Psyllid ID: psy7993

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MGSCLSIRRRNHPDHRNSFDNANAPNAGLRKNHPLCHEIIRWKSDVPLTEGQLRSKRDEFWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKYMVPVYCLSYLKFLLLHMSQPLRHVLVCANCYFPHPGFLTESYDELGNKYMVPVYCLSYPINITKETSGRDSPIEVFDLEEGVGGQEIALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLEGIETSKQRWYYGGKLLSDKMKISDIQNLASGFVIQVIINNLAGPKLVPPVESMKSVTSSS
cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEEccccccccccHHHHHccccccEEEEEEcccccccccccccccccccccc
ccccEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccEcccccHHHHHHHccccEEccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccEEEEEEEEcccccEEEEEEccccHHHHHHHHHHHHcccccccEEEEEEcccccccccHHHHcccccccEEEEEEcccccccccccccccccccccc
mgsclsirrrnhpdhrnsfdnanapnaglrknhplcHEIIrwksdvpltegqlrskrdefwdtapafegRKEIWDALHAAASAAEGNDFQLAQAILdganisvpngfltesydelgnkymvPVYCLSYLKFLLLHMSQPLRHVLVcancyfphpgfltesydelgnkymvpVYCLsypinitketsgrdspievfdleegvggqEIALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLEGIETSKQRWYYggkllsdkmkisdIQNLASGFVIQVIINnlagpklvppvesmksvtsss
mgsclsirrrnhpdhrnsfdnanapnaglrkNHPLCHEIIRwksdvpltegqlrskrdefWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKYMVPVYCLSYLKFLLLHMSQPLRHVLVCANCYFPHPGFLTESYDELGNKYMVPVYCLSYPINITKETSGRDSPIEVFDLEEGVGGQEIALKLRLSNTCQDVRMKVFTQETVAMIKKRlqslegietskqrWYYGGKLLSDKMKISDIQNLASGFVIQVIINNLagpklvppvesmksvtsss
MGSCLSIRRRNHPDHRNSFDNANAPNAGLRKNHPLCHEIIRWKSDVPLTEGQLRSKRDEFWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKYMVPVYCLSYLKFLLLHMSQPLRHVLVCANCYFPHPGFLTESYDELGNKYMVPVYCLSYPINITKETSGRDSPIEVFDLEEGVGGQEIALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLEGIETSKQRWYYGGKLLSDKMKISDIQNLASGFVIQVIINNLAGPKLVPPVESMKSVTSSS
********************************HPLCHEIIRWKSDVPLTEGQLRSKRDEFWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKYMVPVYCLSYLKFLLLHMSQPLRHVLVCANCYFPHPGFLTESYDELGNKYMVPVYCLSYPINITKETSGRDSPIEVFDLEEGVGGQEIALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLEGIETSKQRWYYGGKLLSDKMKISDIQNLASGFVIQVIINNLAGPKL**************
***************************************IRWKSDVPLTEGQLRSKRDEFWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKYMVPVYCLSYLKFLLLHMSQ*******************************************************************IALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLEGIETSKQRWYYGGKLLSDKMKISDIQNLASGFVIQVIINN********************
MGSCLSIRRRNHPDHRNSFDNANAPNAGLRKNHPLCHEIIRWKSDVPLTEGQLRSKRDEFWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKYMVPVYCLSYLKFLLLHMSQPLRHVLVCANCYFPHPGFLTESYDELGNKYMVPVYCLSYPINITKETSGRDSPIEVFDLEEGVGGQEIALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLEGIETSKQRWYYGGKLLSDKMKISDIQNLASGFVIQVIINNLAGPKLVPP***********
****************************************RWKSDVPLTEGQLRSKRDEFWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKYMVPVYCLSYLKFLL*********************************************************************GQEIALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLEGIETSKQRWYYGGKLLSDKMKISDIQNLASGFVIQVIINNLAG*K***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSCLSIRRRNHPDHRNSFDNANAPNAGLRKNHPLCHEIIRWKSDVPLTEGQLRSKRDEFWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKYMVPVYCLSYLKFLLLHMSQPLRHVLVCANCYFPHPGFLTESYDELGNKYMVPVYCLSYPINITKETSGRDSPIEVFDLEEGVGGQEIALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLEGIETSKQRWYYGGKLLSDKMKISDIQNLASGFVIQVIINNLAGPKLVPPVESMKSVTSSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query300 2.2.26 [Sep-21-2011]
Q6DG43240 Ubiquitin domain-containi yes N/A 0.743 0.929 0.423 1e-54
Q6PGH0234 Ubiquitin domain-containi yes N/A 0.74 0.948 0.418 2e-53
Q640W6234 Ubiquitin domain-containi N/A N/A 0.733 0.940 0.421 1e-52
Q8WUN7234 Ubiquitin domain-containi yes N/A 0.736 0.944 0.416 2e-52
Q5EAE3234 Ubiquitin domain-containi yes N/A 0.736 0.944 0.412 2e-52
Q4V8W7227 Ubiquitin domain-containi no N/A 0.74 0.977 0.419 6e-51
Q9HAC8227 Ubiquitin domain-containi no N/A 0.753 0.995 0.385 9e-42
Q3ZBQ1227 Ubiquitin domain-containi no N/A 0.753 0.995 0.389 1e-41
Q6GL38240 Ubiquitin domain-containi no N/A 0.656 0.820 0.402 1e-41
Q68FV8227 Ubiquitin domain-containi no N/A 0.753 0.995 0.396 4e-41
>sp|Q6DG43|UBTD2_DANRE Ubiquitin domain-containing protein 2 OS=Danio rerio GN=ubtd2 PE=2 SV=1 Back     alignment and function desciption
 Score =  213 bits (543), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 119/281 (42%), Positives = 167/281 (59%), Gaps = 58/281 (20%)

Query: 1   MGSCLSIRRRNHPDHRNSF-DNANAPNAGLRKNHPLCHEIIRWKSDVPLTEGQLRSKRDE 59
           MG C+     +H D   S  +N++     L +N PL  E  +WKSD P+T+GQLRSKRDE
Sbjct: 1   MGGCVG----SHHDSSGSLNENSDGTGVALGRNQPLKREKPKWKSDYPMTDGQLRSKRDE 56

Query: 60  FWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKY 119
           FWDTAPAFEGRKEIWDAL AAA A E ND +LAQAI+DGA+I++P+G LTE YDELGN+Y
Sbjct: 57  FWDTAPAFEGRKEIWDALKAAAQAFESNDHELAQAIIDGASITLPHGALTECYDELGNRY 116

Query: 120 MVPVYCLSYLKFLLLHMSQPLRHVLVCANCYFPHPGFLTESYDELGNKYMVPVYCLSYPI 179
            +PVYCL                                                 S P+
Sbjct: 117 QLPVYCL-------------------------------------------------SPPV 127

Query: 180 NITKETSGRDSPIEVFDLEEGVGGQEIALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSL 239
           N+ +E S  ++ IEV +      GQE  L+LRLS T +D+R+ V T ++V  +K+RLQ+ 
Sbjct: 128 NMIEEKSESET-IEVPEA-PASEGQECQLRLRLS-TGRDLRLAVRTSDSVQQMKRRLQTQ 184

Query: 240 EGIETSKQRWYYGGKLLSDKMKISDIQNLASGFVIQVIINN 280
           EG+  + QRW++ G+ L+DKMK+ +++ ++  +V+QVI++ 
Sbjct: 185 EGVAATSQRWFFSGRPLTDKMKLEELK-ISRDYVVQVIVSQ 224

Danio rerio (taxid: 7955)
>sp|Q6PGH0|UBTD2_MOUSE Ubiquitin domain-containing protein 2 OS=Mus musculus GN=Ubtd2 PE=2 SV=1 Back     alignment and function description
>sp|Q640W6|UBTD1_XENLA Ubiquitin domain-containing protein 1 OS=Xenopus laevis GN=ubtd1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WUN7|UBTD2_HUMAN Ubiquitin domain-containing protein 2 OS=Homo sapiens GN=UBTD2 PE=1 SV=2 Back     alignment and function description
>sp|Q5EAE3|UBTD2_BOVIN Ubiquitin domain-containing protein 2 OS=Bos taurus GN=UBTD2 PE=2 SV=1 Back     alignment and function description
>sp|Q4V8W7|UBTD1_DANRE Ubiquitin domain-containing protein 1 OS=Danio rerio GN=ubtd1 PE=2 SV=1 Back     alignment and function description
>sp|Q9HAC8|UBTD1_HUMAN Ubiquitin domain-containing protein 1 OS=Homo sapiens GN=UBTD1 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBQ1|UBTD1_BOVIN Ubiquitin domain-containing protein 1 OS=Bos taurus GN=UBTD1 PE=2 SV=1 Back     alignment and function description
>sp|Q6GL38|UBTD1_XENTR Ubiquitin domain-containing protein 1 OS=Xenopus tropicalis GN=ubtd1 PE=2 SV=1 Back     alignment and function description
>sp|Q68FV8|UBTD1_RAT Ubiquitin domain-containing protein 1 OS=Rattus norvegicus GN=Ubtd1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
350415143240 PREDICTED: ubiquitin domain-containing p 0.753 0.941 0.533 3e-74
66525397240 PREDICTED: ubiquitin domain-containing p 0.753 0.941 0.530 6e-74
307202201240 Ubiquitin domain-containing protein 2 [H 0.756 0.945 0.524 9e-74
383866247240 PREDICTED: ubiquitin domain-containing p 0.753 0.941 0.523 3e-73
332022069240 Ubiquitin domain-containing protein 2 [A 0.753 0.941 0.519 4e-73
193577861234 PREDICTED: ubiquitin domain-containing p 0.753 0.965 0.557 5e-73
307183259245 Ubiquitin domain-containing protein 2 [C 0.753 0.922 0.506 9e-72
347966488244 AGAP001747-PA [Anopheles gambiae str. PE 0.756 0.930 0.503 3e-71
289742241244 uncharacterized conserved protein [Gloss 0.76 0.934 0.512 6e-71
380024166241 PREDICTED: LOW QUALITY PROTEIN: ubiquiti 0.753 0.937 0.521 1e-70
>gi|350415143|ref|XP_003490546.1| PREDICTED: ubiquitin domain-containing protein 2-like [Bombus impatiens] Back     alignment and taxonomy information
 Score =  284 bits (727), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 150/281 (53%), Positives = 181/281 (64%), Gaps = 55/281 (19%)

Query: 1   MGSCLSIRRRNHPDHRNSFDNANAPNAG-LRKNHPLCHEIIRWKSDVPLTEGQLRSKRDE 59
           MG C+ I R  +    NS  N+   N+G  RKNHPLCHE IRWKSDVPLTEGQLRSKRDE
Sbjct: 1   MGGCIGITRARNASVDNSTGNSTRVNSGNSRKNHPLCHEAIRWKSDVPLTEGQLRSKRDE 60

Query: 60  FWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKY 119
           FWDTAPAF+GRKEIWDAL A A+AAE  D+QLAQAILDGANISVPNGFLTE YDELG +Y
Sbjct: 61  FWDTAPAFDGRKEIWDALRAGATAAEAQDYQLAQAILDGANISVPNGFLTECYDELGTRY 120

Query: 120 MVPVYCLSYLKFLLLHMSQPLRHVLVCANCYFPHPGFLTESYDELGNKYMVPVYCLSYPI 179
            VP+YCLSY                                                 PI
Sbjct: 121 QVPIYCLSY-------------------------------------------------PI 131

Query: 180 NITKETSGRDSPIEVFD-LEEGVGGQEIALKLRLSNTCQDVRMKVFTQETVAMIKKRLQS 238
           NI KE SGRDSP +  + ++ GV   E  LKLRLS T  +V++ V++++T+A  KK+LQS
Sbjct: 132 NIVKEDSGRDSPADCSEPIDSGV---EQTLKLRLSTTLGEVKLPVYSKDTIATAKKKLQS 188

Query: 239 LEGIETSKQRWYYGGKLLSDKMKISDIQNLASGFVIQVIIN 279
            EG+E S+QRW++GGKLL DKM I + + +  G+VIQVI+N
Sbjct: 189 QEGLEPSRQRWFFGGKLLGDKMHIEEAK-IQPGYVIQVIVN 228

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|66525397|ref|XP_625226.1| PREDICTED: ubiquitin domain-containing protein 2-like [Apis mellifera] gi|340725573|ref|XP_003401143.1| PREDICTED: ubiquitin domain-containing protein 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307202201|gb|EFN81688.1| Ubiquitin domain-containing protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383866247|ref|XP_003708582.1| PREDICTED: ubiquitin domain-containing protein 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332022069|gb|EGI62394.1| Ubiquitin domain-containing protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|193577861|ref|XP_001945250.1| PREDICTED: ubiquitin domain-containing protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307183259|gb|EFN70128.1| Ubiquitin domain-containing protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|347966488|ref|XP_321338.3| AGAP001747-PA [Anopheles gambiae str. PEST] gi|333470038|gb|EAA01254.3| AGAP001747-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|289742241|gb|ADD19868.1| uncharacterized conserved protein [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|380024166|ref|XP_003695877.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin domain-containing protein 2-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
FB|FBgn0264712249 CG1172 [Drosophila melanogaste 0.416 0.502 0.686 7.1e-45
ZFIN|ZDB-GENE-040718-473244 ubtd2 "ubiquitin domain contai 0.41 0.504 0.617 2.1e-38
UNIPROTKB|E1C4N1234 UBTD2 "Uncharacterized protein 0.41 0.525 0.617 2.1e-38
MGI|MGI:2444752234 Ubtd2 "ubiquitin domain contai 0.413 0.529 0.606 5.5e-38
MGI|MGI:2385092227 Ubtd1 "ubiquitin domain contai 0.44 0.581 0.589 5.5e-38
UNIPROTKB|E2QTA0234 UBTD2 "Uncharacterized protein 0.413 0.529 0.606 7e-38
UNIPROTKB|Q8WUN7234 UBTD2 "Ubiquitin domain-contai 0.413 0.529 0.606 7e-38
UNIPROTKB|Q5EAE3234 UBTD2 "Ubiquitin domain-contai 0.413 0.529 0.606 7e-38
ZFIN|ZDB-GENE-070424-93230 ubtd1a "ubiquitin domain conta 0.413 0.539 0.632 1.1e-37
RGD|1305506211 Ubtd2 "ubiquitin domain contai 0.33 0.469 0.727 3.5e-36
FB|FBgn0264712 CG1172 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 472 (171.2 bits), Expect = 7.1e-45, P = 7.1e-45
 Identities = 94/137 (68%), Positives = 110/137 (80%)

Query:     1 MGSCLSIRRRNHPDHRN-SFDNANA--P-NAGL-----RKNHPLCHEIIRWKSDVPLTEG 51
             MG+C+    R +PD+   S  +A+   P +AG+     RKN PLCHE IRW+SDVPLTEG
Sbjct:     1 MGACVC---RMNPDNETMSVSSASISRPASAGIAMGAARKNRPLCHETIRWRSDVPLTEG 57

Query:    52 QLRSKRDEFWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGANISVPNGFLTES 111
             QLRSKRDEFWDTAPAF+GRKEIWDAL AA +AAEG DFQ+AQAILDGAN+SVPNG+LTE 
Sbjct:    58 QLRSKRDEFWDTAPAFDGRKEIWDALRAATTAAEGLDFQMAQAILDGANVSVPNGYLTEC 117

Query:   112 YDELGNKYMVPVYCLSY 128
             YDELG +Y VP+YCLSY
Sbjct:   118 YDELGTQYKVPIYCLSY 134
GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0003674 "molecular_function" evidence=ND
ZFIN|ZDB-GENE-040718-473 ubtd2 "ubiquitin domain containing 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4N1 UBTD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2444752 Ubtd2 "ubiquitin domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:2385092 Ubtd1 "ubiquitin domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTA0 UBTD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WUN7 UBTD2 "Ubiquitin domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EAE3 UBTD2 "Ubiquitin domain-containing protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-93 ubtd1a "ubiquitin domain containing 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1305506 Ubtd2 "ubiquitin domain containing 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6PGH0UBTD2_MOUSENo assigned EC number0.41840.740.9487yesN/A
Q6DG43UBTD2_DANRENo assigned EC number0.42340.74330.9291yesN/A
Q5EAE3UBTD2_BOVINNo assigned EC number0.41280.73660.9444yesN/A
Q8WUN7UBTD2_HUMANNo assigned EC number0.41630.73660.9444yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
cd0179470 cd01794, DC_UbP_C, dendritic cell derived ubiquiti 1e-20
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 1e-08
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 2e-08
smart0021372 smart00213, UBQ, Ubiquitin homologues 6e-06
cd0180676 cd01806, Nedd8, Nebb8-like ubiquitin protein 2e-05
PTZ0004476 PTZ00044, PTZ00044, ubiquitin; Provisional 2e-04
cd0179374 cd01793, Fubi, Fubi ubiquitin-like protein 0.001
cd0180376 cd01803, Ubiquitin, Ubiquitin 0.002
cd01802103 cd01802, AN1_N, ubiquitin-like domain of AN1 0.003
>gnl|CDD|176389 cd01794, DC_UbP_C, dendritic cell derived ubiquitin-like protein Back     alignment and domain information 
 Score = 83.4 bits (206), Expect = 1e-20
 Identities = 31/72 (43%), Positives = 54/72 (75%), Gaps = 2/72 (2%)

Query: 208 LKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLEGIETSKQRWYYGGKLLSDKMKISDIQN 267
           LK+RLS T +DV++ V +++TV  +KK+LQ+ EG++   QRW++ GKLL+DK ++ + + 
Sbjct: 1   LKVRLS-TGKDVKLSVSSKDTVGQLKKQLQAAEGVDPCCQRWFFSGKLLTDKTRLQETK- 58

Query: 268 LASGFVIQVIIN 279
           +   +V+QVI+N
Sbjct: 59  IQKDYVVQVIVN 70

DC_UbP (dendritic cell derived ubiquitin-like protein) is a ubiquitin-like protein from human dendritic cells that is expressed in the mitochondrion. The ubiquitin-like domain of this protein is found at the C-terminus and lacks the canonical gly-gly motif of ubiquitin required for ubiquitinization. DC_UbP is expressed in tumor cells but not in normal human adult tissue suggesting a role for DC_UbP in tumorogenesis. Length = 70
>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information
>gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues Back     alignment and domain information
>gnl|CDD|176401 cd01806, Nedd8, Nebb8-like ubiquitin protein Back     alignment and domain information
>gnl|CDD|185411 PTZ00044, PTZ00044, ubiquitin; Provisional Back     alignment and domain information
>gnl|CDD|176388 cd01793, Fubi, Fubi ubiquitin-like protein Back     alignment and domain information
>gnl|CDD|176398 cd01803, Ubiquitin, Ubiquitin Back     alignment and domain information
>gnl|CDD|176397 cd01802, AN1_N, ubiquitin-like domain of AN1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 300
KOG0013|consensus231 100.0
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.78
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.77
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.74
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.73
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.71
PTZ0004476 ubiquitin; Provisional 99.71
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.7
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.69
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.68
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.67
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.67
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.67
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.67
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.66
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.66
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.64
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.64
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.64
KOG0005|consensus70 99.62
KOG0013|consensus231 99.6
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.6
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 99.58
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.57
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.56
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.54
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.52
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.5
KOG0010|consensus 493 99.47
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.47
KOG0011|consensus 340 99.44
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.44
KOG0004|consensus156 99.44
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.41
KOG0003|consensus128 99.4
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.28
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 99.22
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.15
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 99.06
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 99.0
KOG0001|consensus75 98.98
KOG4248|consensus 1143 98.75
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.74
PLN02560 308 enoyl-CoA reductase 98.61
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.57
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 98.43
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 98.34
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.13
KOG1872|consensus 473 97.93
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 97.84
KOG0006|consensus 446 97.78
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 97.1
KOG3493|consensus73 97.06
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 97.04
KOG1769|consensus99 96.95
KOG4495|consensus110 96.65
smart0016680 UBX Domain present in ubiquitin-regulatory protein 96.26
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 96.25
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 96.12
KOG4583|consensus 391 96.0
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 95.79
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 95.44
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 94.14
KOG3206|consensus 234 94.01
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 93.52
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 93.06
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 92.66
PF13019162 Telomere_Sde2: Telomere stability and silencing 92.28
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 91.07
COG541781 Uncharacterized small protein [Function unknown] 90.73
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 90.28
KOG1639|consensus 297 87.97
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 86.73
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 86.58
PRK0836470 sulfur carrier protein ThiS; Provisional 86.18
PLN0279982 Molybdopterin synthase sulfur carrier subunit 85.81
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 85.16
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 84.95
PF1162088 GABP-alpha: GA-binding protein alpha chain; InterP 84.57
PRK0643767 hypothetical protein; Provisional 84.1
smart00295 207 B41 Band 4.1 homologues. Also known as ezrin/radix 84.05
smart0045570 RBD Raf-like Ras-binding domain. 84.04
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 81.33
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 80.88
KOG2086|consensus380 80.37
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 80.11
>KOG0013|consensus Back     alignment and domain information 
Probab=100.00  E-value=4e-57  Score=406.87  Aligned_cols=221  Identities=46%  Similarity=0.703  Sum_probs=199.9

Q ss_pred             CCCcccccccCCCCCCCCCCCCCCCCCCCCCCCCCcccccccccCCCCCHHHHHHhhhhhcccCCCCCCCHHHHHHHHHH
Q psy7993           1 MGSCLSIRRRNHPDHRNSFDNANAPNAGLRKNHPLCHEIIRWKSDVPLTEGQLRSKRDEFWDTAPAFEGRKEIWDALHAA   80 (300)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~pl~~~~~~w~s~~~~t~~~l~~~R~eFwdT~p~~~G~~EiW~aL~aA   80 (300)
                      ||+|+++.|-...++      .   +..+++|.||+|++..|+|+.|||++||+.||+|||||+|||+||+|||||||||
T Consensus         1 ~~~~~s~~r~a~~~~------~---~g~a~~~~~l~~~~~~~~~d~~lT~gqlrskRdEFWdTapAf~GrKEIWDaL~aa   71 (231)
T KOG0013|consen    1 MVQCLSGNRPAGVGN------N---GGEAPSNSPLLREPKLWTSDPPLTKGQLRSKRDEFWDTAPAFGGRKEIWDALHAA   71 (231)
T ss_pred             CcccccCCCCccCCC------c---cccCCCCCchhcccccccCCCCcchhhhhhhhhhhhhcccccCCcHHHHHHHHHH
Confidence            899998666544332      2   2345899999999999999999999999999999999999999999999999999


Q ss_pred             HHhcccCCHHHHHHHHhhcCeeeecCCchhheccCCCccccceeeechhhhhhhhccCccchhhhccccCCCCCCCCccc
Q psy7993          81 ASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKYMVPVYCLSYLKFLLLHMSQPLRHVLVCANCYFPHPGFLTES  160 (300)
Q Consensus        81 ~~~~~~~d~~~Aq~il~aA~itlp~g~l~~~yD~~G~~Y~lP~~v~~~P~n~~~~~~~~~~~~~~~an~~~~~~~~~~E~  160 (300)
                      +.++++||+++||+|||+|+||||+|+|+.|||++|+                                           
T Consensus        72 ~ta~e~~d~e~Aqai~dgA~~tiP~g~l~ecydelg~-------------------------------------------  108 (231)
T KOG0013|consen   72 VTAAEEGDAEAAQAILDGADLTIPEGDLSECYDELGG-------------------------------------------  108 (231)
T ss_pred             HHHHhcccHHHHHHHHhccccccCCcchHHHHHhhCC-------------------------------------------
Confidence            9999999999999999999999999999999999999                                           


Q ss_pred             hhhccCccccceeeccCccccccCCCCCCCccccccccCCCCCceEEEEEEecCCCceEEEEEccCchHHHHHHHHHHHh
Q psy7993         161 YDELGNKYMVPVYCLSYPINITKETSGRDSPIEVFDLEEGVGGQEIALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLE  240 (300)
Q Consensus       161 ~De~~~~y~lp~~~~s~p~Nl~~~~~~~~s~~e~~~~e~~~~~~~I~VkVRlS~~Gkdv~VeV~~tdTV~~LK~kI~e~e  240 (300)
                            .|++|.||++.|.|++.+..+.++.++.  +++...+.++.+++|+++++++|.+.+...+||+++|++++.++
T Consensus       109 ------~y~~p~ycls~p~n~~~E~~d~~s~ei~--~ppp~~~~e~~lk~rlTtT~~d~~lta~~~Dtv~eik~~L~Aae  180 (231)
T KOG0013|consen  109 ------TYYEPIYCLSRPPNAFAERKDSESLEIP--EPPPSNHTEPILKLRLTTTREDFWLTAPHYDTVGEIKRALRAAE  180 (231)
T ss_pred             ------eEeecceeeccCchHHHhhccccccccC--CCCCCCCCCcchHHHhhhhhhheeecccCcCcHHHHHHHHHHhh
Confidence                  6777777888888888776666654444  67788889999999999779999999999999999999999999


Q ss_pred             CCCCCceEEEEcCeecCCCCCcccccCCCCC--CEEEEEecCCC
Q psy7993         241 GIETSKQRWYYGGKLLSDKMKISDIQNLASG--FVIQVIINNLA  282 (300)
Q Consensus       241 GIp~~qQRLiy~GKiLkD~~tL~dyqgIq~G--~vI~vmV~kp~  282 (300)
                      |+++-.|||||+|+.|-|+..|++| +|..|  ++|+++|.+++
T Consensus       181 g~D~~sQrif~Sg~~l~dkt~LeEc-~iekg~rYvlqviVlq~~  223 (231)
T KOG0013|consen  181 GVDPLSQRIFFSGGVLVDKTDLEEC-KIEKGQRYVLQVIVLQEP  223 (231)
T ss_pred             ccchhhheeeccCCceeccccceee-eecCCCEEEEEEEeccCC
Confidence            9999999999999999999999999 99999  99999999864

>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>KOG0005|consensus Back     alignment and domain information
>KOG0013|consensus Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>KOG0010|consensus Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>KOG0004|consensus Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>KOG0003|consensus Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>KOG0001|consensus Back     alignment and domain information
>KOG4248|consensus Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>KOG1872|consensus Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>KOG0006|consensus Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>KOG3493|consensus Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>KOG1769|consensus Back     alignment and domain information
>KOG4495|consensus Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>KOG4583|consensus Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>KOG3206|consensus Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>KOG1639|consensus Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>smart00455 RBD Raf-like Ras-binding domain Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>KOG2086|consensus Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
2ksn_A137 Solution Structure Of The N-Terminal Domain Of Dc-U 1e-39
1ttn_A106 Solution Structure Of The Ubiquitin-Like Domain Of 7e-12
>pdb|2KSN|A Chain A, Solution Structure Of The N-Terminal Domain Of Dc-UbpUBTD2 Length = 137 Back     alignment and structure 
Iteration: 1

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 73/108 (67%), Positives = 87/108 (80%)
Query: 20  DNANAPNAGLRKNHPLCHEIIRWKSDVPLTEGQLRSKRDEFWDTAPAFEGRKEIWDALHA 79
           +N+      L +N PL  E  +WKSD P+T+GQLRSKRDEFWDTAPAFEGRKEIWDAL A
Sbjct: 5   ENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKA 64
Query: 80  AASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKYMVPVYCLS 127
           AA A E ND +LAQAI+DGANI++P+G LTE YDELGN+Y +PVYCL+
Sbjct: 65  AAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLA 112
>pdb|1TTN|A Chain A, Solution Structure Of The Ubiquitin-Like Domain Of Human Dc- Ubp From Dendritic Cells Length = 106 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
2ksn_A137 Ubiquitin domain-containing protein 2; UBTD2, DC-U 6e-45
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 9e-12
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 4e-07
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 8e-07
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 1e-06
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 2e-06
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 2e-06
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 2e-06
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 2e-06
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 3e-06
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 3e-06
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 4e-06
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 4e-06
3u5c_F 225 RP14, S2, YS8, 40S ribosomal protein S5; translati 5e-06
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 6e-06
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 7e-06
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 7e-06
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 8e-06
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 9e-06
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 9e-06
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 9e-06
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 1e-05
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 1e-05
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 1e-05
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 1e-05
1we6_A111 Splicing factor, putative; structural genomics, ub 1e-05
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 1e-05
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 1e-05
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 2e-05
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 2e-05
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 2e-05
3m62_B106 UV excision repair protein RAD23; armadillo-like r 2e-05
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 2e-05
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 3e-05
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 4e-05
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 1e-04
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 1e-04
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 1e-04
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 2e-04
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 3e-04
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 3e-04
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 3e-04
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 5e-04
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 6e-04
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 8e-04
>2ksn_A Ubiquitin domain-containing protein 2; UBTD2, DC-UBP, signaling protein; NMR {Homo sapiens} Length = 137 Back     alignment and structure
 Score =  148 bits (374), Expect = 6e-45
 Identities = 73/108 (67%), Positives = 87/108 (80%)

Query: 20  DNANAPNAGLRKNHPLCHEIIRWKSDVPLTEGQLRSKRDEFWDTAPAFEGRKEIWDALHA 79
           +N+      L +N PL  E  +WKSD P+T+GQLRSKRDEFWDTAPAFEGRKEIWDAL A
Sbjct: 5   ENSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKA 64

Query: 80  AASAAEGNDFQLAQAILDGANISVPNGFLTESYDELGNKYMVPVYCLS 127
           AA A E ND +LAQAI+DGANI++P+G LTE YDELGN+Y +PVYCL+
Sbjct: 65  AAHAFESNDHELAQAIIDGANITLPHGALTECYDELGNRYQLPVYCLA 112
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Length = 105 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 78 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Length = 189 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Length = 128 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
2ksn_A137 Ubiquitin domain-containing protein 2; UBTD2, DC-U 100.0
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.8
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.79
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.78
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.78
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.77
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.77
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.77
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.77
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.75
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.74
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.74
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.74
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.74
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.74
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.73
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.73
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.73
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.73
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.73
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.73
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.73
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.72
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.72
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.72
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.72
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.71
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.71
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.71
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.71
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.71
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.71
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.71
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.71
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.71
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.7
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.7
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.7
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.7
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.69
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.69
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.68
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.68
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.68
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.67
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.67
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.66
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.65
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.65
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.65
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.64
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.45
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.64
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.64
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.64
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.64
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.64
1we6_A111 Splicing factor, putative; structural genomics, ub 99.63
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.63
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.63
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.62
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.62
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.62
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.62
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.61
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.61
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.61
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.6
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.6
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.59
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.58
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.57
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.57
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.57
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.57
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 99.55
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.55
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.52
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.52
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.5
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.48
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.47
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.47
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.45
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.43
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.42
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.41
2xzm_9 189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.35
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.34
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.34
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.31
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.3
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.27
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.27
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 99.18
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 99.18
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 99.16
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 98.88
2ksn_A137 Ubiquitin domain-containing protein 2; UBTD2, DC-U 98.76
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.69
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 98.57
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 98.51
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 98.32
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.18
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 98.18
3v7o_A 227 Minor nucleoprotein VP30; ssgcid, seattle structur 98.13
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 98.07
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 97.84
3ix6_A 360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 97.68
4da1_A 389 Protein phosphatase 1K, mitochondrial; metal-ION-a 97.66
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 97.39
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 97.22
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 97.12
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 96.33
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 96.08
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 96.06
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 95.68
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 95.45
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 93.61
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 93.6
4e71_A111 Plexin-B2, MM1; transmembrane, signaling, RBD, str 93.36
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 91.94
2r2o_A138 Plexin-B1; effector domain, structural genomics, s 91.18
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 90.13
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 88.19
3h6n_A127 Plexin-D1; structural genomics consortium, SGC, me 88.14
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 87.8
4e74_A117 Plexin-A4; RBD, structural genomics, structural ge 87.65
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 86.53
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 82.86
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 81.87
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 80.73
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 80.46
>2ksn_A Ubiquitin domain-containing protein 2; UBTD2, DC-UBP, signaling protein; NMR {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.3e-52  Score=352.57  Aligned_cols=116  Identities=63%  Similarity=1.033  Sum_probs=111.0

Q ss_pred             CCCCCCCCCCCCCCCcccccccccCCCCCHHHHHHhhhhhcccCCCCCCCHHHHHHHHHHHHhcccCCHHHHHHHHhhcC
Q psy7993          21 NANAPNAGLRKNHPLCHEIIRWKSDVPLTEGQLRSKRDEFWDTAPAFEGRKEIWDALHAAASAAEGNDFQLAQAILDGAN  100 (300)
Q Consensus        21 ~~~~~~~~~~~n~pl~~~~~~w~s~~~~t~~~l~~~R~eFwdT~p~~~G~~EiW~aL~aA~~~~~~~d~~~Aq~il~aA~  100 (300)
                      ++..|+++.|+|+|||+++|+|+|+.+||++||++||+|||||||||+||+|||+|||+||++|++||++|||+|||+||
T Consensus         6 ~~~~~~~~~~~n~pl~~~~~~W~s~~~~Tr~qL~~~R~EFWDT~p~~~Gr~EIW~ALraA~~~~e~~Dl~tAQ~IldaAg   85 (137)
T 2ksn_A            6 NSEGTGVALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFESNDHELAQAIIDGAN   85 (137)
T ss_dssp             SCCSSSCSSCSSCCCCCCCCCSSCSSCCSHHHHHHHHHHHHTTSSTTCCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHS
T ss_pred             CCCCCCcccCCCCCCCCCCCCccCCCCCCHHHHHHHHHHHHhcCCccCCCHHHHHHHHHHHHHHhcCCHHHHHHHHHHcC
Confidence            35557788899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeecCCchhheccCCCccccceeeechhhhhhhhc
Q psy7993         101 ISVPNGFLTESYDELGNKYMVPVYCLSYLKFLLLHM  136 (300)
Q Consensus       101 itlp~g~l~~~yD~~G~~Y~lP~~v~~~P~n~~~~~  136 (300)
                      ||||+|||+.|||++|++|+||+||+++|+||+.+.
T Consensus        86 Itvp~gdL~~cYDe~G~~Y~LP~yvls~P~Nl~~~~  121 (137)
T 2ksn_A           86 ITLPHGALTECYDELGNRYQLPVYCLAPPINMIEEK  121 (137)
T ss_dssp             CBCSSCCSSEEEETTTEEEECCGGGTCCSTTTCCCT
T ss_pred             CcccCCcHHHHHhccCCccCCCeeEeeCCccccccc
Confidence            999999999999999999999999999999999743
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ksn_A Ubiquitin domain-containing protein 2; UBTD2, DC-UBP, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 300
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 8e-09
d1ttna180 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit 1e-08
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 2e-07
d1ogwa_76 d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax 1e-06
d2zeqa178 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin 3e-06
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 3e-06
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 4e-06
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 6e-06
d1oqya477 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h 6e-06
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 6e-06
d1euvb_79 d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea 3e-05
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 3e-05
d1wh3a_87 d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like 4e-05
d1wgha_116 d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous 4e-05
d1wy8a176 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing 4e-05
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 7e-05
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 9e-05
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 1e-04
d1v5ta_90 d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu 4e-04
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 4e-04
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 4e-04
d2faza176 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing 6e-04
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 8e-04
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 9e-04
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 0.001
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 0.001
d2uyzb177 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human 0.003
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 0.004
d1uela_95 d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol 0.004
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: DSK2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 49.4 bits (118), Expect = 8e-09
 Identities = 15/71 (21%), Positives = 31/71 (43%), Gaps = 1/71 (1%)

Query: 207 ALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLEGIETSKQRWYYGGKLLSDKMKISDIQ 266
           +L + + +      + V  + TV   K+ +    GI  + QR  Y GK+L D   +    
Sbjct: 1   SLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY- 59

Query: 267 NLASGFVIQVI 277
           ++  G  + ++
Sbjct: 60  HIQDGHSVHLV 70
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.84
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.82
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.81
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.81
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.8
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.8
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.79
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.79
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.77
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.77
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.77
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.76
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.76
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.75
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.73
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.73
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.73
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.73
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.7
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.7
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.7
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.68
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.66
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.65
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.64
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.63
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.63
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.6
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.56
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.52
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.44
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.42
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.34
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.28
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.23
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 98.57
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.11
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 96.56
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 96.43
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 96.4
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 94.8
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 94.42
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 90.73
d1wgra_100 Growth factor receptor-bound protein 7, GRB-7 {Hum 87.05
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Dendritic cell-derived ubiquitin-like protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.84  E-value=2.2e-21  Score=147.24  Aligned_cols=79  Identities=38%  Similarity=0.741  Sum_probs=75.4

Q ss_pred             CceEEEEEEecCCCceEEEEEccCchHHHHHHHHHHHhCCCCCceEEEEcCeecCCCCCcccccCCCCCCEEEEEecCCC
Q psy7993         203 GQEIALKLRLSNTCQDVRMKVFTQETVAMIKKRLQSLEGIETSKQRWYYGGKLLSDKMKISDIQNLASGFVIQVIINNLA  282 (300)
Q Consensus       203 ~~~I~VkVRlS~~Gkdv~VeV~~tdTV~~LK~kI~e~eGIp~~qQRLiy~GKiLkD~~tL~dyqgIq~G~vI~vmV~kp~  282 (300)
                      +.+|+|+||+++ |+++.|+|.+++||++||++|+++.|+|+++|||+|.||.|+|..||.+| ||++|++||+++++|.
T Consensus         1 g~e~qi~Vk~~~-G~~~~l~V~~~~tV~~lK~~I~~~~~ip~~~qrLi~~Gk~L~d~~tL~~y-~I~~~sti~lvi~~p~   78 (80)
T d1ttna1           1 GYECQLRLRLST-GKDLKLVVRSTDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEEL-KIPKDYVVQVIVSQPV   78 (80)
T ss_dssp             CCSEEEEEEETT-TEEEEEEECTTSHHHHHHHHHHHTTCCCSTTCEEEETTEECCTTSHHHHC-CCSSSCEEEEECCCSS
T ss_pred             CCeEEEEEEcCC-CCEEEEEECCcCcHHHHHHHHHHHhCCCcccEEEEECceEcCCCCcHHHc-CCCCCCEEEEEecCCC
Confidence            467999999998 99999999999999999999999999999999999999999999999999 9999999999998775


Q ss_pred             C
Q psy7993         283 G  283 (300)
Q Consensus       283 ~  283 (300)
                      +
T Consensus        79 ~   79 (80)
T d1ttna1          79 Q   79 (80)
T ss_dssp             C
T ss_pred             C
Confidence            3
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure