Psyllid ID: psy8111
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 135 | ||||||
| 340719742 | 1384 | PREDICTED: hypothetical protein LOC10065 | 0.911 | 0.088 | 0.830 | 8e-55 | |
| 320545982 | 989 | limpet, isoform J [Drosophila melanogast | 0.911 | 0.124 | 0.806 | 8e-55 | |
| 350421086 | 1384 | PREDICTED: hypothetical protein LOC10074 | 0.911 | 0.088 | 0.830 | 9e-55 | |
| 312380317 | 300 | hypothetical protein AND_07659 [Anophele | 0.888 | 0.4 | 0.834 | 6e-54 | |
| 345488106 | 671 | PREDICTED: hypothetical protein LOC10012 | 0.911 | 0.183 | 0.838 | 6e-54 | |
| 383851070 | 669 | PREDICTED: uncharacterized protein LOC10 | 0.911 | 0.183 | 0.822 | 1e-53 | |
| 332021159 | 176 | Four and a half LIM domains protein 2 [A | 0.888 | 0.681 | 0.851 | 2e-53 | |
| 307166376 | 175 | Four and a half LIM domains protein 2 [C | 0.888 | 0.685 | 0.851 | 2e-53 | |
| 322793841 | 177 | hypothetical protein SINV_04723 [Solenop | 0.992 | 0.757 | 0.770 | 2e-53 | |
| 380027198 | 578 | PREDICTED: four and a half LIM domains p | 0.911 | 0.212 | 0.830 | 2e-53 |
| >gi|340719742|ref|XP_003398306.1| PREDICTED: hypothetical protein LOC100650291 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Score = 218 bits (554), Expect = 8e-55, Method: Compositional matrix adjust.
Identities = 103/124 (83%), Positives = 110/124 (88%), Gaps = 1/124 (0%)
Query: 12 FREDYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKI 71
F +Y K KD SG HFCCWQCDESLTGQRYVLRD+HPYCIKCYESVFAN CEEC+KI
Sbjct: 1091 FSGEYTKAMNKDWHSG-HFCCWQCDESLTGQRYVLRDEHPYCIKCYESVFANGCEECNKI 1149
Query: 72 IGIDSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCSE 131
IGIDSKDLSYKDKHWHEACF C++CR SLVDKQFGSK +KIYCGNCYDAQFASRCDGC E
Sbjct: 1150 IGIDSKDLSYKDKHWHEACFLCNRCRVSLVDKQFGSKVDKIYCGNCYDAQFASRCDGCGE 1209
Query: 132 IFKA 135
IF+A
Sbjct: 1210 IFRA 1213
|
Source: Bombus terrestris Species: Bombus terrestris Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|320545982|ref|NP_001189122.1| limpet, isoform J [Drosophila melanogaster] gi|318069230|gb|ADV37558.1| limpet, isoform J [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|350421086|ref|XP_003492728.1| PREDICTED: hypothetical protein LOC100741757 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|312380317|gb|EFR26348.1| hypothetical protein AND_07659 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|345488106|ref|XP_001604322.2| PREDICTED: hypothetical protein LOC100120714 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383851070|ref|XP_003701076.1| PREDICTED: uncharacterized protein LOC100883879 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332021159|gb|EGI61544.1| Four and a half LIM domains protein 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307166376|gb|EFN60513.1| Four and a half LIM domains protein 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322793841|gb|EFZ17181.1| hypothetical protein SINV_04723 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|380027198|ref|XP_003697316.1| PREDICTED: four and a half LIM domains protein 2-like isoform 1 [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 135 | ||||||
| WB|WBGene00006407 | 656 | lim-9 [Caenorhabditis elegans | 0.911 | 0.187 | 0.685 | 4.1e-49 | |
| UNIPROTKB|Q2KI95 | 279 | FHL2 "Four and a half LIM doma | 0.770 | 0.372 | 0.548 | 6.5e-35 | |
| UNIPROTKB|F1SU18 | 287 | FHL2 "Uncharacterized protein" | 0.755 | 0.355 | 0.558 | 8.3e-35 | |
| UNIPROTKB|J3KNW4 | 389 | FHL2 "Four and a half LIM doma | 0.770 | 0.267 | 0.548 | 1.7e-34 | |
| UNIPROTKB|Q14192 | 279 | FHL2 "Four and a half LIM doma | 0.770 | 0.372 | 0.548 | 1.7e-34 | |
| UNIPROTKB|F1P4R3 | 283 | FHL2 "Uncharacterized protein" | 0.770 | 0.367 | 0.538 | 5.8e-34 | |
| ZFIN|ZDB-GENE-040808-49 | 279 | fhl2a "four and a half LIM dom | 0.770 | 0.372 | 0.538 | 9.5e-34 | |
| ZFIN|ZDB-GENE-041010-121 | 279 | fhl2b "four and a half LIM dom | 0.770 | 0.372 | 0.538 | 2e-33 | |
| UNIPROTKB|F1PU47 | 279 | FHL2 "Uncharacterized protein" | 0.770 | 0.372 | 0.509 | 3.2e-33 | |
| RGD|61963 | 279 | Fhl2 "four and a half LIM doma | 0.770 | 0.372 | 0.5 | 3.7e-32 |
| WB|WBGene00006407 lim-9 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 512 (185.3 bits), Expect = 4.1e-49, P = 4.1e-49
Identities = 85/124 (68%), Positives = 101/124 (81%)
Query: 12 FREDYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKI 71
F +Y K KD S HFCCWQCD++LTGQRY++RD+ PYCIKCYE VFAN C+EC+K
Sbjct: 359 FAGEYTKAMNKDWHS-DHFCCWQCDQTLTGQRYIMRDEQPYCIKCYEDVFANQCDECAKP 417
Query: 72 IGIDSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFASRCDGCSE 131
IGIDSKDLSYKDKHWHE CF CS C+ SLVD FGSK+++I+C NCYD FA+RCDGC+E
Sbjct: 418 IGIDSKDLSYKDKHWHEHCFLCSMCKISLVDMPFGSKNDRIFCSNCYDQAFATRCDGCNE 477
Query: 132 IFKA 135
IF+A
Sbjct: 478 IFRA 481
|
|
| UNIPROTKB|Q2KI95 FHL2 "Four and a half LIM domains protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SU18 FHL2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KNW4 FHL2 "Four and a half LIM domains protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14192 FHL2 "Four and a half LIM domains protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4R3 FHL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040808-49 fhl2a "four and a half LIM domains 2a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041010-121 fhl2b "four and a half LIM domains 2b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PU47 FHL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|61963 Fhl2 "four and a half LIM domains 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 135 | |||
| cd09421 | 59 | cd09421, LIM3_LIMPETin, The third LIM domain of pr | 5e-29 | |
| cd09343 | 59 | cd09343, LIM1_FHL, The first LIM domain of Four an | 8e-24 | |
| cd09422 | 62 | cd09422, LIM1_FHL2, The first LIM domain of Four a | 2e-18 | |
| cd09417 | 56 | cd09417, LIM2_LIMPETin_like, The second LIM domain | 2e-18 | |
| cd09344 | 54 | cd09344, LIM1_FHL1, The first LIM domain of Four a | 2e-14 | |
| cd09341 | 56 | cd09341, LIM2_Testin_like, The second LIM domain o | 1e-13 | |
| cd09423 | 59 | cd09423, LIM1_FHL3, The first LIM domain of Four a | 3e-12 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 2e-09 | |
| cd09424 | 58 | cd09424, LIM2_FHL1, The second LIM domain of Four | 4e-09 | |
| cd09426 | 57 | cd09426, LIM2_FHL2, The second LIM domain of Four | 2e-08 | |
| cd09345 | 54 | cd09345, LIM2_FHL, The second LIM domain of Four a | 3e-08 | |
| cd09418 | 56 | cd09418, LIM2_Prickle, The second LIM domain of Pr | 3e-08 | |
| cd09342 | 57 | cd09342, LIM3_Testin_like, The third LIM domain of | 3e-08 | |
| cd09430 | 52 | cd09430, LIM5_LIMPETin, The fifth LIM domain of pr | 4e-08 | |
| cd09420 | 59 | cd09420, LIM3_Prickle, The third LIM domain of Pri | 4e-08 | |
| cd09432 | 56 | cd09432, LIM6_LIMPETin, The sixth LIM domain of pr | 7e-08 | |
| cd09347 | 56 | cd09347, LIM4_FHL, The fourth LIM domain of Four a | 8e-08 | |
| cd09346 | 52 | cd09346, LIM3_FHL, The third LIM domain of Four an | 9e-08 | |
| cd09425 | 54 | cd09425, LIM4_LIMPETin, The fourth LIM domain of p | 1e-07 | |
| cd09434 | 56 | cd09434, LIM4_FHL3, The fourth LIM domain of Four | 2e-07 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 2e-07 | |
| cd09340 | 58 | cd09340, LIM1_Testin_like, The first LIM domain of | 6e-07 | |
| cd09428 | 54 | cd09428, LIM2_FHL5, The second LIM domain of Four | 1e-06 | |
| cd09348 | 64 | cd09348, LIM4_FHL1, The fourth LIM domain of Four | 2e-06 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 3e-06 | |
| cd09427 | 58 | cd09427, LIM2_FHL3, The second LIM domain of Four | 5e-06 | |
| cd09429 | 53 | cd09429, LIM3_FHL1, The third LIM domain of Four a | 5e-06 | |
| cd09431 | 57 | cd09431, LIM3_Fhl2, The third LIM domain of Four a | 9e-06 | |
| cd09413 | 58 | cd09413, LIM1_Testin, The first LIM domain of Test | 1e-04 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 1e-04 | |
| cd09433 | 58 | cd09433, LIM4_FHL2, The fourth LIM domain of Four | 1e-04 | |
| cd09349 | 87 | cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | 2e-04 | |
| cd09415 | 59 | cd09415, LIM1_Prickle, The first LIM domain of Pri | 5e-04 | |
| cd09416 | 56 | cd09416, LIM2_Testin, The second LIM domain of Tes | 9e-04 | |
| cd09430 | 52 | cd09430, LIM5_LIMPETin, The fifth LIM domain of pr | 0.001 | |
| cd09403 | 54 | cd09403, LIM2_CRP, The second LIM domain of Cystei | 0.001 | |
| cd09414 | 58 | cd09414, LIM1_LIMPETin, The first LIM domain of pr | 0.001 | |
| cd09341 | 56 | cd09341, LIM2_Testin_like, The second LIM domain o | 0.002 | |
| cd09346 | 52 | cd09346, LIM3_FHL, The third LIM domain of Four an | 0.002 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 0.002 | |
| cd09331 | 59 | cd09331, LIM1_PINCH, The first LIM domain of prote | 0.002 | |
| cd09393 | 56 | cd09393, LIM3_Lrg1p_like, The third LIM domain of | 0.003 | |
| cd09840 | 54 | cd09840, LIM2_CRP2, The second LIM domain of Cyste | 0.003 | |
| cd09431 | 57 | cd09431, LIM3_Fhl2, The third LIM domain of Four a | 0.004 | |
| cd09326 | 53 | cd09326, LIM_CRP_like, The LIM domains of Cysteine | 0.004 | |
| cd09336 | 53 | cd09336, LIM1_Paxillin_like, The first LIM domain | 0.004 |
| >gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
Score = 99 bits (249), Expect = 5e-29
Identities = 51/59 (86%), Positives = 55/59 (93%)
Query: 61 FANSCEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIYCGNCYD 119
FAN CEECSKIIGIDSKDLSYKDKHWHEACF CSKC+ SLVDK FGSK+++IYCGNCYD
Sbjct: 1 FANQCEECSKIIGIDSKDLSYKDKHWHEACFLCSKCKISLVDKPFGSKADRIYCGNCYD 59
|
The third LIM domain of protein LIMPETin: LIMPETin contains 6 LIM domains at the C-terminal and an N-terminal PET domain. Four of the six LIM domains are highly homologous to the four and half LIM domain protein family and two of them show sequence similarity to the LIM domains of the testin family. Thus, LIMPETin may be the recombinant product of genes coding testin and FHL proteins. In Schistosoma mansoni, where LIMPETin was first identified, LIMPETin is down regulated in sexually mature adult Schistosoma females compared to sexually immature adult females and adult male. Its differential expression indicates that it is a transcription regulator. LIM domains are 50-60 amino acids in size and share two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 59 |
| >gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188806 cd09422, LIM1_FHL2, The first LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
| >gnl|CDD|188801 cd09417, LIM2_LIMPETin_like, The second LIM domain of protein LIMPETin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188730 cd09344, LIM1_FHL1, The first LIM domain of Four and a half LIM domains protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188807 cd09423, LIM1_FHL3, The first LIM domain of Four and a half LIM domains protein 3 (FHL3) | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM domains protein 1 (FHL1) | Back alignment and domain information |
|---|
| >gnl|CDD|188810 cd09426, LIM2_FHL2, The second LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
| >gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188802 cd09418, LIM2_Prickle, The second LIM domain of Prickle | Back alignment and domain information |
|---|
| >gnl|CDD|188728 cd09342, LIM3_Testin_like, The third LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188804 cd09420, LIM3_Prickle, The third LIM domain of Prickle | Back alignment and domain information |
|---|
| >gnl|CDD|188816 cd09432, LIM6_LIMPETin, The sixth LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188818 cd09434, LIM4_FHL3, The fourth LIM domain of Four and a half LIM domains protein 3 (FHL3) | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188812 cd09428, LIM2_FHL5, The second LIM domain of Four and a half LIM domains protein 5 (FHL5) | Back alignment and domain information |
|---|
| >gnl|CDD|188734 cd09348, LIM4_FHL1, The fourth LIM domain of Four and a half LIM domains protein 1 (FHL1) | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188811 cd09427, LIM2_FHL3, The second LIM domain of Four and a half LIM domains protein 3 (FHL3) | Back alignment and domain information |
|---|
| >gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM domains protein 1 (FHL1) | Back alignment and domain information |
|---|
| >gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
| >gnl|CDD|188797 cd09413, LIM1_Testin, The first LIM domain of Testin | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188817 cd09433, LIM4_FHL2, The fourth LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
| >gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | Back alignment and domain information |
|---|
| >gnl|CDD|188799 cd09415, LIM1_Prickle, The first LIM domain of Prickle | Back alignment and domain information |
|---|
| >gnl|CDD|188800 cd09416, LIM2_Testin, The second LIM domain of Testin | Back alignment and domain information |
|---|
| >gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin | Back alignment and domain information |
|---|
| >gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
| >gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family | Back alignment and domain information |
|---|
| >gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 135 | |||
| KOG1701|consensus | 468 | 100.0 | ||
| KOG1701|consensus | 468 | 99.94 | ||
| KOG2272|consensus | 332 | 99.91 | ||
| KOG2272|consensus | 332 | 99.91 | ||
| KOG1703|consensus | 479 | 99.91 | ||
| KOG4577|consensus | 383 | 99.9 | ||
| KOG1703|consensus | 479 | 99.84 | ||
| KOG1044|consensus | 670 | 99.82 | ||
| KOG1044|consensus | 670 | 99.82 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.69 | |
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.64 | |
| KOG1700|consensus | 200 | 99.51 | ||
| KOG4577|consensus | 383 | 99.46 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.98 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.91 | |
| KOG0490|consensus | 235 | 98.26 | ||
| KOG1700|consensus | 200 | 98.07 | ||
| KOG1702|consensus | 264 | 97.77 | ||
| KOG1702|consensus | 264 | 97.23 | ||
| KOG0490|consensus | 235 | 96.19 | ||
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 93.05 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 91.26 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 90.77 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 90.76 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 89.3 | |
| PF08394 | 37 | Arc_trans_TRASH: Archaeal TRASH domain; InterPro: | 88.96 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 87.79 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 83.48 | |
| PF06677 | 41 | Auto_anti-p27: Sjogren's syndrome/scleroderma auto | 83.26 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 82.88 | |
| COG2191 | 206 | Formylmethanofuran dehydrogenase subunit E [Energy | 82.76 | |
| COG2191 | 206 | Formylmethanofuran dehydrogenase subunit E [Energy | 81.24 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 80.25 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 80.22 | |
| PF11781 | 36 | RRN7: RNA polymerase I-specific transcription init | 80.05 |
| >KOG1701|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.6e-35 Score=216.94 Aligned_cols=129 Identities=25% Similarity=0.552 Sum_probs=121.9
Q ss_pred ccccccCcccccc--ceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCchhhcCCccccCcccce
Q psy8111 3 SAVKHQDKSFRED--YNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDSKDLS 80 (135)
Q Consensus 3 ~~C~~C~~~i~~~--~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~I~~~~~~~~ 80 (135)
.+|.+|+|.|.++ .+.||++.||.. ||+|.+|++.|.++.||..|+++||+.||... ..+|..|+++|+ +++++
T Consensus 275 ~iC~~C~K~V~g~~~ac~Am~~~fHv~-CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~t-lekC~~Cg~~I~--d~iLr 350 (468)
T KOG1701|consen 275 GICAFCHKTVSGQGLAVEAMDQLFHVQ-CFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDT-LEKCNKCGEPIM--DRILR 350 (468)
T ss_pred hhhhhcCCcccCcchHHHHhhhhhccc-ceehHhhhhhhccccccccCCcccchHHHHHH-HHHHhhhhhHHH--HHHHH
Confidence 4799999999964 589999999999 99999999999999999999999999999876 479999999995 88999
Q ss_pred eCCccccccccccccccccCCCCCeeee-CCcccCHHhHhhhcCCCcccCCCCCCC
Q psy8111 81 YKDKHWHEACFSCSKCRQSLVDKQFGSK-SEKIYCGNCYDAQFASRCDGCSEIFKA 135 (135)
Q Consensus 81 ~~~~~~H~~Cf~C~~C~~~l~~~~~~~~-~~~~~C~~c~~~~~~~~C~~C~~~I~~ 135 (135)
|.|+.||+.||+|..|.+.|++..|.+. ++++||..+|.++|++||+.|++||+|
T Consensus 351 A~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P 406 (468)
T KOG1701|consen 351 ALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILP 406 (468)
T ss_pred hcccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccC
Confidence 9999999999999999999999988876 799999999999999999999999987
|
|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 135 | ||||
| 2ehe_A | 82 | Solution Structure Of The First Lim Domain From Hum | 7e-15 | ||
| 2cup_A | 101 | Solution Structure Of The Skeletal Muscle Lim-Prote | 1e-11 | ||
| 2xqn_T | 126 | Complex Of The 2nd And 3rd Lim Domains Of Tes With | 4e-11 | ||
| 2cuq_A | 80 | Solution Structure Of Second Lim Domain From Human | 8e-10 | ||
| 1x4k_A | 72 | Solution Structure Of Lim Domain In Lim-Protein 3 L | 1e-08 | ||
| 1x63_A | 82 | Solution Structure Of The Second Lim Domain Of Skel | 7e-08 | ||
| 2egq_A | 77 | Solution Structure Of The Fourth Lim Domain From Hu | 4e-06 | ||
| 2d8z_A | 70 | Solution Structure Of The Third Lim Domain Of Four | 7e-06 | ||
| 1wyh_A | 72 | Solution Structure Of The Lim Domain From Human Ske | 1e-05 | ||
| 1x68_A | 76 | Solution Structures Of The C-Terminal Lim Domain Of | 1e-05 | ||
| 1qli_A | 113 | Quail Cysteine And Glycine-Rich Protein, Nmr, 15 Mi | 3e-05 | ||
| 3mmk_A | 169 | The Structural Basis For Partial Redundancy In A Cl | 3e-05 | ||
| 1b8t_A | 192 | Solution Structure Of The Chicken Crp1 Length = 192 | 4e-05 | ||
| 1ctl_A | 85 | Structure Of The Carboxy-Terminal Lim Domain From T | 4e-05 | ||
| 2cur_A | 69 | Solution Structure Of Skeletal Muscle Lim-Protein 1 | 5e-05 | ||
| 1cxx_A | 113 | Mutant R122a Of Quail Cysteine And Glycine-Rich Pro | 5e-05 | ||
| 2rgt_A | 169 | Crystal Structure Of Lhx3 Lim Domains 1 And 2 With | 1e-04 | ||
| 2jtn_A | 182 | Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl | 1e-04 | ||
| 1x4l_A | 72 | Solution Structure Of Lim Domain In Four And A Half | 2e-04 |
| >pdb|2EHE|A Chain A, Solution Structure Of The First Lim Domain From Human Four And A Half Lim Domains Protein 3 Length = 82 | Back alignment and structure |
|
| >pdb|2CUP|A Chain A, Solution Structure Of The Skeletal Muscle Lim-Protein 1 Length = 101 | Back alignment and structure |
| >pdb|2XQN|T Chain T, Complex Of The 2nd And 3rd Lim Domains Of Tes With The Evh1 Domain Of Mena And The N-Terminal Domain Of Actin-Like Protein Arp7a Length = 126 | Back alignment and structure |
| >pdb|2CUQ|A Chain A, Solution Structure Of Second Lim Domain From Human Skeletal Muscle Lim-Protein 2 Length = 80 | Back alignment and structure |
| >pdb|1X4K|A Chain A, Solution Structure Of Lim Domain In Lim-Protein 3 Length = 72 | Back alignment and structure |
| >pdb|1X63|A Chain A, Solution Structure Of The Second Lim Domain Of Skeletal Muscle Lim Protein 1 Length = 82 | Back alignment and structure |
| >pdb|2EGQ|A Chain A, Solution Structure Of The Fourth Lim Domain From Human Four And A Half Lim Domains 1 Length = 77 | Back alignment and structure |
| >pdb|2D8Z|A Chain A, Solution Structure Of The Third Lim Domain Of Four And A Half Lim Domains Protein 2 (Fhl-2) Length = 70 | Back alignment and structure |
| >pdb|1WYH|A Chain A, Solution Structure Of The Lim Domain From Human Skeletal Muscle Lim-Protein 2 Length = 72 | Back alignment and structure |
| >pdb|1X68|A Chain A, Solution Structures Of The C-Terminal Lim Domain Of Human Fhl5 Protein Length = 76 | Back alignment and structure |
| >pdb|1QLI|A Chain A, Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Average Structure Length = 113 | Back alignment and structure |
| >pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 | Back alignment and structure |
| >pdb|1B8T|A Chain A, Solution Structure Of The Chicken Crp1 Length = 192 | Back alignment and structure |
| >pdb|1CTL|A Chain A, Structure Of The Carboxy-Terminal Lim Domain From The Cysteine Rich Protein Crp Length = 85 | Back alignment and structure |
| >pdb|2CUR|A Chain A, Solution Structure Of Skeletal Muscle Lim-Protein 1 Length = 69 | Back alignment and structure |
| >pdb|1CXX|A Chain A, Mutant R122a Of Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Structure Length = 113 | Back alignment and structure |
| >pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 | Back alignment and structure |
| >pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 | Back alignment and structure |
| >pdb|1X4L|A Chain A, Solution Structure Of Lim Domain In Four And A Half Lim Domains Protein 2 Length = 72 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 135 | |||
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 4e-30 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 7e-14 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 1e-25 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 2e-05 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 8e-25 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 4e-14 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 5e-10 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 2e-23 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 1e-16 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 2e-20 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 1e-07 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 3e-19 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 1e-18 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 4e-18 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 7e-09 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 1e-17 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 8e-09 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 2e-05 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 4e-17 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 3e-08 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 5e-17 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 2e-08 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 5e-17 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 7e-05 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 6e-17 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 1e-06 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 2e-16 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 2e-15 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 3e-11 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 1e-07 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 2e-05 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 7e-15 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 2e-08 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 8e-15 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 1e-08 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 1e-14 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 2e-05 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 3e-14 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 2e-08 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 4e-14 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 6e-06 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 6e-14 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 2e-05 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 1e-13 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 2e-06 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 4e-13 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 3e-05 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 6e-12 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 7e-12 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 5e-05 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 9e-12 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 1e-04 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 2e-11 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 7e-09 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 2e-11 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 2e-04 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 2e-11 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 9e-06 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 6e-11 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 1e-08 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 2e-10 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 1e-06 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 6e-10 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 3e-04 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 2e-09 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 5e-09 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 7e-09 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 4e-04 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 4e-08 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 7e-08 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 2e-07 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 2e-05 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 6e-07 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 7e-07 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 8e-04 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 5e-06 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 3e-04 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 1e-04 |
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
Score = 104 bits (261), Expect = 4e-30
Identities = 30/98 (30%), Positives = 50/98 (51%), Gaps = 2/98 (2%)
Query: 28 QHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANSCEECSKIIGIDSKDLSYKDKHWH 87
+HFCC+ CD L G+ YV+ +D P C CY A C+ C I + + ++Y + WH
Sbjct: 29 KHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWH 88
Query: 88 EA--CFSCSKCRQSLVDKQFGSKSEKIYCGNCYDAQFA 123
+ CF CS C + L+ ++F ++C + +
Sbjct: 89 ASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS 126
|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 135 | |||
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 100.0 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 100.0 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 100.0 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 100.0 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.97 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.97 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.96 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.92 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.91 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.9 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.9 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.9 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.9 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.88 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.87 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.87 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.86 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.84 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.83 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.82 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.82 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.82 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.82 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.8 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.8 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.8 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.79 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.79 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.79 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.79 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.79 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.78 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.78 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.78 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.77 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.77 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.77 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.77 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.77 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.76 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.76 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.76 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.75 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.75 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.75 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.75 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.74 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.74 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.74 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.74 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.74 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.74 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.74 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.74 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.74 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.73 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.73 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.73 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.73 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.73 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.72 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.72 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.72 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.72 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.72 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.71 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.71 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.71 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.71 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.7 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.7 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.67 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.66 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.66 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.66 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.65 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.64 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.63 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.62 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.62 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.62 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.61 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.6 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.51 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.11 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.07 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 90.39 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 90.03 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 87.81 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 87.43 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 85.89 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 84.8 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 84.52 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 83.56 | |
| 1jjd_A | 55 | Metallothionein, SMTA; zinc finger, zinc cluster, | 80.53 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 80.1 |
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-36 Score=212.25 Aligned_cols=130 Identities=24% Similarity=0.572 Sum_probs=120.8
Q ss_pred ccccccCcccc-ccceeeCCCcccCCCCeeccccCCccCCCceEeECCeeeccCchhhhcCCc-----------------
Q psy8111 3 SAVKHQDKSFR-EDYNKLGGKDRGSGQHFCCWQCDESLTGQRYVLRDDHPYCIKCYESVFANS----------------- 64 (135)
Q Consensus 3 ~~C~~C~~~i~-~~~i~a~~~~~H~~~cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~----------------- 64 (135)
..|.+|+++|. ++.|.|+|+.||++ ||+|+.|+++|.+..|+.++|++||+.||.++++++
T Consensus 8 ~~C~~C~~~I~~~~~v~a~g~~wH~~-CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~f~~~c~~c~~~~g~~~~~~~~ 86 (192)
T 1b8t_A 8 KKCGVCQKAVYFAEEVQCEGSSFHKS-CFLCMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGPKGKGKGMGAGTLSTDKGE 86 (192)
T ss_dssp EECTTTCCEECSSCCEEETTEEECTT-TCBCTTTCCBCCSSSEEEETTEEEEHHHHHHHHSCCCCCCCCCCCCCCCCCCC
T ss_pred CcCccCCCeecceeEEEeCCceecCC-CCcCcccCCcCCCCeeEecCCEeeChhhhHhhcCccccccccccccEecCCCc
Confidence 47999999997 78899999999999 999999999999989999999999999999998876
Q ss_pred -------------------------------hhhcCCccccCcccceeCCccccccccccccccccCCCCCeeeeCCccc
Q psy8111 65 -------------------------------CEECSKIIGIDSKDLSYKDKHWHEACFSCSKCRQSLVDKQFGSKSEKIY 113 (135)
Q Consensus 65 -------------------------------C~~C~~~I~~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~ 113 (135)
|++|+++|.+ ...|.++++.||++||+|..|+++|.++.|+..+++||
T Consensus 87 ~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~C~~C~~~I~~-~~~v~a~~~~~H~~CF~C~~C~~~L~~~~~~~~~g~~y 165 (192)
T 1b8t_A 87 SLGIKYEEGQSHRPTNPNASRMAQKVGGSDGCPRCGQAVYA-AEKVIGAGKSWHKSCFRCAKCGKSLESTTLADKDGEIY 165 (192)
T ss_dssp CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECTTTSCEECS-SSCEEETTEEECTTTCBCTTTCCBCCSSSEEEETTEEE
T ss_pred ccccccccccccCCCCcCccccccccCCCCcCCCCCCEecC-cEEEecCCCccchhcCCccccCCCCCCCcccccCCEEe
Confidence 7899999974 45678999999999999999999999888999999999
Q ss_pred CHHhHhhhcCCCcccCCCCCC
Q psy8111 114 CGNCYDAQFASRCDGCSEIFK 134 (135)
Q Consensus 114 C~~c~~~~~~~~C~~C~~~I~ 134 (135)
|+.||.++|+++|.+|+++|.
T Consensus 166 C~~cy~~~f~~kc~~C~~~~g 186 (192)
T 1b8t_A 166 CKGCYAKNFGPKGFGFGQGAG 186 (192)
T ss_dssp EHHHHHHHTCCCCCCCCCCCC
T ss_pred CHHHHHHhcCCcCCCCCCccc
Confidence 999999999999999999864
|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1jjd_A Metallothionein, SMTA; zinc finger, zinc cluster, metal binding PR; NMR {Synechococcus elongatus} SCOP: g.46.1.1 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 135 | ||||
| d2d8za2 | 32 | g.39.1.3 (A:33-64) Four and a half LIM domains pro | 6e-10 | |
| d1x63a1 | 37 | g.39.1.3 (A:8-44) Four and a half LIM domains prot | 6e-10 | |
| d2cupa3 | 27 | g.39.1.3 (A:8-34) Four and a half LIM domains prot | 3e-05 | |
| d2cuqa1 | 32 | g.39.1.3 (A:43-74) Four and a half LIM domains 3, | 5e-05 | |
| d2cuqa2 | 35 | g.39.1.3 (A:8-42) Four and a half LIM domains 3, F | 5e-04 | |
| d1g47a2 | 35 | g.39.1.3 (A:36-70) Pinch (particularly interesting | 0.003 |
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Four and a half LIM domains protein 2, FHL2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 48.9 bits (117), Expect = 6e-10
Identities = 13/31 (41%), Positives = 20/31 (64%)
Query: 32 CWQCDESLTGQRYVLRDDHPYCIKCYESVFA 62
C C + L+GQR+ RDD YC+ C+ ++A
Sbjct: 2 CTACRKQLSGQRFTARDDFAYCLNCFCDLYA 32
|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 27 | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 135 | |||
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 99.17 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 99.1 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 99.1 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.98 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.88 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.86 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.83 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 98.82 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.79 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.77 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.73 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.71 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.69 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 98.67 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.66 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.65 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.63 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.59 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 98.56 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.55 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 98.55 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.49 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.48 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.47 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 98.47 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.46 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.46 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.4 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 98.4 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 98.38 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.37 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.35 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.35 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.34 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.34 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.32 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.25 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.23 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.21 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.2 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.2 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 98.18 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.18 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.18 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.18 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.15 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.14 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.14 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.14 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.13 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 98.12 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 98.1 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.1 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 98.09 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 98.08 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.05 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.03 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 98.01 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.0 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.99 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 97.95 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 97.94 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.93 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 97.91 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.89 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.88 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 97.87 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.86 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 97.86 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.82 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.81 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.79 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.78 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 97.78 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 97.77 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.76 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 97.68 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.68 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.67 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.66 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.63 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.63 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.62 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 97.57 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.55 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.48 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.44 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 97.4 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.39 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.32 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.29 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.27 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.14 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.07 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.04 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.03 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.03 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 96.99 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.79 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.78 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.76 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.67 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 96.67 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 96.55 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.43 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.38 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.38 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.14 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.13 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 95.95 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 95.81 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 95.75 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.7 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 95.68 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 95.5 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.47 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 95.31 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 95.25 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 95.11 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.05 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 94.99 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 94.9 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 94.33 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 94.28 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 94.18 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 93.43 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 92.65 | |
| d1x4la2 | 30 | Four and a half LIM domains protein 2, FHL2 {Human | 89.24 | |
| d1j2oa2 | 33 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 88.85 | |
| d1v6ga2 | 40 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 87.77 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 85.52 | |
| d2co8a1 | 33 | Nedd9 interacting protein with calponin homology, | 85.22 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 82.41 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 81.94 | |
| d2gvia2 | 33 | Uncharacterized protein Ta1109 {Thermoplasma acido | 80.26 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 80.17 |
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Leupaxin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.37 E-value=7.1e-14 Score=69.24 Aligned_cols=35 Identities=31% Similarity=0.716 Sum_probs=32.7
Q ss_pred CchhhhcCCchhhcCCccccCcccceeCCcccccccc
Q psy8111 55 KCYESVFANSCEECSKIIGIDSKDLSYKDKHWHEACF 91 (135)
Q Consensus 55 ~c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~H~~Cf 91 (135)
+||.++++++|++|+++|. +.+|+|+|+.||++||
T Consensus 1 ~DY~~~fapkC~~C~~~I~--g~~v~Al~~~wHpeCF 35 (35)
T d1x3ha1 1 KDFLAMFSPKCGGCNRPVL--ENYLSAMDTVWHPECF 35 (35)
T ss_dssp CCCCCCCSCBCTTTCCBCC--SSCEEETTEEECTTTC
T ss_pred CcHHHHhChhhhhcCCccc--chheeecCCccCcccC
Confidence 4799999999999999994 7899999999999998
|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gvia2 g.39.1.18 (A:169-201) Uncharacterized protein Ta1109 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|