Psyllid ID: psy795

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MAFQHQAGTAMECLSPPDGRRVLKCGFKIGGGIDQDYKKSPQGYTDNGIYVTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHKKAVDYIKKHPVLNLLVARKGVTST
cccccccccccEEEccccccccccccEEEEccccccccccccccccccEEEEEEccccHHHHcccccccEEEEEccEEcccccHHHHHHHHHcccEEEEEEEEcccccc
cccccccccEEEEEEcccccccccEEEEEEcccccccccccccccccEEEEEEEccccccHHHccccccEEEEEccEEcccccHHHHHHHHHHccEEEEEEEEcccccc
mafqhqagtameclsppdgrrvlkcgfkigggidqdykkspqgytdngiyvtevydespasksglrmhdkilqcngydftmVTHKKAVDYIKKHPVLNLLVARKGVTST
mafqhqagtameclsppdgRRVLKCGFKIGggidqdykkspqgYTDNGIYVTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHKKAVDYIKKHPVLNLlvarkgvtst
MAFQHQAGTAMECLSPPDGRRVLKCGFKIGGGIDQDYKKSPQGYTDNGIYVTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHKKAVDYIKKHPVLNLLVARKGVTST
*******************RRVLKCGFKIGGGIDQDYKKSPQGYTDNGIYVTEVYD*******GLRMHDKILQCNGYDFTMVTHKKAVDYIKKHPVLNLLVAR******
********************RVLKCGFKIGGGIDQDYKKSPQGYTDNGIYVTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHKKAVDYIKKHPVLNLL**RK*****
**********MECLSPPDGRRVLKCGFKIGGGIDQDYKKSPQGYTDNGIYVTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHKKAVDYIKKHPVLNLLVARKGVTST
*****QAGTAMECLSPPDGRRVLKCGFKIGGGIDQDYKKSPQGYTDNGIYVTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHKKAVDYIKKHPVLNLLVARKG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFQHQAGTAMECLSPPDGRRVLKCGFKIGGGIDQDYKKSPQGYTDNGIYVTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHKKAVDYIKKHPVLNLLVARKGVTST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q09506124 Uncharacterized protein C yes N/A 0.935 0.822 0.513 3e-25
Q9DBG9124 Tax1-binding protein 3 OS yes N/A 0.770 0.677 0.488 1e-15
O14907124 Tax1-binding protein 3 OS yes N/A 0.770 0.677 0.488 1e-15
Q80TH21402 Protein LAP2 OS=Mus muscu no N/A 0.697 0.054 0.412 7e-08
Q6ZMN7 1036 PDZ domain-containing RIN no N/A 0.697 0.073 0.345 3e-07
Q96RT11412 Protein LAP2 OS=Homo sapi no N/A 0.697 0.053 0.4 8e-07
Q69ZS0 1063 E3 ubiquitin-protein liga no N/A 0.697 0.071 0.358 1e-06
P68907 1062 E3 ubiquitin-protein liga yes N/A 0.697 0.071 0.358 1e-06
Q9UPQ7 1066 E3 ubiquitin-protein liga no N/A 0.697 0.071 0.358 1e-06
F1MCA71536 Leucine-rich repeat-conta no N/A 0.697 0.049 0.4 3e-06
>sp|Q09506|YQI7_CAEEL Uncharacterized protein C45G9.7 OS=Caenorhabditis elegans GN=C45G9.7 PE=1 SV=1 Back     alignment and function desciption
 Score =  113 bits (283), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 74/113 (65%), Gaps = 11/113 (9%)

Query: 2   AFQHQAGTAMECLS-----------PPDGRRVLKCGFKIGGGIDQDYKKSPQGYTDNGIY 50
           A+ H  G A+ECLS              G+  ++ GFKIGGGIDQD  K+P  Y D+G+Y
Sbjct: 3   AYGHMPGEAIECLSIAVELHKQEVIDAHGQVTIRVGFKIGGGIDQDPTKAPFKYPDSGVY 62

Query: 51  VTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHKKAVDYIKKHPVLNLLVAR 103
           +T V   SPA  +GLR HDKILQ NG DFTM+TH +AV +IK+  VL++LVAR
Sbjct: 63  ITNVESGSPADVAGLRKHDKILQVNGADFTMMTHDRAVKFIKQSKVLHMLVAR 115

Caenorhabditis elegans (taxid: 6239)
>sp|Q9DBG9|TX1B3_MOUSE Tax1-binding protein 3 OS=Mus musculus GN=Tax1bp3 PE=1 SV=1 Back     alignment and function description
>sp|O14907|TX1B3_HUMAN Tax1-binding protein 3 OS=Homo sapiens GN=TAX1BP3 PE=1 SV=2 Back     alignment and function description
>sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 Back     alignment and function description
>sp|Q6ZMN7|PZRN4_HUMAN PDZ domain-containing RING finger protein 4 OS=Homo sapiens GN=PDZRN4 PE=1 SV=3 Back     alignment and function description
>sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 Back     alignment and function description
>sp|Q69ZS0|PZRN3_MOUSE E3 ubiquitin-protein ligase PDZRN3 OS=Mus musculus GN=Pdzrn3 PE=1 SV=3 Back     alignment and function description
>sp|P68907|PZRN3_RAT E3 ubiquitin-protein ligase PDZRN3 OS=Rattus norvegicus GN=Pdzrn3 PE=1 SV=1 Back     alignment and function description
>sp|Q9UPQ7|PZRN3_HUMAN E3 ubiquitin-protein ligase PDZRN3 OS=Homo sapiens GN=PDZRN3 PE=1 SV=2 Back     alignment and function description
>sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
242015111124 conserved hypothetical protein [Pediculu 1.0 0.879 0.825 8e-51
357625692120 hypothetical protein KGM_19990 [Danaus p 1.0 0.908 0.816 1e-50
328784006124 PREDICTED: uncharacterized protein C45G9 1.0 0.879 0.8 1e-49
350398911124 PREDICTED: uncharacterized protein C45G9 1.0 0.879 0.791 4e-49
332030185120 Uncharacterized protein C45G9.7 [Acromyr 1.0 0.908 0.8 6e-49
157107691123 hypothetical protein AaeL_AAEL004858 [Ae 1.0 0.886 0.808 6e-49
328705816124 PREDICTED: uncharacterized protein C45G9 1.0 0.879 0.791 1e-48
307191028120 Uncharacterized protein C45G9.7 [Campono 1.0 0.908 0.791 1e-48
307205697120 Uncharacterized protein C45G9.7 [Harpegn 1.0 0.908 0.783 2e-48
383859055124 PREDICTED: uncharacterized protein C45G9 1.0 0.879 0.783 3e-48
>gi|242015111|ref|XP_002428217.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212512778|gb|EEB15479.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  203 bits (517), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 99/120 (82%), Positives = 106/120 (88%), Gaps = 11/120 (9%)

Query: 1   MAFQHQAGTAMECLSPP-----------DGRRVLKCGFKIGGGIDQDYKKSPQGYTDNGI 49
           MAFQHQAGTAMECLS P           +GR+VLKCGFKIGGGIDQD++KSPQGYTDNGI
Sbjct: 5   MAFQHQAGTAMECLSIPITLQKESGLDCEGRKVLKCGFKIGGGIDQDFRKSPQGYTDNGI 64

Query: 50  YVTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHKKAVDYIKKHPVLNLLVARKGVTST 109
           YVTEV++ SPA+KSGLRMHDKILQCNGYDFTMVTHKKAV YIKKHPVLNLLVARKGVTST
Sbjct: 65  YVTEVHEGSPAAKSGLRMHDKILQCNGYDFTMVTHKKAVTYIKKHPVLNLLVARKGVTST 124

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357625692|gb|EHJ76054.1| hypothetical protein KGM_19990 [Danaus plexippus] Back     alignment and taxonomy information
>gi|328784006|ref|XP_624047.2| PREDICTED: uncharacterized protein C45G9.7-like [Apis mellifera] gi|340712148|ref|XP_003394626.1| PREDICTED: uncharacterized protein C45G9.7-like [Bombus terrestris] gi|380030425|ref|XP_003698849.1| PREDICTED: uncharacterized protein C45G9.7-like [Apis florea] Back     alignment and taxonomy information
>gi|350398911|ref|XP_003485348.1| PREDICTED: uncharacterized protein C45G9.7-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332030185|gb|EGI69979.1| Uncharacterized protein C45G9.7 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157107691|ref|XP_001649893.1| hypothetical protein AaeL_AAEL004858 [Aedes aegypti] gi|157107695|ref|XP_001649895.1| hypothetical protein AaeL_AAEL004835 [Aedes aegypti] gi|170044011|ref|XP_001849656.1| conserved hypothetical protein [Culex quinquefasciatus] gi|108879505|gb|EAT43730.1| AAEL004858-PA [Aedes aegypti] gi|108879507|gb|EAT43732.1| AAEL004835-PA [Aedes aegypti] gi|167867267|gb|EDS30650.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328705816|ref|XP_001950107.2| PREDICTED: uncharacterized protein C45G9.7-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307191028|gb|EFN74782.1| Uncharacterized protein C45G9.7 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307205697|gb|EFN83959.1| Uncharacterized protein C45G9.7 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383859055|ref|XP_003705013.1| PREDICTED: uncharacterized protein C45G9.7-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
FB|FBgn0035148123 CG3402 [Drosophila melanogaste 1.0 0.886 0.766 1.3e-45
WB|WBGene00016678124 C45G9.7 [Caenorhabditis elegan 0.935 0.822 0.513 1.1e-23
UNIPROTKB|Q09506124 C45G9.7 "Uncharacterized prote 0.935 0.822 0.513 1.1e-23
ZFIN|ZDB-GENE-040426-2830125 tax1bp3 "Tax1 (human T-cell le 0.871 0.76 0.47 6.7e-17
UNIPROTKB|Q3ZCD3124 TAX1BP3 "Uncharacterized prote 0.743 0.653 0.494 4.2e-15
UNIPROTKB|E2R7R0124 TAX1BP3 "Uncharacterized prote 0.743 0.653 0.494 4.2e-15
UNIPROTKB|O14907124 TAX1BP3 "Tax1-binding protein 0.743 0.653 0.494 4.2e-15
UNIPROTKB|F2Z516124 TAX1BP3 "Uncharacterized prote 0.743 0.653 0.494 4.2e-15
UNIPROTKB|I3LEH0125 LOC100519729 "Uncharacterized 0.743 0.648 0.494 4.2e-15
MGI|MGI:1923531124 Tax1bp3 "Tax1 (human T cell le 0.743 0.653 0.494 4.2e-15
FB|FBgn0035148 CG3402 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 479 (173.7 bits), Expect = 1.3e-45, P = 1.3e-45
 Identities = 92/120 (76%), Positives = 104/120 (86%)

Query:     1 MAFQHQAGTAMECLSPP-----------DGRRVLKCGFKIGGGIDQDYKKSPQGYTDNGI 49
             MAFQHQAGTAMECLS P           +GR +LKCGFKIGGGIDQDYKKSPQGYTD GI
Sbjct:     4 MAFQHQAGTAMECLSIPITLHKEKDYDQEGREILKCGFKIGGGIDQDYKKSPQGYTDYGI 63

Query:    50 YVTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHKKAVDYIKKHPVLNLLVARKGVTST 109
             YVTEV++ SPA+++GLR+HDKILQCNGYDFTMVTHKKAV YI+K+P+LN+LVARKGVTST
Sbjct:    64 YVTEVHEGSPAARAGLRIHDKILQCNGYDFTMVTHKKAVSYIRKNPILNMLVARKGVTST 123
GO:0030111 "regulation of Wnt receptor signaling pathway" evidence=IEA
WB|WBGene00016678 C45G9.7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q09506 C45G9.7 "Uncharacterized protein C45G9.7" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2830 tax1bp3 "Tax1 (human T-cell leukemia virus type I) binding protein 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCD3 TAX1BP3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R7R0 TAX1BP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O14907 TAX1BP3 "Tax1-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z516 TAX1BP3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LEH0 LOC100519729 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1923531 Tax1bp3 "Tax1 (human T cell leukemia virus type I) binding protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9DBG9TX1B3_MOUSENo assigned EC number0.48860.77060.6774yesN/A
O14907TX1B3_HUMANNo assigned EC number0.48860.77060.6774yesN/A
Q09506YQI7_CAEELNo assigned EC number0.51320.93570.8225yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 2e-13
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 2e-13
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 1e-09
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 2e-09
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 3e-07
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 4e-06
COG0793 406 COG0793, Prc, Periplasmic protease [Cell envelope 5e-05
pfam1318081 pfam13180, PDZ_2, PDZ domain 9e-05
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 1e-04
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 0.001
TIGR02037 428 TIGR02037, degP_htrA_DO, periplasmic serine protea 0.004
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information 
 Score = 60.1 bits (146), Expect = 2e-13
 Identities = 31/81 (38%), Positives = 43/81 (53%), Gaps = 11/81 (13%)

Query: 26  GFKIGGGIDQDYKKSPQGYTDNGIYVTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHK 85
           GF + GG D+            G+ V+ V   SPA+K+GLR+ D IL+ NG     +TH 
Sbjct: 15  GFSLVGGKDEG----------GGVVVSSVVPGSPAAKAGLRVGDVILEVNGTSVEGLTHL 64

Query: 86  KAVDYIKK-HPVLNLLVARKG 105
           +AVD +KK    + L V R G
Sbjct: 65  EAVDLLKKAGGKVTLTVLRGG 85

Also called DHR (Dlg homologous region) or GLGF (relatively well conserved tetrapeptide in these domains). Some PDZs have been shown to bind C-terminal polypeptides; others appear to bind internal (non-C-terminal) polypeptides. Different PDZs possess different binding specificities. Length = 85
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
KOG3553|consensus124 99.9
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.62
KOG3550|consensus207 99.54
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.47
KOG3209|consensus984 99.4
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 99.38
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.36
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.35
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 99.33
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 99.16
KOG3549|consensus 505 99.16
KOG3209|consensus 984 99.16
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 99.09
KOG3551|consensus 506 99.07
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 99.06
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 99.06
PLN00049 389 carboxyl-terminal processing protease; Provisional 99.02
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.94
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.93
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.93
KOG1892|consensus 1629 98.91
KOG3580|consensus 1027 98.88
KOG3571|consensus 626 98.88
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.8
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.78
PRK10139 455 serine endoprotease; Provisional 98.76
KOG3580|consensus 1027 98.75
PRK11186 667 carboxy-terminal protease; Provisional 98.72
KOG3606|consensus358 98.72
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.69
PRK10942473 serine endoprotease; Provisional 98.69
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 98.67
PRK10139455 serine endoprotease; Provisional 98.67
KOG3542|consensus 1283 98.66
KOG3552|consensus 1298 98.66
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.64
PRK10898353 serine endoprotease; Provisional 98.64
PRK10942473 serine endoprotease; Provisional 98.62
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.59
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.56
KOG3651|consensus 429 98.46
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 98.21
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 98.2
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 98.19
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 98.18
KOG3129|consensus231 98.1
COG0265347 DegQ Trypsin-like serine proteases, typically peri 98.05
COG3975558 Predicted protease with the C-terminal PDZ domain 97.94
KOG3605|consensus829 97.88
PRK09681276 putative type II secretion protein GspC; Provision 97.82
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.7
KOG0609|consensus 542 97.64
KOG0606|consensus 1205 97.59
KOG3605|consensus829 97.56
KOG1320|consensus473 97.49
COG3031275 PulC Type II secretory pathway, component PulC [In 97.27
KOG1738|consensus 638 97.24
KOG3938|consensus 334 97.17
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 97.13
KOG1421|consensus 955 96.87
KOG3532|consensus 1051 96.33
PF1281278 PDZ_1: PDZ-like domain 95.0
COG0750 375 Predicted membrane-associated Zn-dependent proteas 94.16
KOG3834|consensus 462 92.65
KOG4371|consensus1332 92.37
KOG4371|consensus1332 90.51
PF11874183 DUF3394: Domain of unknown function (DUF3394); Int 90.49
KOG4407|consensus 1973 90.48
KOG4407|consensus 1973 88.1
KOG2921|consensus 484 87.85
KOG1421|consensus955 86.63
KOG3834|consensus 462 84.54
>KOG3553|consensus Back     alignment and domain information 
Probab=99.90  E-value=3.9e-24  Score=123.77  Aligned_cols=107  Identities=61%  Similarity=0.935  Sum_probs=97.8

Q ss_pred             CCcccCCCCceEEeeec-----------CCCCcceecEEEecccCCCCCCCCCCCCCCCEEEEEECCCChhhhcCCCCCC
Q psy795            1 MAFQHQAGTAMECLSPP-----------DGRRVLKCGFKIGGGIDQDYKKSPQGYTDNGIYVTEVYDESPASKSGLRMHD   69 (109)
Q Consensus         1 ~~~~~~~~~~~~~~~~~-----------~~~~~~~lG~~i~g~~~~~~~~~~~~~~~~gi~V~~v~~gs~a~~~Gl~~gD   69 (109)
                      |||+|.|+.+++|+++.           .+++..-+||.+-|+.+|+++++|+...+.|+||..|.+||||+.+||+.+|
T Consensus         2 ~a~~h~pG~aveclsi~velHK~~~~d~~Gre~l~~GFkIGGGIDQDp~k~Pf~ytD~GiYvT~V~eGsPA~~AGLrihD   81 (124)
T KOG3553|consen    2 MAMSHIPGQAVECLSIRVELHKLRDYDQQGRENLILGFKIGGGIDQDPSKNPFSYTDKGIYVTRVSEGSPAEIAGLRIHD   81 (124)
T ss_pred             cccccCCCCceEEEEEEEEeeeehhhhcCCcEEEEEEEEeccccCCCcccCCCCcCCccEEEEEeccCChhhhhcceecc
Confidence            79999999999999988           3456678999999999999999999999999999999999999999999999


Q ss_pred             EEEEECCEEeccccHHHHHHHhcCCCeEEEEEEeCCEe
Q psy795           70 KILQCNGYDFTMVTHKKAVDYIKKHPVLNLLVARKGVT  107 (109)
Q Consensus        70 ~i~~vn~~~i~~~~~~~~~~~l~~~~~v~l~v~r~~~~  107 (109)
                      .|+.+||-++.-++|+.++..+++.+.+.++|.|.+.+
T Consensus        82 KIlQvNG~DfTMvTHd~Avk~i~k~~vl~mLVaR~~l~  119 (124)
T KOG3553|consen   82 KILQVNGWDFTMVTHDQAVKRITKEEVLRMLVARQSLQ  119 (124)
T ss_pred             eEEEecCceeEEEEhHHHHHHhhHhHHHHHHHHhhccc
Confidence            99999999999999999999999877777777776543

>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>PF11874 DUF3394: Domain of unknown function (DUF3394); InterPro: IPR021814 This domain is functionally uncharacterised Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG2921|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2vz5_A139 Structure Of The Pdz Domain Of Tax1 (Human T-Cell L 8e-17
3diw_A124 C-Terminal Beta-Catenin Bound Tip-1 Structure Lengt 9e-17
3gj9_A124 Crystal Structure Of Tip-1 In Complex With C-Termin 9e-17
2kg2_A124 Solution Structure Of A Pdz Protein Length = 124 1e-16
3sfj_A104 Crystal Structure Of Tax-Interacting Protein-1 (Tip 1e-16
3dj3_A113 Crystal Structure Of C-Terminal Truncated Tip-1 (6- 1e-16
4e3b_A102 Crystal Structure Of Tax-Interacting Protein-1 (Tip 1e-16
1mfg_A95 The Structure Of Erbin Pdz Domain Bound To The Carb 2e-08
1uhp_A107 Solution Structure Of Rsgi Ruh-005, A Pdz Domain In 2e-08
2h3l_A103 Crystal Structure Of Erbin Pdz Length = 103 2e-08
3ch8_A 195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 2e-08
2qbw_A 195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 3e-08
2w4f_A97 Crystal Structure Of The First Pdz Domain Of Human 2e-07
1x5q_A110 Solution Structure Of The First Pdz Domain Of Scrib 5e-07
3shu_A95 Crystal Structure Of Zo-1 Pdz3 Length = 95 7e-07
3tsv_A124 Crystal Structure Of The Third Pdz Domain Of The Hu 1e-06
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 2e-06
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 2e-06
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 2e-06
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 2e-06
3tsw_B 194 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 2e-06
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 4e-06
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 7e-06
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 8e-06
3tsw_A 391 Crystal Structure Of The Pdz3-Sh3-Guk Core Module O 8e-06
3shw_A 468 Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule 1e-05
2ehr_A117 Solution Structure Of The Sixth Pdz Domain Of Human 1e-05
2he4_A90 The Crystal Structure Of The Second Pdz Domain Of H 1e-05
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 2e-05
2fcf_A103 The Crystal Structure Of The 7th Pdz Domain Of Mpdz 2e-05
2iwq_A123 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 3e-05
1x5n_A114 Solution Structure Of The Second Pdz Domain Of Harm 3e-05
2kbs_A92 Solution Structure Of Harmonin Pdz2 In Complex With 4e-05
1uf1_A128 Solution Structure Of The Second Pdz Domain Of Huma 4e-05
4amh_A106 Influence Of Circular Permutation On The Folding Pa 6e-05
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 7e-05
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 7e-05
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 7e-05
2ytw_A118 Solution Structure Of The Pdz-Domain Of Human Prote 1e-04
2eeh_A100 Solution Structure Of First Pdz Domain Of Pdz Domai 1e-04
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 1e-04
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 1e-04
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 1e-04
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 2e-04
2opg_A98 The Crystal Structure Of The 10th Pdz Domain Of Mpd 2e-04
2joa_A105 Htra1 Bound To An Optimized Peptide: Nmr Assignment 2e-04
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 2e-04
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 2e-04
1obz_A166 Crystal Structure Of The Complex Of The Pdz Tandem 3e-04
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 3e-04
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 3e-04
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 3e-04
1n99_A166 Crystal Structure Of The Pdz Tandem Of Human Synten 3e-04
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 3e-04
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 3e-04
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 4e-04
2k1z_A104 Solution Structure Of Par-3 Pdz3 Length = 104 4e-04
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 4e-04
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 4e-04
2koh_A111 Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve 5e-04
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 5e-04
3num_A332 Substrate Induced Remodeling Of The Active Site Reg 5e-04
3nzi_A334 Substrate Induced Remodeling Of The Active Site Reg 5e-04
3qdo_A109 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 6e-04
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 7e-04
2r4h_B112 Crystal Structure Of A C1190s Mutant Of The 6th Pdz 7e-04
3qgl_A101 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 7e-04
3qe1_A107 Crystal Structure Of Pdz Domain Of Sorting Nexin 27 8e-04
>pdb|2VZ5|A Chain A, Structure Of The Pdz Domain Of Tax1 (Human T-Cell Leukemia Virus Type I) Binding Protein 3 Length = 139 Back     alignment and structure 
Iteration: 1

 Score = 82.0 bits (201), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 57/88 (64%), Gaps = 4/88 (4%)
Query: 23  LKCGFKIGGGIDQDYKKSP--QGYTDNGIYVTEVYDESPASKSGLRMHDKILQCNGYDFT 80
           L  GF IGGGIDQD  ++P  +  TD GIYVT V +  PA  +GL++ DKI+Q NG+D T
Sbjct: 38  LILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMT 97
Query: 81  MVTHKKAVDYIKK--HPVLNLLVARKGV 106
           MVTH +A   + K    V+ LLV R+ +
Sbjct: 98  MVTHDQARKRLTKRSEEVVRLLVTRQSL 125
>pdb|3DIW|A Chain A, C-Terminal Beta-Catenin Bound Tip-1 Structure Length = 124 Back     alignment and structure
>pdb|3GJ9|A Chain A, Crystal Structure Of Tip-1 In Complex With C-Terminal Of Kir2.3 Length = 124 Back     alignment and structure
>pdb|2KG2|A Chain A, Solution Structure Of A Pdz Protein Length = 124 Back     alignment and structure
>pdb|3SFJ|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36 Inhibitor Peptide Length = 104 Back     alignment and structure
>pdb|3DJ3|A Chain A, Crystal Structure Of C-Terminal Truncated Tip-1 (6-113) Length = 113 Back     alignment and structure
>pdb|4E3B|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36-L (Ansrwptsil) Peptide Length = 102 Back     alignment and structure
>pdb|1MFG|A Chain A, The Structure Of Erbin Pdz Domain Bound To The Carboxy- Terminal Tail Of The Erbb2 Receptor Length = 95 Back     alignment and structure
>pdb|1UHP|A Chain A, Solution Structure Of Rsgi Ruh-005, A Pdz Domain In Human Cdna, Kiaa1095 Length = 107 Back     alignment and structure
>pdb|2H3L|A Chain A, Crystal Structure Of Erbin Pdz Length = 103 Back     alignment and structure
>pdb|3CH8|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure
>pdb|2QBW|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure
>pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 Back     alignment and structure
>pdb|1X5Q|A Chain A, Solution Structure Of The First Pdz Domain Of Scribble Homolog Protein (Hscrib) Length = 110 Back     alignment and structure
>pdb|3SHU|A Chain A, Crystal Structure Of Zo-1 Pdz3 Length = 95 Back     alignment and structure
>pdb|3TSV|A Chain A, Crystal Structure Of The Third Pdz Domain Of The Human Zo-1 Maguk Protein Length = 124 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|3TSW|A Chain A, Crystal Structure Of The Pdz3-Sh3-Guk Core Module Of Human Zo-1 Length = 391 Back     alignment and structure
>pdb|3SHW|A Chain A, Crystal Structure Of Zo-1 Pdz3-Sh3-Guk Supramodule Complex With Connexin-45 Peptide Length = 468 Back     alignment and structure
>pdb|2EHR|A Chain A, Solution Structure Of The Sixth Pdz Domain Of Human Inad- Like Protein Length = 117 Back     alignment and structure
>pdb|2HE4|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Nherf-2 (Slc9a3r2) Interacting With A Mode 1 Pdz Binding Motif Length = 90 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|2FCF|A Chain A, The Crystal Structure Of The 7th Pdz Domain Of Mpdz (Mupp-1) Length = 103 Back     alignment and structure
>pdb|2IWQ|A Chain A, 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz Length = 123 Back     alignment and structure
>pdb|1X5N|A Chain A, Solution Structure Of The Second Pdz Domain Of Harmonin Protein Length = 114 Back     alignment and structure
>pdb|2KBS|A Chain A, Solution Structure Of Harmonin Pdz2 In Complex With The Carboxyl Tail Peptide Of Cadherin23 Length = 92 Back     alignment and structure
>pdb|1UF1|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Kiaa1526 Protein Length = 128 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|2YTW|A Chain A, Solution Structure Of The Pdz-Domain Of Human Protease Htra 1 Precursor Length = 118 Back     alignment and structure
>pdb|2EEH|A Chain A, Solution Structure Of First Pdz Domain Of Pdz Domain Containing Protein 7 Length = 100 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|2OPG|A Chain A, The Crystal Structure Of The 10th Pdz Domain Of Mpdz Length = 98 Back     alignment and structure
>pdb|2JOA|A Chain A, Htra1 Bound To An Optimized Peptide: Nmr Assignment Of Pdz Domain And Ligand Resonances Length = 105 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|1OBZ|A Chain A, Crystal Structure Of The Complex Of The Pdz Tandem Of Syntenin With An Interleukin 5 Receptor Alpha Peptide. Length = 166 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|1N99|A Chain A, Crystal Structure Of The Pdz Tandem Of Human Syntenin Length = 166 Back     alignment and structure
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|2K1Z|A Chain A, Solution Structure Of Par-3 Pdz3 Length = 104 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2KOH|A Chain A, Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve-Cadherin C-Terminus Length = 111 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 Back     alignment and structure
>pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 Back     alignment and structure
>pdb|3QDO|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) Fused To The Gly-Gly Linker Followed By C-Terminal (Eseskv) Of Girk3 Length = 109 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|2R4H|B Chain B, Crystal Structure Of A C1190s Mutant Of The 6th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 112 Back     alignment and structure
>pdb|3QGL|A Chain A, Crystal Structure Of Pdz Domain Of Sorting Nexin 27 (Snx27) In Complex With The Eseskv Peptide Corresponding To The C-Terminal Tail Of Girk3 Length = 101 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 2e-25
2eeh_A100 PDZ domain-containing protein 7; structural genomi 1e-22
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 5e-22
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 1e-21
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 1e-21
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 3e-21
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 5e-20
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 6e-20
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 6e-20
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-19
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 2e-19
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 2e-19
3k1r_A192 Harmonin; protein-protein complex, alternative spl 7e-19
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 1e-18
2byg_A117 Channel associated protein of synapse-110; DLG2, P 1e-18
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 2e-18
2awx_A105 Synapse associated protein 97; membrane protein, s 5e-18
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 5e-18
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 5e-18
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 7e-18
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 1e-17
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 1e-17
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-17
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 2e-17
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-17
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 4e-17
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 6e-17
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 7e-17
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 1e-16
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 2e-16
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 2e-16
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 2e-16
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 2e-16
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 2e-16
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 3e-16
2eaq_A90 LIM domain only protein 7; conserved hypothetical 4e-16
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 4e-16
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 6e-16
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 6e-16
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 8e-16
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 8e-16
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-15
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 1e-15
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 1e-15
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-15
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-13
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 1e-15
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 2e-15
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-15
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-15
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 2e-15
2opg_A98 Multiple PDZ domain protein; structural protein, s 2e-15
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 3e-15
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 3e-15
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 3e-15
2fne_A117 Multiple PDZ domain protein; structural protein, s 3e-15
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 4e-15
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 4e-15
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 5e-15
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 6e-15
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 8e-15
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 9e-15
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 9e-15
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 1e-14
2qbw_A 195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 1e-14
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 2e-14
2djt_A104 Unnamed protein product; PDZ domain, structural ge 2e-14
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 2e-14
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 3e-14
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 3e-14
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 4e-14
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 5e-14
2o2t_A117 Multiple PDZ domain protein; structural protein, s 5e-14
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 5e-14
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 6e-14
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 6e-14
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 9e-14
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-13
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 1e-13
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 1e-13
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 1e-13
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 2e-13
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 2e-13
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 2e-13
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 3e-13
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 3e-13
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 3e-13
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 3e-13
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 4e-13
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 4e-13
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 5e-13
2eei_A106 PDZ domain-containing protein 1; regulatory factor 5e-13
2ego_A96 General receptor for phosphoinositides 1- associat 8e-13
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 8e-13
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 8e-13
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 9e-13
2v90_A96 PDZ domain-containing protein 3; membrane, protein 9e-13
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 1e-12
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 1e-12
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-12
2qt5_A 200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-11
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 2e-12
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 2e-12
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 2e-12
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-12
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 3e-12
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 3e-12
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 3e-12
2d90_A102 PDZ domain containing protein 1; structural genomi 3e-12
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 4e-12
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 4e-12
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 4e-12
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 5e-12
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 5e-12
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 4e-09
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 7e-05
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 5e-12
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 5e-12
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 5e-12
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 5e-12
3khf_A99 Microtubule-associated serine/threonine-protein ki 6e-12
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 6e-12
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 8e-12
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-11
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 9e-12
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 9e-12
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 1e-04
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 1e-11
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 1e-11
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 1e-11
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 1e-11
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 2e-11
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-11
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 2e-11
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 2e-11
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 2e-11
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 3e-11
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 3e-11
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 3e-11
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 3e-11
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 5e-11
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 9e-11
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 1e-10
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 2e-10
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 3e-10
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 3e-10
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 3e-10
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 4e-10
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 7e-10
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 1e-09
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 1e-09
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 2e-09
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-09
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 4e-08
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-08
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-07
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 1e-07
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-07
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 4e-07
4fgm_A597 Aminopeptidase N family protein; structural genomi 5e-07
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 2e-06
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 2e-06
3k50_A 403 Putative S41 protease; structural genomics, joint 2e-06
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 2e-06
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 3e-06
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 5e-06
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 6e-06
2hga_A125 Conserved protein MTH1368; GFT structural genomics 7e-06
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 9e-06
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 1e-05
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-05
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 3e-05
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 3e-05
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 3e-05
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 5e-05
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 5e-05
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 1e-04
2kl1_A94 YLBL protein; structure genomics, structural genom 1e-04
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 1e-04
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 3e-04
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 3e-04
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 7e-04
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
 Score = 92.0 bits (228), Expect = 2e-25
 Identities = 42/88 (47%), Positives = 56/88 (63%), Gaps = 4/88 (4%)

Query: 26  GFKIGGGIDQDYKKSP--QGYTDNGIYVTEVYDESPASKSGLRMHDKILQCNGYDFTMVT 83
           GF IGGGIDQD  ++P  +  TD GIYVT V +  PA  +GL++ DKI+Q NG+D TMVT
Sbjct: 41  GFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVT 100

Query: 84  HKKAVDYIKKH--PVLNLLVARKGVTST 109
           H +A   + K    V+ LLV R+ +   
Sbjct: 101 HDQARKRLTKRSEEVVRLLVTRQSLQKA 128
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.75
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.74
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.74
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.73
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.73
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.73
2awx_A105 Synapse associated protein 97; membrane protein, s 99.73
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.72
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.72
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.72
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.72
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.72
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.72
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.71
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.71
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.71
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.71
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.71
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.71
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.7
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.7
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.7
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.7
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.7
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.7
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.69
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.69
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.69
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.69
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.69
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.69
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.69
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.69
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.68
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.68
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.68
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.68
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.68
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.68
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.68
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.68
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.68
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.67
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.67
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.67
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.67
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.66
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.66
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.66
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.66
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.66
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.66
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.66
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.66
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.65
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.65
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.65
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.65
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.64
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.64
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.64
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.64
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.63
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.63
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.63
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.63
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.63
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.63
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.63
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.62
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.62
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.62
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.62
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.62
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.62
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.62
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.62
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.61
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.61
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.61
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.61
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.61
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.61
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.61
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.6
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.6
2d90_A102 PDZ domain containing protein 1; structural genomi 99.6
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.6
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.6
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.6
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.6
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.6
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.6
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.59
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.59
2ego_A96 General receptor for phosphoinositides 1- associat 99.59
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.59
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.59
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.59
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.59
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.59
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.58
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.58
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.58
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.58
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.58
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.58
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.58
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.58
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.58
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.58
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.58
2qbw_A 195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.57
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.57
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.57
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.57
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.56
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.56
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.55
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.55
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.54
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.54
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.54
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.54
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.54
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.54
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.53
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.53
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.53
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.53
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.52
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.52
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.51
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.51
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.51
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.51
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.5
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.5
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.5
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.5
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.49
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.49
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.48
2qt5_A 200 Glutamate receptor-interacting protein 1; PDZ-pept 99.48
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.48
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.47
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.47
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.47
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.46
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.46
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.45
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.45
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.44
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.43
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.4
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.39
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 99.09
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.37
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.37
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.36
2krg_A 216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 99.35
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.34
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.33
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 99.31
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.29
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.24
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.23
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.18
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 99.16
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 99.12
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 99.12
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 99.1
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 99.1
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 99.09
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 99.08
2kl1_A94 YLBL protein; structure genomics, structural genom 99.06
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 99.03
3rle_A 209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.02
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.99
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.98
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.98
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.98
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.97
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.97
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.94
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.94
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.86
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.84
3k50_A 403 Putative S41 protease; structural genomics, joint 98.8
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.8
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.8
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.77
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.72
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.63
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.6
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 98.51
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.49
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.47
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.44
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.24
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 97.72
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
Probab=99.75  E-value=2e-17  Score=97.04  Aligned_cols=92  Identities=32%  Similarity=0.480  Sum_probs=76.2

Q ss_pred             eEEeeecCCCCcceecEEEecccCCCCCCCCCCCCCCCEEEEEECCCChhhhcC-CCCCCEEEEECCEEeccccHHHHHH
Q psy795           11 MECLSPPDGRRVLKCGFKIGGGIDQDYKKSPQGYTDNGIYVTEVYDESPASKSG-LRMHDKILQCNGYDFTMVTHKKAVD   89 (109)
Q Consensus        11 ~~~~~~~~~~~~~~lG~~i~g~~~~~~~~~~~~~~~~gi~V~~v~~gs~a~~~G-l~~gD~i~~vn~~~i~~~~~~~~~~   89 (109)
                      ++...+.+.+...+|||++.++.+.     +......|++|..|.++|||+++| |++||+|++||+.++.+.++.++..
T Consensus         3 ~~~~~v~l~k~~~glG~~i~~g~~~-----~~~~~~~gv~V~~V~~~spA~~aG~L~~GD~I~~vng~~v~~~~~~~~~~   77 (102)
T 2i1n_A            3 FKYEEIVLERGNSGLGFSIAGGIDN-----PHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVE   77 (102)
T ss_dssp             EEEEEEEEECBTTBTSEEEEECTTS-----CSSTTCCCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECSSCCHHHHHH
T ss_pred             ceEEEEEEEECCCcCCEEEEcccCC-----CCcCCCCCEEEEEECCCCHHHHCCCCCCCCEEEEECCEECCCCCHHHHHH
Confidence            3445555556678999999998763     233346789999999999999999 9999999999999999988898888


Q ss_pred             HhcCCC-eEEEEEEeCCEe
Q psy795           90 YIKKHP-VLNLLVARKGVT  107 (109)
Q Consensus        90 ~l~~~~-~v~l~v~r~~~~  107 (109)
                      .++..+ .+.|.+.|++..
T Consensus        78 ~~~~~g~~v~l~v~R~~~~   96 (102)
T 2i1n_A           78 ALKEAGPVVRLVVRRRQPP   96 (102)
T ss_dssp             HHHHSCSEEEEEEEEECCC
T ss_pred             HHHcCCCeEEEEEEeCCCC
Confidence            888776 899999997754
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-17
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 6e-17
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 8e-17
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 3e-16
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 1e-15
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-15
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 2e-15
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 3e-15
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 3e-15
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 4e-15
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 5e-15
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 7e-15
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 2e-14
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 3e-14
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 3e-14
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 3e-14
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 4e-14
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 4e-14
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 7e-14
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 9e-14
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 1e-13
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 2e-13
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 2e-13
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 3e-13
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 4e-13
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 6e-13
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 7e-13
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 8e-13
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-12
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-12
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 3e-12
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 3e-12
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 3e-12
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 4e-12
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 4e-12
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 5e-12
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 5e-12
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 7e-12
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 7e-12
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-11
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-11
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-11
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 2e-11
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-11
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-11
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 3e-11
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 5e-11
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 5e-11
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 8e-11
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 9e-11
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 3e-10
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-10
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 9e-10
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 9e-10
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 1e-09
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 1e-09
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 3e-09
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 4e-09
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 5e-09
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 6e-09
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 9e-09
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 4e-08
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 3e-07
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 8e-07
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 1e-06
d1sota199 b.36.1.4 (A:255-353) Stress sensor protease DegS, 3e-06
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 6e-06
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 9e-06
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: KIAA1526 protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 68.8 bits (168), Expect = 2e-17
 Identities = 31/83 (37%), Positives = 38/83 (45%), Gaps = 10/83 (12%)

Query: 26  GFKIGGGIDQDYKKSPQGYTDNGIYVTEVYDESPASKSGLRMHDKILQCNGYDFTMVTHK 85
           GF I GG +             GIYV+ V   S A K GLR+ D+IL+ N      VTH 
Sbjct: 24  GFSIRGGSEHGV----------GIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVTHA 73

Query: 86  KAVDYIKKHPVLNLLVARKGVTS 108
           +AV  +K    L L V   G  S
Sbjct: 74  EAVKALKGSKKLVLSVYSAGRIS 96
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 99 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.85
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.84
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.84
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.82
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.82
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.8
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.79
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.79
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.78
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.78
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.78
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.78
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.77
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.77
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.77
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.76
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.76
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.75
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.75
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.75
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.75
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.74
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.74
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.74
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.72
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.72
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.72
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.72
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.71
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.71
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.71
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.7
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.69
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.68
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.68
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.68
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.68
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.68
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.68
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.67
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.67
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.67
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.67
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.65
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.64
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.64
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.63
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.63
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.61
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.58
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.56
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.54
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.52
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.41
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.38
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 99.17
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 99.14
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.13
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 99.13
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 99.08
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Synapse-associated protein 102
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.85  E-value=9.7e-21  Score=108.36  Aligned_cols=85  Identities=32%  Similarity=0.482  Sum_probs=74.0

Q ss_pred             ecCCCCcceecEEEecccCCCCCCCCCCCCCCCEEEEEECCCChhhhcC-CCCCCEEEEECCEEeccccHHHHHHHhcCC
Q psy795           16 PPDGRRVLKCGFKIGGGIDQDYKKSPQGYTDNGIYVTEVYDESPASKSG-LRMHDKILQCNGYDFTMVTHKKAVDYIKKH   94 (109)
Q Consensus        16 ~~~~~~~~~lG~~i~g~~~~~~~~~~~~~~~~gi~V~~v~~gs~a~~~G-l~~gD~i~~vn~~~i~~~~~~~~~~~l~~~   94 (109)
                      +++.+.+.||||++.++...     +......|+||..|.++|||+++| |++||+|++||+.++.+++++++++.++..
T Consensus         5 V~L~k~~~glG~~i~gg~~~-----~~~~~~~gi~I~~v~~gg~A~~~G~L~~GD~Il~VNg~~v~~~~~~e~~~~lk~~   79 (92)
T d2fe5a1           5 VNLLKGPKGLGFSIAGGIGN-----QHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNT   79 (92)
T ss_dssp             EEEECCTTCSCEEEEECBTS-----CSBTTBCCEEEEEECTTSHHHHHCCCCTTCEEEEETTEECTTCBHHHHHHHHHTC
T ss_pred             EEEEECCCccCEEEEeecCC-----ccCCCCCCEEEEEECCCCChhhcCCCCCCCEEEEeCCeecCCCCHHHHHHHHHcC
Confidence            34444557999999988762     334457889999999999999999 999999999999999999999999999988


Q ss_pred             C-eEEEEEEeCC
Q psy795           95 P-VLNLLVARKG  105 (109)
Q Consensus        95 ~-~v~l~v~r~~  105 (109)
                      + .+.|.+.|++
T Consensus        80 ~~~v~L~v~Rpg   91 (92)
T d2fe5a1          80 SDMVYLKVAKPG   91 (92)
T ss_dssp             CSEEEEEEECCC
T ss_pred             CCEEEEEEECCC
Confidence            8 9999999976
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure