mg, magnesium-translocating | 2e-13 | |
| TIGR01523 | 1053 | TIGR01523, ATPase-IID_K-Na, potassium and/or sodiu | 8e-13 | |
| TIGR01517 | 944 | TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium- | 4e-12 | |
| TIGR01494 | 543 | TIGR01494, ATPase_P-type, ATPase, P-type (transpor | 5e-12 | |
| TIGR01106 | 997 | TIGR01106, ATPase-IIC_X-K, sodium or proton efflux | 4e-11 | |
| PRK15122 | 903 | PRK15122, PRK15122, magnesium-transporting ATPase; | 5e-10 | |
| PRK10517 | 902 | PRK10517, PRK10517, magnesium-transporting ATPase | 6e-10 | |
| TIGR01647 | 754 | TIGR01647, ATPase-IIIA_H, plasma-membrane proton-e | 2e-09 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 4e-09 | |
| pfam00702 | 187 | pfam00702, Hydrolase, haloacid dehalogenase-like h | 6e-09 | |
| TIGR01511 | 572 | TIGR01511, ATPase-IB1_Cu, copper-(or silver)-trans | 3e-07 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 5e-07 | |
| TIGR01525 | 556 | TIGR01525, ATPase-IB_hvy, heavy metal translocatin | 1e-06 | |
| TIGR01525 | 556 | TIGR01525, ATPase-IB_hvy, heavy metal translocatin | 1e-06 | |
| TIGR01511 | 572 | TIGR01511, ATPase-IB1_Cu, copper-(or silver)-trans | 3e-06 | |
| TIGR01512 | 536 | TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb | 7e-06 | |
| PRK11033 | 741 | PRK11033, zntA, zinc/cadmium/mercury/lead-transpor | 3e-05 | |
| COG2216 | 681 | COG2216, KdpB, High-affinity K+ transport system, | 8e-05 | |
| PRK13582 | 205 | PRK13582, thrH, phosphoserine phosphatase; Provisi | 2e-04 | |
| PLN03190 | 1178 | PLN03190, PLN03190, aminophospholipid translocase; | 2e-04 | |
| TIGR02137 | 203 | TIGR02137, HSK-PSP, phosphoserine phosphatase/homo | 3e-04 | |
| TIGR01497 | 675 | TIGR01497, kdpB, K+-transporting ATPase, B subunit | 7e-04 | |
| COG4087 | 152 | COG4087, COG4087, Soluble P-type ATPase [General f | 0.001 | |
| PRK01122 | 679 | PRK01122, PRK01122, potassium-transporting ATPase | 0.001 | |
| TIGR01512 | 536 | TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb | 0.002 | |
| pfam00122 | 222 | pfam00122, E1-E2_ATPase, E1-E2 ATPase | 0.002 | |
| PRK10671 | 834 | PRK10671, copA, copper exporting ATPase; Provision | 0.002 |
| >gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
Score = 245 bits (628), Expect = 2e-71
Identities = 102/237 (43%), Positives = 146/237 (61%), Gaps = 5/237 (2%)
Query: 289 VPENIVSVLSEYTEQGYRVIALASRTLSIEDYKHLNYMKREDIEKDLEFLGLIILENRLK 348
VP + VL YT +GYRV+ALA + L + + R+ +E +L FLG I+ EN LK
Sbjct: 599 VPSDYQEVLKSYTREGYRVLALAYKELPKLTLQKAQDLSRDAVESNLTFLGFIVFENPLK 658
Query: 349 PQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKV 408
P T+ VIKELK A ++ VMITGDN TA+ VA+ECGI++P T++ A P + ++
Sbjct: 659 PDTKEVIKELKRASIRTVMITGDNPLTAVHVARECGIVNPSNTLILAEAEPPESGKPNQI 718
Query: 409 YFTV-SGVSAIQTKAKK--LNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPRII 465
F V + T+ + + E+L S Y A++GK++ +++ PEL+ R++
Sbjct: 719 KFEVIDSIPFASTQVEIPYPLGQDSVEDLLASR--YHLAMSGKAFAVLQAHSPELLLRLL 776
Query: 466 VKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGISLSEAESPI 522
+FARM+ DQK+ LV LQ+L Y V MCGDGANDCGAL+ A GISLSEAE+ +
Sbjct: 777 SHTTVFARMAPDQKETLVELLQKLDYTVGMCGDGANDCGALKQADVGISLSEAEASV 833
|
These P-type ATPases form a distinct clade but the substrate of their pumping activity has yet to be determined. This clade has been designated type V in. Length = 1054 |
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233438 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >gnl|CDD|233277 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >gnl|CDD|233509 TIGR01652, ATPase-Plipid, phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >gnl|CDD|130587 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|130586 TIGR01523, ATPase-IID_K-Na, potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >gnl|CDD|188151 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233438 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >gnl|CDD|130176 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237914 PRK15122, PRK15122, magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236705 PRK10517, PRK10517, magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233506 TIGR01647, ATPase-IIIA_H, plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|233445 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233447 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233447 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|233445 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|211664 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225126 COG2216, KdpB, High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237437 PRK13582, thrH, phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215623 PLN03190, PLN03190, aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|162723 TIGR02137, HSK-PSP, phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >gnl|CDD|130561 TIGR01497, kdpB, K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226572 COG4087, COG4087, Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234905 PRK01122, PRK01122, potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211664 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|215733 pfam00122, E1-E2_ATPase, E1-E2 ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 523 | |||
| KOG0208|consensus | 1140 | 100.0 | ||
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 100.0 | |
| KOG0204|consensus | 1034 | 100.0 | ||
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 100.0 | |
| KOG0202|consensus | 972 | 100.0 | ||
| KOG0209|consensus | 1160 | 100.0 | ||
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 100.0 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 100.0 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 100.0 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 100.0 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 100.0 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 100.0 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 100.0 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 100.0 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 100.0 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 100.0 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 100.0 | |
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 100.0 | |
| KOG0203|consensus | 1019 | 100.0 | ||
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 100.0 | |
| KOG0207|consensus | 951 | 99.98 | ||
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 99.98 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 99.97 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 99.96 | |
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 99.96 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 99.95 | |
| KOG0210|consensus | 1051 | 99.95 | ||
| KOG0206|consensus | 1151 | 99.95 | ||
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 99.95 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 99.94 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 99.94 | |
| KOG0205|consensus | 942 | 99.92 | ||
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 99.91 | |
| KOG0208|consensus | 1140 | 99.81 | ||
| KOG0209|consensus | 1160 | 99.79 | ||
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 99.76 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 99.74 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 99.74 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 99.71 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.68 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 99.67 | |
| PLN02887 | 580 | hydrolase family protein | 99.66 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 99.65 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 99.64 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 99.62 | |
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 99.62 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 99.61 | |
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 99.6 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 99.6 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.57 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 99.56 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 99.49 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 99.46 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 99.44 | |
| TIGR01485 | 249 | SPP_plant-cyano sucrose-6F-phosphate phosphohydrol | 99.43 | |
| PTZ00174 | 247 | phosphomannomutase; Provisional | 99.41 | |
| PLN02382 | 413 | probable sucrose-phosphatase | 99.41 | |
| PRK14502 | 694 | bifunctional mannosyl-3-phosphoglycerate synthase/ | 99.37 | |
| TIGR02471 | 236 | sucr_syn_bact_C sucrose phosphate synthase, sucros | 99.34 | |
| PRK10187 | 266 | trehalose-6-phosphate phosphatase; Provisional | 99.3 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 99.13 | |
| TIGR01484 | 204 | HAD-SF-IIB HAD-superfamily hydrolase, subfamily II | 99.12 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 99.12 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 99.07 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 99.02 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 98.99 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 98.94 | |
| PF05116 | 247 | S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter | 98.87 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 98.8 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 98.71 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 98.69 | |
| PLN02423 | 245 | phosphomannomutase | 98.69 | |
| KOG1615|consensus | 227 | 98.62 | ||
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 98.55 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 98.55 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 98.55 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 98.47 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 98.41 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 98.41 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 98.4 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 98.4 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 98.31 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 98.26 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 98.26 | |
| PLN02954 | 224 | phosphoserine phosphatase | 98.13 | |
| PLN02580 | 384 | trehalose-phosphatase | 98.11 | |
| PLN02205 | 854 | alpha,alpha-trehalose-phosphate synthase [UDP-form | 98.03 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 98.02 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 97.99 | |
| PRK08238 | 479 | hypothetical protein; Validated | 97.98 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 97.95 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 97.95 | |
| TIGR00685 | 244 | T6PP trehalose-phosphatase. At least 18 distinct s | 97.92 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 97.78 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 97.77 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 97.76 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 97.69 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 97.68 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 97.6 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 97.53 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 97.53 | |
| PLN03017 | 366 | trehalose-phosphatase | 97.47 | |
| PF00122 | 230 | E1-E2_ATPase: E1-E2 ATPase p-type cation-transport | 97.44 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 97.44 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 97.44 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 97.42 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 97.33 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 97.3 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 97.25 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 97.21 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 97.2 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 97.2 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 97.17 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 97.16 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 97.08 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 96.98 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 96.97 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 96.96 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 96.95 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 96.88 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 96.86 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 96.84 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 96.83 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 96.81 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 96.77 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 96.74 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 96.74 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 96.73 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 96.61 | |
| KOG3120|consensus | 256 | 96.59 | ||
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 96.53 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 96.46 | |
| PLN02940 | 382 | riboflavin kinase | 96.43 | |
| PRK06769 | 173 | hypothetical protein; Validated | 96.33 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 96.3 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 96.3 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 96.29 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 96.24 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 96.24 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 96.08 | |
| PLN02151 | 354 | trehalose-phosphatase | 95.92 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 95.85 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 95.8 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 95.79 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 95.76 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 95.61 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 95.59 | |
| PLN02811 | 220 | hydrolase | 95.56 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 95.41 | |
| PF00689 | 182 | Cation_ATPase_C: Cation transporting ATPase, C-ter | 95.38 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 95.16 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 95.04 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 94.97 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 94.94 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 94.9 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 94.79 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 94.77 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 94.68 | |
| PF02358 | 235 | Trehalose_PPase: Trehalose-phosphatase; InterPro: | 94.37 | |
| PLN02177 | 497 | glycerol-3-phosphate acyltransferase | 94.28 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 93.76 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 93.75 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 93.64 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 93.55 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 93.54 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 93.35 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 93.34 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 93.28 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 93.19 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 93.19 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 93.09 | |
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 92.98 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 92.8 | |
| PF08235 | 157 | LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 | 92.75 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 92.38 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 92.19 | |
| COG1877 | 266 | OtsB Trehalose-6-phosphatase [Carbohydrate transpo | 92.1 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 91.76 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 91.62 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 91.54 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 91.01 | |
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 90.66 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 90.14 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 90.01 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 89.77 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 88.68 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 87.89 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 87.54 | |
| PLN03064 | 934 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 86.66 | |
| COG3700 | 237 | AphA Acid phosphatase (class B) [General function | 86.57 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 86.29 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 85.89 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 84.42 | |
| KOG4383|consensus | 1354 | 84.22 | ||
| TIGR01460 | 236 | HAD-SF-IIA Haloacid Dehalogenase Superfamily Class | 82.46 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 81.39 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 80.43 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 80.14 |
| >KOG0208|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.5e-49 Score=411.11 Aligned_cols=317 Identities=49% Similarity=0.788 Sum_probs=276.9
Q ss_pred eeecCCchHHHHHHHHhheeeccCCCChhHHHHHHHHHHHHHhhcccccccccceeeeeeehhhhhhhccccceeeecCC
Q psy78 179 EILRGRSLWDIVIKSLDIITIVIPPALPATMTVGKLYALTRLKKYNISCINSRVINLMTVGKLYALTRLKKYNISCINSR 258 (523)
Q Consensus 179 ~~~~~~~~~~~~~~~~~vlv~~~P~aLp~~~~~~~~~~~~~l~k~~~~~~~~~t~~~m~v~~~~~~~~~~~~~il~~~~~ 258 (523)
....|.++...++++++++++.+|||||++++++..+|..||+|+ ||+|.+|.
T Consensus 408 l~~~g~~~~~iiirsLDliTi~VPPALPAaltvG~~~a~~RLkkk---------------------------~IfCisP~ 460 (1140)
T KOG0208|consen 408 LNLLGVPLKTIIIRSLDLITIVVPPALPAALTVGIIYAQSRLKKK---------------------------GIFCISPQ 460 (1140)
T ss_pred HHHcCCCHHHHhhhhhcEEEEecCCCchhhhhHHHHHHHHHHHhc---------------------------CeEEcCcc
Confidence 345788999999999999999999999999999999999999999 99999999
Q ss_pred ccccCCceeEEeecc-----------------------------------------------------------------
Q psy78 259 VINVSGSINCVCFDK----------------------------------------------------------------- 273 (523)
Q Consensus 259 ~~~~~~~v~~v~fDK----------------------------------------------------------------- 273 (523)
+++.+|+++++||||
T Consensus 461 rIn~~G~i~~~cFDKTGTLTEdGLDl~gv~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~a~atCHSL~~ 540 (1140)
T KOG0208|consen 461 RINLCGKLNLVCFDKTGTLTEDGLDLWGVVPVERNVDDGPELKVVTEDSLQLFYKLSLRSSSLPMGNLVAAMATCHSLTL 540 (1140)
T ss_pred ceeecceeeEEEEcCCCcccccceeEEEEEeccccccccchhhhhhhhhccceeeccccccCCchHHHHHHHhhhceeEE
Confidence 999999999999999
Q ss_pred -------------ccccccccccCCC------------------------------------------------------
Q psy78 274 -------------MFESTGWTLEEPM------------------------------------------------------ 286 (523)
Q Consensus 274 -------------~~~~~~~~~~~~~------------------------------------------------------ 286 (523)
+|+.++|..++.+
T Consensus 541 v~g~l~GDPLdlkmfe~t~w~~ee~~~~~~~~~~~~~~~p~v~~p~~~~~~~~t~~~~~~~si~k~feF~S~LrRMSVIv 620 (1140)
T KOG0208|consen 541 VDGTLVGDPLDLKMFESTGWVYEEADIEDEATREFNTLIPTVVRPPENAFNQSTECGEGEISIVKQFEFSSALRRMSVIV 620 (1140)
T ss_pred eCCeeccCceeeeeeeccceEEEeccccchhhhhhCCccCCEeCCCcccccCCCcCCCcceEEEEecccchhhheEEEEE
Confidence 7788888764421
Q ss_pred -------------------------CcchhHHHHHHHHHhhccCeEEEEEEecCCch-hHHHhhhcchhhhhccceeeee
Q psy78 287 -------------------------KFVPENIVSVLSEYTEQGYRVIALASRTLSIE-DYKHLNYMKREDIEKDLEFLGL 340 (523)
Q Consensus 287 -------------------------~~~~~~~~~~~~~~~~~G~r~l~~a~k~l~~~-~~~~~~~~~~~~~e~dl~~lG~ 340 (523)
+++|+++++.+++|+.+|+|++++|+|.++.. +.+.+. .+|+.+|+|++|+|+
T Consensus 621 ~~~~e~~~~~ftKGaPE~I~~ic~p~tvP~dy~evl~~Yt~~GfRVIAlA~K~L~~~~~~~~~~-~~Rd~vEs~l~FlGL 699 (1140)
T KOG0208|consen 621 STGGEDKMMVFTKGAPESIAEICKPETVPADYQEVLKEYTHQGFRVIALASKELETSTLQKAQK-LSRDTVESNLEFLGL 699 (1140)
T ss_pred ecCCCCceEeeccCCHHHHHHhcCcccCCccHHHHHHHHHhCCeEEEEEecCccCcchHHHHhh-ccHhhhhccceeeEE
Confidence 06789999999999999999999999999865 444444 899999999999999
Q ss_pred eeeccCCCcchHHHHHHHHhCCCcEEEEcCCCHhhHHHHHHHcCccCCCCeEEEeecCCCCCCCCCceEEEecCcchhhh
Q psy78 341 IILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSAIQT 420 (523)
Q Consensus 341 i~~~d~lr~~t~~aI~~Lk~~Gi~vvi~TGr~~~~a~~ia~~lgi~~~~~~~i~~ng~~~~~~~~~~~~~~~~~~~~~~~ 420 (523)
+.+++++|++++.+|++|.++.|+++|+|||+..||..+|++||+..+..+++...-...+.....++.|...+.+....
T Consensus 700 iVmeNkLK~~T~~VI~eL~~AnIRtVMcTGDNllTaisVakeCgmi~p~~~v~~~~~~~~~~~~~~~i~w~~ve~~~~~~ 779 (1140)
T KOG0208|consen 700 IVMENKLKEETKRVIDELNRANIRTVMCTGDNLLTAISVAKECGMIEPQVKVIIPELEPPEDDSIAQIVWLCVESQTQFL 779 (1140)
T ss_pred EEeecccccccHHHHHHHHhhcceEEEEcCCchheeeehhhcccccCCCCeEEEEeccCCccCCCceeEEEEccCccccC
Confidence 99999999999999999999999999999999999999999999999988888887776666666777777665554443
Q ss_pred hhhhcccCchhhh---hccCCCceEEEEecccHHHHHhhCcchHhhhhcccEEEEcCChHhHHHHHHHHHHCCCEEEEEc
Q psy78 421 KAKKLNYSKTEEE---LGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCG 497 (523)
Q Consensus 421 ~~~~~~~~~~~~~---~~~~~~~~~l~i~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~p~~K~~~i~~L~~~~~~V~a~G 497 (523)
+............ +......++++++|+.+..+.+.+++.+..+..+..+|||++|.||.+.|+.+|+.+..|+|+|
T Consensus 780 ~~~~~~~~~~~~~~~~d~~~~~~yhlA~sG~~f~~i~~~~~~l~~~Il~~~~VfARMsP~qK~~Lie~lQkl~y~VgfCG 859 (1140)
T KOG0208|consen 780 DPKEPDPDLASVKLSLDVLSEKDYHLAMSGKTFQVILEHFPELVPKILLKGTVFARMSPDQKAELIEALQKLGYKVGFCG 859 (1140)
T ss_pred CCCccCccccCCccChhhhccceeEEEecCchhHHHHhhcHHHHHHHHhcCeEEeecCchhHHHHHHHHHhcCcEEEecC
Confidence 3322222111111 3344567899999999999998889999999999999999999999999999999999999999
Q ss_pred CChhhHHHHHhCCccEEecccCCCCC
Q psy78 498 DGANDCGALRAAHAGISLSEAESPID 523 (523)
Q Consensus 498 DG~ND~~MLk~A~vGIAMgna~~~va 523 (523)
||.||+.+||+||+||+.+.|++++|
T Consensus 860 DGANDCgALKaAdvGISLSeaEASvA 885 (1140)
T KOG0208|consen 860 DGANDCGALKAADVGISLSEAEASVA 885 (1140)
T ss_pred CCcchhhhhhhcccCcchhhhhHhhc
Confidence 99999999999999999999999887
|
|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >KOG0204|consensus | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0202|consensus | Back alignment and domain information |
|---|
| >KOG0209|consensus | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >KOG0203|consensus | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >KOG0207|consensus | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >KOG0210|consensus | Back alignment and domain information |
|---|
| >KOG0206|consensus | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >KOG0205|consensus | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0208|consensus | Back alignment and domain information |
|---|
| >KOG0209|consensus | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase | Back alignment and domain information |
|---|
| >PTZ00174 phosphomannomutase; Provisional | Back alignment and domain information |
|---|
| >PLN02382 probable sucrose-phosphatase | Back alignment and domain information |
|---|
| >PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial | Back alignment and domain information |
|---|
| >PRK10187 trehalose-6-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >PLN02423 phosphomannomutase | Back alignment and domain information |
|---|
| >KOG1615|consensus | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >PLN02580 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00685 T6PP trehalose-phosphatase | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03017 trehalose-phosphatase | Back alignment and domain information |
|---|
| >PF00122 E1-E2_ATPase: E1-E2 ATPase p-type cation-transporting ATPase superfamily signature H+-transporting ATPase (proton pump) signature sodium/potassium-transporting ATPase signature; InterPro: IPR008250 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >KOG3120|consensus | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >PLN02151 trehalose-phosphatase | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PF00689 Cation_ATPase_C: Cation transporting ATPase, C-terminus; InterPro: IPR006068 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 | Back alignment and domain information |
|---|
| >PLN02177 glycerol-3-phosphate acyltransferase | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >COG3700 AphA Acid phosphatase (class B) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4383|consensus | Back alignment and domain information |
|---|
| >TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 523 | |||
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 2e-29 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 3e-29 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 3e-27 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 4e-26 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 5e-25 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 1e-10 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 2e-05 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 2e-10 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 7e-07 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 5e-10 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 2e-04 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 1e-09 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 4e-06 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 1e-09 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 6e-04 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 4e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 3gwi_A | 170 | Magnesium-transporting ATPase, P-type 1; P-type AT | 1e-05 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 3e-05 |
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Length = 1028 | Back alignment and structure |
|---|
Score = 122 bits (308), Expect = 2e-29
Identities = 52/230 (22%), Positives = 86/230 (37%), Gaps = 38/230 (16%)
Query: 291 ENIVSVLSEYTEQGYRVIALASRTLSIEDYKH---LNYMKREDIEKDLEFLGLIILENRL 347
E + E G RV+ L + Y + + DL F+GL+ + +
Sbjct: 541 EAFQNAYLELGGLGERVLGFCHFALPEDKYNEGYPFDADEPNFPTTDLCFVGLMAMIDPP 600
Query: 348 KPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPK 407
+ + + + A +KV+M+TGD+ TA ++AK GII G ++ A
Sbjct: 601 RAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETIEDIAARLN------ 654
Query: 408 VYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIR---DQMPELIPRI 464
A V G +L + + +++
Sbjct: 655 ----------------------IPIGQVNPRDAKACVVHGS--DLKDLSTEVLDDILHY- 689
Query: 465 IVKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGIS 514
+FAR S QK +V Q+ G VA+ GDG ND AL+ A G++
Sbjct: 690 -HTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVA 738
|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2xzb_A 1iwc_A 1iwf_A Length = 1034 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Length = 995 | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Length = 280 | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Length = 280 | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Length = 263 | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Length = 263 | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Length = 287 | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Length = 287 | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Length = 736 | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Length = 736 | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 645 | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 645 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3gwi_A Magnesium-transporting ATPase, P-type 1; P-type ATPase, nucleotide binding, ATP binding, MGTA, membra protein, cell inner membrane; 1.60A {Escherichia coli} Length = 170 | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Length = 206 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 523 | |||
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 100.0 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 100.0 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 100.0 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 100.0 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 100.0 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 100.0 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 100.0 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 100.0 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 99.62 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 99.69 | |
| 3pgv_A | 285 | Haloacid dehalogenase-like hydrolase; structural g | 99.64 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 99.61 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 99.61 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 99.6 | |
| 3dao_A | 283 | Putative phosphatse; structural genomics, joint ce | 99.58 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 99.55 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 99.54 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 99.5 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 99.49 | |
| 2b30_A | 301 | Pvivax hypothetical protein; SGPP, structural geno | 99.49 | |
| 3r4c_A | 268 | Hydrolase, haloacid dehalogenase-like hydrolase; h | 99.49 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 99.48 | |
| 3fzq_A | 274 | Putative hydrolase; YP_001086940.1, putative haloa | 99.47 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 99.47 | |
| 3l7y_A | 304 | Putative uncharacterized protein SMU.1108C; hydrol | 99.44 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 99.44 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 99.43 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 99.39 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 99.38 | |
| 1rlm_A | 271 | Phosphatase; HAD family, rossman fold, hydrolase; | 99.38 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 99.35 | |
| 1s2o_A | 244 | SPP, sucrose-phosphatase; phosphohydrolase, HAD su | 99.34 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 99.31 | |
| 3f9r_A | 246 | Phosphomannomutase; trypanosome glycobiology struc | 99.29 | |
| 2rbk_A | 261 | Putative uncharacterized protein; HAD-like phospha | 99.23 | |
| 2amy_A | 246 | PMM 2, phosphomannomutase 2; HS.459855, HS.313504, | 99.22 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.2 | |
| 2fue_A | 262 | PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ | 99.19 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 99.17 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 99.1 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 99.08 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 99.05 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 98.99 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 98.97 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 98.94 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 98.93 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 98.91 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 98.84 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 98.79 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 98.77 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 98.74 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 98.73 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.69 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 98.67 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.65 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 98.63 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 98.62 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 98.6 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 98.55 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 98.51 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 98.51 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 98.5 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 98.5 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 98.5 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 98.49 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 98.49 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 98.48 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 98.47 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 98.46 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 98.46 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 98.43 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 98.42 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 98.42 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 98.42 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 98.4 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 98.38 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 98.33 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 98.33 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 98.31 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 98.31 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 98.3 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 98.28 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 98.25 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 98.25 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 98.25 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 98.24 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 98.23 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 98.23 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 98.23 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 98.22 | |
| 1vjr_A | 271 | 4-nitrophenylphosphatase; TM1742, structural genom | 98.19 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 98.16 | |
| 2x4d_A | 271 | HLHPP, phospholysine phosphohistidine inorganic py | 98.15 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 98.14 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 98.14 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 98.12 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 98.12 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 98.12 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 98.1 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 98.09 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 98.08 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 98.07 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 98.07 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 98.06 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 98.04 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.03 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 98.03 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 98.03 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 98.03 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 98.0 | |
| 3epr_A | 264 | Hydrolase, haloacid dehalogenase-like family; stru | 98.0 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 97.99 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 97.97 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 97.92 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 97.86 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 97.86 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 97.83 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 97.83 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 97.81 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 97.78 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 97.75 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 97.7 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 97.56 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 97.38 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 97.28 | |
| 2oyc_A | 306 | PLP phosphatase, pyridoxal phosphate phosphatase; | 97.27 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 97.27 | |
| 2ho4_A | 259 | Haloacid dehalogenase-like hydrolase domain contai | 97.23 | |
| 3gwi_A | 170 | Magnesium-transporting ATPase, P-type 1; P-type AT | 97.22 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 97.16 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 97.09 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 96.93 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 96.88 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 96.8 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 96.76 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 96.75 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 96.73 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 96.72 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 96.62 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 96.49 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 96.31 | |
| 1yv9_A | 264 | Hydrolase, haloacid dehalogenase family; hypotheti | 96.12 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 95.99 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 95.91 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 95.8 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 95.19 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 95.07 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 93.28 | |
| 1zjj_A | 263 | Hypothetical protein PH1952; alpha/beta hydrolase | 93.07 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 92.61 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 92.5 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 91.26 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 90.18 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 89.96 | |
| 2hx1_A | 284 | Predicted sugar phosphatases of the HAD superfamil | 87.94 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 86.75 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 86.33 | |
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 85.65 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 83.56 | |
| 1svj_A | 156 | Potassium-transporting ATPase B chain; alpha-beta | 82.65 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 80.92 |
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5.5e-37 Score=349.90 Aligned_cols=309 Identities=24% Similarity=0.297 Sum_probs=208.9
Q ss_pred ecCCchHHHHHHHHhheeeccCCCChhHHHHHHHHHHHHHhhcccc----------------cccc---cceeeeeeehh
Q psy78 181 LRGRSLWDIVIKSLDIITIVIPPALPATMTVGKLYALTRLKKYNIS----------------CINS---RVINLMTVGKL 241 (523)
Q Consensus 181 ~~~~~~~~~~~~~~~vlv~~~P~aLp~~~~~~~~~~~~~l~k~~~~----------------~~~~---~t~~~m~v~~~ 241 (523)
+.+.++.+++.+++++++++||||||+++|++++.|+.||+|+|++ |+++ +|+|+|+|.++
T Consensus 322 ~~~~~~~~~~~~~i~l~v~~iPe~Lp~~vti~la~~~~rmak~~~lvr~l~avE~LG~v~~IcsDKTGTLT~n~m~v~~~ 401 (1034)
T 3ixz_A 322 CIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHL 401 (1034)
T ss_pred HhcchHHHHHHHHHHHHHheeccccHHHHHHHHHHHHHHHhhCCeEecChHHHHhhcCCcEEEcCCCCCcccCeEEEEEE
Confidence 4678899999999999999999999999999999999999999974 3444 89999999998
Q ss_pred hhhhhcc------------------------ccceeeecCCc-------------------------------------c
Q psy78 242 YALTRLK------------------------KYNISCINSRV-------------------------------------I 260 (523)
Q Consensus 242 ~~~~~~~------------------------~~~il~~~~~~-------------------------------------~ 260 (523)
|..+... ....+|.+... .
T Consensus 402 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~lc~~a~~~~~~~~~~~~~~~~~gdp~e~All~~~~~~~~~~~~~~ 481 (1034)
T 3ixz_A 402 WFDNHIHSADTTEDQSGQTFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMGYR 481 (1034)
T ss_pred EECCccccccCcccccccccCcCCHHHHHHHHHHHHhccceeccCcCCCcccCceeccCchHHHHHHHHHHhCCChHHHH
Confidence 7643221 01112211100 0
Q ss_pred ccCCceeEEeecccccc--ccccccC-------------CC-------------------CcchhHHHHHHHHHhhccCe
Q psy78 261 NVSGSINCVCFDKMFES--TGWTLEE-------------PM-------------------KFVPENIVSVLSEYTEQGYR 306 (523)
Q Consensus 261 ~~~~~v~~v~fDK~~~~--~~~~~~~-------------~~-------------------~~~~~~~~~~~~~~~~~G~r 306 (523)
+...++..+.||...+. +-....+ ++ ++.++.+.+..++++++|+|
T Consensus 482 ~~~~~~~~~pF~s~rk~m~~v~~~~~~~~~~~~l~~KGApe~il~~c~~~~~~~~~~~l~~~~~~~~~~~~~~~a~~G~R 561 (1034)
T 3ixz_A 482 ERFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHVLVMKGAPERVLERCSSILIKGQELPLDEQWREAFQTAYLSLGGLGER 561 (1034)
T ss_pred HhCcceEEeeecCCCceEEEEEEecCCCCccEEEEEeCChHHHHHHhHHhhcCCceecCCHHHHHHHHHHHHHHHhcCcH
Confidence 01122344445541110 0000000 00 12235567788899999999
Q ss_pred EEEEEEecCCchhHHHhhh---cchhhhhccceeeeeeeeccCCCcchHHHHHHHHhCCCcEEEEcCCCHhhHHHHHHHc
Q psy78 307 VIALASRTLSIEDYKHLNY---MKREDIEKDLEFLGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKEC 383 (523)
Q Consensus 307 ~l~~a~k~l~~~~~~~~~~---~~~~~~e~dl~~lG~i~~~d~lr~~t~~aI~~Lk~~Gi~vvi~TGr~~~~a~~ia~~l 383 (523)
|+++|+|.++.+....... ...+..|+|++|+|+++++|++|+++++||++|+++||+++|+|||++.++.++++++
T Consensus 562 vLa~A~~~l~~~~~~~~~~~~~~~~~~~e~~l~~lGlv~i~Dp~r~~~~~aI~~l~~aGI~vvmiTGd~~~tA~~ia~~l 641 (1034)
T 3ixz_A 562 VLGFCQLYLSEKDYPPGYAFDVEAMNFPTSGLSFAGLVSMIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASV 641 (1034)
T ss_pred hheEeEEecChhhcccccccchhhhhccccCcEEEEEEeccCCCchhHHHHHHHHHHcCCeEEEEeCCCHHHHHHHHHHc
Confidence 9999999987542211110 1223468999999999999999999999999999999999999999999999999999
Q ss_pred CccCCCCeEEEeecCCCCCCCCCceEEEecCcchhhhhhhhcccCchhhhhccCCCceEEEEecccHHHHHhhCcchHhh
Q psy78 384 GIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPR 463 (523)
Q Consensus 384 gi~~~~~~~i~~ng~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~l~~~~~~~~~~ 463 (523)
|+..++...+. ......... .............+++..+..+.+ +.+..
T Consensus 642 gi~~~~~~~i~-------------------------~~~~~~~~~---~~~~~~~~~~~~~~~g~~l~~~~~---~~l~~ 690 (1034)
T 3ixz_A 642 GIISEGSETVE-------------------------DIAARLRVP---VDQVNRKDARACVINGMQLKDMDP---SELVE 690 (1034)
T ss_pred CCCCCCchHHH-------------------------HHHHhhCcc---chhccccccceeEEecHhhhhCCH---HHHHH
Confidence 99753221100 000000000 000001112234455554433221 12222
Q ss_pred hhc--ccEEEEcCChHhHHHHHHHHHHCCCEEEEEcCChhhHHHHHhCCccEEec-ccCC
Q psy78 464 IIV--KGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGISLS-EAES 520 (523)
Q Consensus 464 ~~~--~~~v~~~~~p~~K~~~i~~L~~~~~~V~a~GDG~ND~~MLk~A~vGIAMg-na~~ 520 (523)
... ...+++|++|++|..+++.+++.++.|+|+|||.||++||+.||+||||| ||.+
T Consensus 691 ~~~~~~~~v~ar~~P~~K~~iv~~lq~~g~~V~a~GDG~ND~~mLk~A~vGIAMg~ng~d 750 (1034)
T 3ixz_A 691 ALRTHPEMVFARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSPALKKADIGVAMGIAGSD 750 (1034)
T ss_pred HHHhCCceEEEecCHHHHHHHHHHHHHcCCEEEEECCcHHhHHHHHHCCeeEEeCCccCH
Confidence 222 22589999999999999999999999999999999999999999999999 7654
|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* | Back alignment and structure |
|---|
| >2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A | Back alignment and structure |
|---|
| >2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A | Back alignment and structure |
|---|
| >3gwi_A Magnesium-transporting ATPase, P-type 1; P-type ATPase, nucleotide binding, ATP binding, MGTA, membra protein, cell inner membrane; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >1svj_A Potassium-transporting ATPase B chain; alpha-beta sandwich, hydrolase; NMR {Escherichia coli} SCOP: d.220.1.1 PDB: 1u7q_A 2a00_A* 2a29_A* | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 523 | ||||
| d1wpga2 | 168 | c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, ca | 2e-15 | |
| d1qyia_ | 380 | c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 | 2e-11 | |
| d1wpga3 | 239 | d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryc | 3e-06 | |
| d1q3ia_ | 214 | d.220.1.1 (A:) Sodium/potassium-transporting ATPas | 4e-06 | |
| d1wr8a_ | 230 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 6e-05 | |
| d2b8ea1 | 135 | c.108.1.7 (A:416-434,A:548-663) Cation-transportin | 2e-04 | |
| d2b8ea1 | 135 | c.108.1.7 (A:416-434,A:548-663) Cation-transportin | 0.001 | |
| d1l6ra_ | 225 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 3e-04 |
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 168 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Meta-cation ATPase, catalytic domain P domain: Calcium ATPase, catalytic domain P species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Score = 72.1 bits (176), Expect = 2e-15
Identities = 42/185 (22%), Positives = 64/185 (34%), Gaps = 51/185 (27%)
Query: 334 DLEFLGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVV 393
D + + + G I+ +DA ++V+MITGDN TAI++ + GI E V
Sbjct: 8 DKTGTLTTNQLDPPRKEVMGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVA 67
Query: 394 DVSAVPGGLKECPKVYFTVSGVSAIQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELI 453
D + TG+ ++ +
Sbjct: 68 DRA------------------------------------------------YTGREFDDL 79
Query: 454 RDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCGDGANDCGALRAAHAGI 513
R FAR+ K ++V LQ AM GDG ND AL+ A GI
Sbjct: 80 PLAEQREACRRAC---CFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGI 136
Query: 514 SLSEA 518
++
Sbjct: 137 AMGSG 141
|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 | Back information, alignment and structure |
|---|
| >d1wpga3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 239 | Back information, alignment and structure |
|---|
| >d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} Length = 214 | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 135 | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 135 | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 523 | |||
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 99.88 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 99.85 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 99.68 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 99.62 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.61 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 99.57 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 99.57 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 99.57 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 99.56 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 99.55 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 99.52 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 99.52 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 99.51 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 99.38 | |
| d2fuea1 | 244 | Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: | 99.19 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 99.18 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 99.09 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 99.07 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 99.03 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 98.97 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 98.78 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.78 | |
| d1wpga4 | 472 | Calcium ATPase, transmembrane domain M {Rabbit (Or | 98.27 | |
| d1q3ia_ | 214 | Sodium/potassium-transporting ATPase alpha chain { | 98.11 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 97.81 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 97.67 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 97.53 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 97.4 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 97.32 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 97.16 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 97.08 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 97.01 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 96.96 | |
| d1yv9a1 | 253 | Putative hydrolase EF1188 {Enterococcus faecalis [ | 96.95 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 96.78 | |
| d1wpga3 | 239 | Calcium ATPase {Rabbit (Oryctolagus cuniculus) [Ta | 96.77 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 96.75 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 96.73 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 96.63 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 96.38 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 96.14 | |
| d1vjra_ | 261 | Hypothetical protein TM1742 {Thermotoga maritima [ | 96.06 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 95.91 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 95.84 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 95.55 | |
| d1wpga4 | 472 | Calcium ATPase, transmembrane domain M {Rabbit (Or | 95.54 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 95.52 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 95.13 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 94.6 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 94.05 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 94.03 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 93.44 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 92.26 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 91.68 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 90.54 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 88.62 |
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Meta-cation ATPase, catalytic domain P domain: Calcium ATPase, catalytic domain P species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Probab=99.88 E-value=4.3e-23 Score=182.96 Aligned_cols=131 Identities=31% Similarity=0.420 Sum_probs=101.7
Q ss_pred eeeeeeccCCCcchHHHHHHHHhCCCcEEEEcCCCHhhHHHHHHHcCccCCCCeEEEeecCCCCCCCCCceEEEecCcch
Q psy78 338 LGLIILENRLKPQTEGVIKELKDARVKVVMITGDNIQTAISVAKECGIIDPGETVVDVSAVPGGLKECPKVYFTVSGVSA 417 (523)
Q Consensus 338 lG~i~~~d~lr~~t~~aI~~Lk~~Gi~vvi~TGr~~~~a~~ia~~lgi~~~~~~~i~~ng~~~~~~~~~~~~~~~~~~~~ 417 (523)
..++..-||+|++++++|+.||++|++++|+|||+..++..+|+++|+..++..+.
T Consensus 12 ~~~~~~~Dp~R~~~~~~I~~l~~~GI~v~miTGD~~~tA~~ia~~~Gi~~~~~~v~------------------------ 67 (168)
T d1wpga2 12 TLTTNQLDPPRKEVMGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVA------------------------ 67 (168)
T ss_dssp TTBCCCECCBCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHTTSSCTTCCCT------------------------
T ss_pred EEEEEecCCCchhHHHHHHHHHHCcCEEEEECCCCHHHHHHHHHHcCCCCCccccc------------------------
Confidence 33344449999999999999999999999999999999999999999975433210
Q ss_pred hhhhhhhcccCchhhhhccCCCceEEEEecccHHHHHhhCcchHhhhhcccEEEEcCChHhHHHHHHHHHHCCCEEEEEc
Q psy78 418 IQTKAKKLNYSKTEEELGLSSGAYKFAVTGKSWELIRDQMPELIPRIIVKGAIFARMSSDQKQQLVLELQQLGYYVAMCG 497 (523)
Q Consensus 418 ~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~l~~~~~~~~~~~~~~~~v~~~~~p~~K~~~i~~L~~~~~~V~a~G 497 (523)
...+++++++ ............+..+++|++|++|..+++.+++.++.|+|+|
T Consensus 68 ------------------------~~~~~~~~~~---~~~~~~~~~~~~~~~v~ar~~p~~K~~lv~~l~~~g~~Va~vG 120 (168)
T d1wpga2 68 ------------------------DRAYTGREFD---DLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTG 120 (168)
T ss_dssp ------------------------TTEEEHHHHH---HSCHHHHHHHHHHCCEEESCCHHHHHHHHHHHHHTTCCEEEEE
T ss_pred ------------------------cccccccccc---hhhHHHHhhhhhhhhhhhccchhHHHHHHHHHHhcccceeEEe
Confidence 0011222221 1111222333445579999999999999999999999999999
Q ss_pred CChhhHHHHHhCCccEEecccC
Q psy78 498 DGANDCGALRAAHAGISLSEAE 519 (523)
Q Consensus 498 DG~ND~~MLk~A~vGIAMgna~ 519 (523)
||.||++||+.||+||||+++.
T Consensus 121 DG~nD~~AL~~AdvGIa~~~gt 142 (168)
T d1wpga2 121 DGVNDAPALKKAEIGIAMGSGT 142 (168)
T ss_dssp CSGGGHHHHHHSSEEEEETTSC
T ss_pred cCCCCHHHHHhCCEEEEecccc
Confidence 9999999999999999999754
|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wpga3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wpga4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|