Psyllid ID: psy8131


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MEYKTRQWHEKCFACVVCKTPIGTKSFIPREQEIYCANCYEEKFATRCVKCNKTFFRLREKGTFQSHSGRINKVYSILFYFLFQIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSREDKPFCADCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGFITDGEDIICPDCAKAKLM
cEEccccccccccccccccccccccccEEcccccccHHHHHHHHcccccccccccccccccccccccccccccHHHHHcccEEEEEccccEEEcccccccccccccccccccccccEEEEccccccHHHHHHHcccccccccccEEccccccEEEEccccccccccccccccccccccccEEcccccccHHHHHHHcc
ccccccccccccEEEEEcccccccccEEEcccccccHHHHHHHHcccHcccccccccHHcccccccccccccccccccHHHccccccccEEEEcccccccccEEEEEccccccccccEccccccccHHHHHHHHcHHHccccccccccccHHHEHHcccccccccEEEEHccccccccccEccccccccHHHHHHHcc
meyktrqwhekcfacvvcktpigtksfipreqEIYCANCYEEKFATRCVKCNKTFFRlrekgtfqshsgriNKVYSILFYFLFQIITsggvtyknepwhrecftcsncstslagqrftsredkpfcADCFGELfakrcysckkpitgiggtrfisfedrhwhndcfmcascqsslvgrgfitdgediicpdcakaklm
meyktrqwhekcfacvvcktpigtksfiprEQEIYCANCYEEKFATRCVKCNKTFFRLRekgtfqshsgriNKVYSILFYFLFQIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSREDKPFCADCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGFITDGEDIICPDCAKAKLM
MEYKTRQWHEKCFACVVCKTPIGTKSFIPREQEIYCANCYEEKFATRCVKCNKTFFRLREKGTFQSHSGRINKVYSILFYFLFQIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSREDKPFCADCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGFITDGEDIICPDCAKAKLM
******QWHEKCFACVVCKTPIGTKSFIPREQEIYCANCYEEKFATRCVKCNKTFFRLREKGTFQSHSGRINKVYSILFYFLFQIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSREDKPFCADCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGFITDGEDIICPDCA*****
MEYKTRQWHEKCFACVVCKTPIGTKSFIPREQEIYCANCYEEKFATRCVKCNKTFFRLREKGTFQSHSGRINKVYSILFYFLFQIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSREDKPFCADCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGFITDGEDIICPDCAKAKLM
********HEKCFACVVCKTPIGTKSFIPREQEIYCANCYEEKFATRCVKCNKTFFRLREKGTFQSHSGRINKVYSILFYFLFQIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSREDKPFCADCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGFITDGEDIICPDCAKAKLM
****TRQWHEKCFACVVCKTPIGTKSFIPREQEIYCANCYEEKFATRCVKCNKTFFRLREKGTFQSHSGRINKVYSILFYFLFQIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSREDKPFCADCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGFITDGEDIICPDCAKAKLM
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYKTRQWHEKCFACVVCKTPIGTKSFIPREQEIYCANCYEEKFATRCVKCNKTFFRLREKGTFQSHSGRINKVYSILFYFLFQIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSREDKPFCADCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGFITDGEDIICPDCAKAKLM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q3ZBI6280 Four and a half LIM domai yes N/A 0.828 0.585 0.487 2e-54
O35115279 Four and a half LIM domai yes N/A 0.823 0.584 0.494 3e-53
Q13643280 Four and a half LIM domai yes N/A 0.828 0.585 0.471 4e-53
O70433279 Four and a half LIM domai yes N/A 0.823 0.584 0.489 1e-52
Q2KI95279 Four and a half LIM domai no N/A 0.823 0.584 0.494 4e-52
Q14192279 Four and a half LIM domai no N/A 0.823 0.584 0.484 1e-51
Q9R059289 Four and a half LIM domai no N/A 0.828 0.567 0.460 1e-48
Q2YDK0284 Four and a half LIM domai no N/A 0.828 0.577 0.425 8e-43
P97447280 Four and a half LIM domai no N/A 0.823 0.582 0.430 7e-42
Q9WUH4280 Four and a half LIM domai no N/A 0.823 0.582 0.430 9e-42
>sp|Q3ZBI6|FHL3_BOVIN Four and a half LIM domains protein 3 OS=Bos taurus GN=FHL3 PE=2 SV=1 Back     alignment and function desciption
 Score =  211 bits (538), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 95/195 (48%), Positives = 127/195 (65%), Gaps = 31/195 (15%)

Query: 1   MEYKTRQWHEKCFACVVCKTPIGTKSFIPREQEIYCANCYEEKFATRCVKCNKTFFRLRE 60
           +EY  + WHE CF C  C+ P+G++SF+P +   YC  CYE KFA RC +C+KT      
Sbjct: 115 LEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKT------ 168

Query: 61  KGTFQSHSGRINKVYSILFYFLFQIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSR 120
                                    +T GGVTY+++PWHREC  C+ C T LAGQ+FTSR
Sbjct: 169 -------------------------LTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSR 203

Query: 121 EDKPFCADCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGF 180
           ED P+C  CFGELFA +C SCK+PITG+GG +++SFEDRHWH+ CF CA C +SLVG+GF
Sbjct: 204 EDDPYCVTCFGELFAPKCSSCKRPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGF 263

Query: 181 ITDGEDIICPDCAKA 195
           + DG+ ++C  C++A
Sbjct: 264 VPDGDQVLCQGCSQA 278





Bos taurus (taxid: 9913)
>sp|O35115|FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus GN=Fhl2 PE=1 SV=1 Back     alignment and function description
>sp|Q13643|FHL3_HUMAN Four and a half LIM domains protein 3 OS=Homo sapiens GN=FHL3 PE=1 SV=4 Back     alignment and function description
>sp|O70433|FHL2_MOUSE Four and a half LIM domains protein 2 OS=Mus musculus GN=Fhl2 PE=1 SV=1 Back     alignment and function description
>sp|Q2KI95|FHL2_BOVIN Four and a half LIM domains protein 2 OS=Bos taurus GN=FHL2 PE=2 SV=1 Back     alignment and function description
>sp|Q14192|FHL2_HUMAN Four and a half LIM domains protein 2 OS=Homo sapiens GN=FHL2 PE=1 SV=3 Back     alignment and function description
>sp|Q9R059|FHL3_MOUSE Four and a half LIM domains protein 3 OS=Mus musculus GN=Fhl3 PE=2 SV=2 Back     alignment and function description
>sp|Q2YDK0|FHL5_BOVIN Four and a half LIM domains protein 5 OS=Bos taurus GN=FHL5 PE=2 SV=1 Back     alignment and function description
>sp|P97447|FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus GN=Fhl1 PE=2 SV=3 Back     alignment and function description
>sp|Q9WUH4|FHL1_RAT Four and a half LIM domains protein 1 OS=Rattus norvegicus GN=Fhl1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
350421086 1384 PREDICTED: hypothetical protein LOC10074 0.843 0.120 0.757 1e-84
340719742 1384 PREDICTED: hypothetical protein LOC10065 0.843 0.120 0.752 6e-84
380027198 578 PREDICTED: four and a half LIM domains p 0.843 0.288 0.757 2e-81
328786758 546 PREDICTED: four and a half LIM domains p 0.843 0.305 0.757 3e-81
380027200 546 PREDICTED: four and a half LIM domains p 0.843 0.305 0.757 3e-81
383851070 669 PREDICTED: uncharacterized protein LOC10 0.843 0.249 0.752 3e-81
332021158239 Four and a half LIM domains protein 2 [A 0.843 0.698 0.747 9e-81
389611039244 limpet protein [Papilio polytes] 0.843 0.684 0.742 3e-80
320545982 989 limpet, isoform J [Drosophila melanogast 0.843 0.168 0.712 3e-80
307166375239 Four and a half LIM domains protein 2 [C 0.843 0.698 0.737 2e-79
>gi|350421086|ref|XP_003492728.1| PREDICTED: hypothetical protein LOC100741757 [Bombus impatiens] Back     alignment and taxonomy information
 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 150/198 (75%), Positives = 159/198 (80%), Gaps = 31/198 (15%)

Query: 1    MEYKTRQWHEKCFACVVCKTPIGTKSFIPREQEIYCANCYEEKFATRCVKCNKTFFRLRE 60
            MEYKTRQWHEKCF CVVCK PIGTKSFIPREQEIYCA CYE+KFATRCVKCNK       
Sbjct: 1218 MEYKTRQWHEKCFCCVVCKNPIGTKSFIPREQEIYCAACYEDKFATRCVKCNK------- 1270

Query: 61   KGTFQSHSGRINKVYSILFYFLFQIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSR 120
                                    IITSGGVTYKNEPWHR+CFTCSNC+ SLAGQRFTSR
Sbjct: 1271 ------------------------IITSGGVTYKNEPWHRDCFTCSNCNNSLAGQRFTSR 1306

Query: 121  EDKPFCADCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGF 180
            +DKP+CADCFGELFAKRC +C KPITGIGGTRFISFEDRHWHNDCF+CA C++SLVGRGF
Sbjct: 1307 DDKPYCADCFGELFAKRCTACSKPITGIGGTRFISFEDRHWHNDCFICAGCKTSLVGRGF 1366

Query: 181  ITDGEDIICPDCAKAKLM 198
            ITDGEDIICPDCAK KLM
Sbjct: 1367 ITDGEDIICPDCAKMKLM 1384




Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340719742|ref|XP_003398306.1| PREDICTED: hypothetical protein LOC100650291 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380027198|ref|XP_003697316.1| PREDICTED: four and a half LIM domains protein 2-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|328786758|ref|XP_393694.4| PREDICTED: four and a half LIM domains protein 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|380027200|ref|XP_003697317.1| PREDICTED: four and a half LIM domains protein 2-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|383851070|ref|XP_003701076.1| PREDICTED: uncharacterized protein LOC100883879 [Megachile rotundata] Back     alignment and taxonomy information
>gi|332021158|gb|EGI61543.1| Four and a half LIM domains protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|389611039|dbj|BAM19130.1| limpet protein [Papilio polytes] Back     alignment and taxonomy information
>gi|320545982|ref|NP_001189122.1| limpet, isoform J [Drosophila melanogaster] gi|318069230|gb|ADV37558.1| limpet, isoform J [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|307166375|gb|EFN60512.1| Four and a half LIM domains protein 2 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
WB|WBGene00006407656 lim-9 [Caenorhabditis elegans 0.580 0.175 0.747 7.6e-74
UNIPROTKB|Q3ZBI6280 FHL3 "Four and a half LIM doma 0.555 0.392 0.618 2.6e-59
UNIPROTKB|E2QXW5290 FHL3 "Uncharacterized protein" 0.555 0.379 0.609 5.4e-59
UNIPROTKB|F1SV27280 FHL3 "Uncharacterized protein" 0.555 0.392 0.609 2.3e-58
UNIPROTKB|Q13643280 FHL3 "Four and a half LIM doma 0.555 0.392 0.590 4.8e-58
UNIPROTKB|Q2KI95279 FHL2 "Four and a half LIM doma 0.550 0.390 0.605 4.8e-58
ZFIN|ZDB-GENE-040808-49279 fhl2a "four and a half LIM dom 0.550 0.390 0.596 9.9e-58
UNIPROTKB|J3KNW4389 FHL2 "Four and a half LIM doma 0.550 0.280 0.596 2e-57
UNIPROTKB|Q14192279 FHL2 "Four and a half LIM doma 0.550 0.390 0.596 2e-57
RGD|1307180288 Fhl3 "four and a half LIM doma 0.555 0.381 0.567 1.8e-56
WB|WBGene00006407 lim-9 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 543 (196.2 bits), Expect = 7.6e-74, Sum P(2) = 7.6e-74
 Identities = 86/115 (74%), Positives = 108/115 (93%)

Query:    84 QIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSREDKPFCADCFGELFAKRCYSCKK 143
             ++IT+GGVTYKNEPWHRECF C+NC++SLAGQRFTS+++KP+CA+C+G+LFAKRC +C K
Sbjct:   538 KVITAGGVTYKNEPWHRECFCCTNCNSSLAGQRFTSKDEKPYCANCYGDLFAKRCNACTK 597

Query:   144 PITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGFITDGEDIICPDCAKAKLM 198
             PITGIGG +FISFEDRHWHNDCF+CA C +SLVG+GFITDG +I+CP+CAKA+LM
Sbjct:   598 PITGIGGAKFISFEDRHWHNDCFICAQCTTSLVGKGFITDGHEILCPECAKARLM 652


GO:0008270 "zinc ion binding" evidence=IEA
GO:0071688 "striated muscle myosin thick filament assembly" evidence=IMP
GO:0031430 "M band" evidence=IDA
GO:0019904 "protein domain specific binding" evidence=IPI
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|Q3ZBI6 FHL3 "Four and a half LIM domains protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXW5 FHL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SV27 FHL3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q13643 FHL3 "Four and a half LIM domains protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KI95 FHL2 "Four and a half LIM domains protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040808-49 fhl2a "four and a half LIM domains 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNW4 FHL2 "Four and a half LIM domains protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q14192 FHL2 "Four and a half LIM domains protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307180 Fhl3 "four and a half LIM domains 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
cd0943256 cd09432, LIM6_LIMPETin, The sixth LIM domain of pr 6e-29
cd0934756 cd09347, LIM4_FHL, The fourth LIM domain of Four a 1e-25
cd0943052 cd09430, LIM5_LIMPETin, The fifth LIM domain of pr 1e-22
cd0943358 cd09433, LIM4_FHL2, The fourth LIM domain of Four 1e-20
cd0934652 cd09346, LIM3_FHL, The third LIM domain of Four an 2e-20
cd0943456 cd09434, LIM4_FHL3, The fourth LIM domain of Four 5e-20
cd0942554 cd09425, LIM4_LIMPETin, The fourth LIM domain of p 3e-17
cd0942953 cd09429, LIM3_FHL1, The third LIM domain of Four a 1e-15
cd0943157 cd09431, LIM3_Fhl2, The third LIM domain of Four a 1e-14
cd0934864 cd09348, LIM4_FHL1, The fourth LIM domain of Four 4e-13
cd0934554 cd09345, LIM2_FHL, The second LIM domain of Four a 6e-13
cd0942458 cd09424, LIM2_FHL1, The second LIM domain of Four 1e-11
cd0942657 cd09426, LIM2_FHL2, The second LIM domain of Four 1e-10
cd0934359 cd09343, LIM1_FHL, The first LIM domain of Four an 3e-10
cd0942758 cd09427, LIM2_FHL3, The second LIM domain of Four 1e-09
cd0942262 cd09422, LIM1_FHL2, The first LIM domain of Four a 2e-09
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 8e-09
cd0942159 cd09421, LIM3_LIMPETin, The third LIM domain of pr 3e-08
cd0934652 cd09346, LIM3_FHL, The third LIM domain of Four an 4e-08
cd0942953 cd09429, LIM3_FHL1, The third LIM domain of Four a 2e-07
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 5e-07
cd0942854 cd09428, LIM2_FHL5, The second LIM domain of Four 9e-07
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 1e-06
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 1e-06
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 1e-06
cd0934987 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin 1e-06
cd0934359 cd09343, LIM1_FHL, The first LIM domain of Four an 2e-06
cd0942159 cd09421, LIM3_LIMPETin, The third LIM domain of pr 2e-06
cd0934756 cd09347, LIM4_FHL, The fourth LIM domain of Four a 3e-06
cd0934454 cd09344, LIM1_FHL1, The first LIM domain of Four a 3e-06
cd0934156 cd09341, LIM2_Testin_like, The second LIM domain o 4e-06
pfam0041258 pfam00412, LIM, LIM domain 5e-06
cd0934864 cd09348, LIM4_FHL1, The fourth LIM domain of Four 7e-06
cd0942159 cd09421, LIM3_LIMPETin, The third LIM domain of pr 7e-06
cd0934359 cd09343, LIM1_FHL, The first LIM domain of Four an 9e-06
cd0943456 cd09434, LIM4_FHL3, The fourth LIM domain of Four 1e-05
cd0934554 cd09345, LIM2_FHL, The second LIM domain of Four a 1e-05
cd0934454 cd09344, LIM1_FHL1, The first LIM domain of Four a 1e-05
cd0942758 cd09427, LIM2_FHL3, The second LIM domain of Four 2e-05
cd0942262 cd09422, LIM1_FHL2, The first LIM domain of Four a 2e-05
pfam0041258 pfam00412, LIM, LIM domain 2e-05
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 2e-05
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 3e-05
cd0942359 cd09423, LIM1_FHL3, The first LIM domain of Four a 3e-05
cd0942953 cd09429, LIM3_FHL1, The third LIM domain of Four a 4e-05
cd0945955 cd09459, LIM3_ENH, The third LIM domain of the Eni 4e-05
cd0943157 cd09431, LIM3_Fhl2, The third LIM domain of Four a 5e-05
cd0942458 cd09424, LIM2_FHL1, The second LIM domain of Four 5e-05
cd0942458 cd09424, LIM2_FHL1, The second LIM domain of Four 5e-05
cd0943256 cd09432, LIM6_LIMPETin, The sixth LIM domain of pr 7e-05
cd0934652 cd09346, LIM3_FHL, The third LIM domain of Four an 7e-05
cd0943052 cd09430, LIM5_LIMPETin, The fifth LIM domain of pr 1e-04
cd0943358 cd09433, LIM4_FHL2, The fourth LIM domain of Four 1e-04
cd0942262 cd09422, LIM1_FHL2, The first LIM domain of Four a 1e-04
cd0934454 cd09344, LIM1_FHL1, The first LIM domain of Four a 1e-04
cd0935054 cd09350, LIM1_TRIP6, The first LIM domain of Thyro 1e-04
cd0936354 cd09363, LIM3_Enigma_like, The third LIM domain of 1e-04
cd0941756 cd09417, LIM2_LIMPETin_like, The second LIM domain 1e-04
cd0942554 cd09425, LIM4_LIMPETin, The fourth LIM domain of p 2e-04
cd0934257 cd09342, LIM3_Testin_like, The third LIM domain of 2e-04
cd0943456 cd09434, LIM4_FHL3, The fourth LIM domain of Four 3e-04
cd0934156 cd09341, LIM2_Testin_like, The second LIM domain o 3e-04
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 3e-04
cd0946055 cd09460, LIM3_ZASP_Cypher, The third LIM domain of 3e-04
cd0941856 cd09418, LIM2_Prickle, The second LIM domain of Pr 3e-04
cd0943157 cd09431, LIM3_Fhl2, The third LIM domain of Four a 4e-04
cd0936152 cd09361, LIM1_Enigma_like, The first LIM domain of 4e-04
cd0943052 cd09430, LIM5_LIMPETin, The fifth LIM domain of pr 5e-04
cd0934554 cd09345, LIM2_FHL, The second LIM domain of Four a 5e-04
cd0945955 cd09459, LIM3_ENH, The third LIM domain of the Eni 5e-04
cd0939653 cd09396, LIM_DA1, The Lim domain of DA1 6e-04
cd0942854 cd09428, LIM2_FHL5, The second LIM domain of Four 9e-04
cd0934756 cd09347, LIM4_FHL, The fourth LIM domain of Four a 0.001
cd0942359 cd09423, LIM1_FHL3, The first LIM domain of Four a 0.001
cd0946055 cd09460, LIM3_ZASP_Cypher, The third LIM domain of 0.001
cd0941856 cd09418, LIM2_Prickle, The second LIM domain of Pr 0.001
cd0941959 cd09419, LIM3_Testin, The third LIM domain of Test 0.001
cd0942059 cd09420, LIM3_Prickle, The third LIM domain of Pri 0.001
cd0945452 cd09454, LIM1_ZASP_Cypher, The first LIM domain of 0.001
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 0.001
cd0943256 cd09432, LIM6_LIMPETin, The sixth LIM domain of pr 0.002
cd0942657 cd09426, LIM2_FHL2, The second LIM domain of Four 0.002
pfam0041258 pfam00412, LIM, LIM domain 0.002
cd0936354 cd09363, LIM3_Enigma_like, The third LIM domain of 0.002
cd0934257 cd09342, LIM3_Testin_like, The third LIM domain of 0.002
cd0936152 cd09361, LIM1_Enigma_like, The first LIM domain of 0.002
cd0932653 cd09326, LIM_CRP_like, The LIM domains of Cysteine 0.002
cd0936252 cd09362, LIM2_Enigma_like, The second LIM domain o 0.002
cd0937253 cd09372, LIM2_FBLP-1, The second LIM domain of the 0.002
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 0.003
cd0945855 cd09458, LIM3_Enigma, The third LIM domain of Enig 0.003
cd0939356 cd09393, LIM3_Lrg1p_like, The third LIM domain of 0.003
cd0945652 cd09456, LIM2_Enigma, The second LIM domain of Eni 0.003
cd0940153 cd09401, LIM_TLP_like, The LIM domains of thymus L 0.003
cd0942657 cd09426, LIM2_FHL2, The second LIM domain of Four 0.004
cd0934156 cd09341, LIM2_Testin_like, The second LIM domain o 0.004
cd0942059 cd09420, LIM3_Prickle, The third LIM domain of Pri 0.004
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 0.004
cd0932752 cd09327, LIM1_abLIM, The first LIM domain of actin 0.004
cd0935360 cd09353, LIM2_Zyxin, The second LIM domain of Zyxi 0.004
cd0932952 cd09329, LIM3_abLIM, The third LIM domain of actin 0.004
cd0984054 cd09840, LIM2_CRP2, The second LIM domain of Cyste 0.004
>gnl|CDD|188816 cd09432, LIM6_LIMPETin, The sixth LIM domain of protein LIMPETin Back     alignment and domain information
 Score =  102 bits (255), Expect = 6e-29
 Identities = 44/56 (78%), Positives = 50/56 (89%)

Query: 138 CYSCKKPITGIGGTRFISFEDRHWHNDCFMCASCQSSLVGRGFITDGEDIICPDCA 193
           C +C KPITGIGGT+FISFEDRHWHNDCF CA C++SLVG+GFITDG  I+CPDCA
Sbjct: 1   CAACGKPITGIGGTKFISFEDRHWHNDCFNCAGCRTSLVGKGFITDGGRILCPDCA 56


The sixth LIM domain of protein LIMPETin: LIMPETin contains 6 LIM domains at the C-terminal and an N-terminal PET domain. Four of the six LIM domains are highly homologous to the four and half LIM domain protein family and two of them show sequence similarity to the LIM domains of the testin family. Thus, LIMPETin may be the recombinant product of genes coding testin and FHL proteins. In Schistosoma mansoni, where LIMPETin was first identified, LIMPETin is down regulated in sexually mature adult Schistosoma females compared to sexually immature adult females and adult male. Its differential expression indicates that it is a transcription regulator. LIM domains are 50-60 amino acids in size and share two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 56

>gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188817 cd09433, LIM4_FHL2, The fourth LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188818 cd09434, LIM4_FHL3, The fourth LIM domain of Four and a half LIM domains protein 3 (FHL3) Back     alignment and domain information
>gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188734 cd09348, LIM4_FHL1, The fourth LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188810 cd09426, LIM2_FHL2, The second LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188811 cd09427, LIM2_FHL3, The second LIM domain of Four and a half LIM domains protein 3 (FHL3) Back     alignment and domain information
>gnl|CDD|188806 cd09422, LIM1_FHL2, The first LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188812 cd09428, LIM2_FHL5, The second LIM domain of Four and a half LIM domains protein 5 (FHL5) Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188730 cd09344, LIM1_FHL1, The first LIM domain of Four and a half LIM domains protein 1 Back     alignment and domain information
>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188734 cd09348, LIM4_FHL1, The fourth LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188818 cd09434, LIM4_FHL3, The fourth LIM domain of Four and a half LIM domains protein 3 (FHL3) Back     alignment and domain information
>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188730 cd09344, LIM1_FHL1, The first LIM domain of Four and a half LIM domains protein 1 Back     alignment and domain information
>gnl|CDD|188811 cd09427, LIM2_FHL3, The second LIM domain of Four and a half LIM domains protein 3 (FHL3) Back     alignment and domain information
>gnl|CDD|188806 cd09422, LIM1_FHL2, The first LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188807 cd09423, LIM1_FHL3, The first LIM domain of Four and a half LIM domains protein 3 (FHL3) Back     alignment and domain information
>gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188816 cd09432, LIM6_LIMPETin, The sixth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188817 cd09433, LIM4_FHL2, The fourth LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188806 cd09422, LIM1_FHL2, The first LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188730 cd09344, LIM1_FHL1, The first LIM domain of Four and a half LIM domains protein 1 Back     alignment and domain information
>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188801 cd09417, LIM2_LIMPETin_like, The second LIM domain of protein LIMPETin and related proteins Back     alignment and domain information
>gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188728 cd09342, LIM3_Testin_like, The third LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188818 cd09434, LIM4_FHL3, The fourth LIM domain of Four and a half LIM domains protein 3 (FHL3) Back     alignment and domain information
>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188802 cd09418, LIM2_Prickle, The second LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 Back     alignment and domain information
>gnl|CDD|188812 cd09428, LIM2_FHL5, The second LIM domain of Four and a half LIM domains protein 5 (FHL5) Back     alignment and domain information
>gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188807 cd09423, LIM1_FHL3, The first LIM domain of Four and a half LIM domains protein 3 (FHL3) Back     alignment and domain information
>gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188802 cd09418, LIM2_Prickle, The second LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188803 cd09419, LIM3_Testin, The third LIM domain of Testin Back     alignment and domain information
>gnl|CDD|188804 cd09420, LIM3_Prickle, The third LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188838 cd09454, LIM1_ZASP_Cypher, The first LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188816 cd09432, LIM6_LIMPETin, The sixth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188810 cd09426, LIM2_FHL2, The second LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188728 cd09342, LIM3_Testin_like, The third LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family Back     alignment and domain information
>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding LIM protein-1 (FBLP-1) Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188842 cd09458, LIM3_Enigma, The third LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188810 cd09426, LIM2_FHL2, The second LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188804 cd09420, LIM3_Prickle, The third LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
KOG1701|consensus468 100.0
KOG2272|consensus332 100.0
KOG2272|consensus332 99.96
KOG1703|consensus479 99.95
KOG1044|consensus 670 99.93
KOG1701|consensus468 99.89
KOG1044|consensus 670 99.87
KOG1703|consensus479 99.86
KOG4577|consensus 383 99.83
KOG4577|consensus 383 99.72
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.52
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.46
KOG1700|consensus200 99.34
KOG1700|consensus200 99.21
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.79
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.49
KOG0490|consensus 235 97.2
KOG0490|consensus235 96.81
KOG1702|consensus264 96.44
KOG1702|consensus 264 96.21
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 91.71
PF1463444 zf-RING_5: zinc-RING finger domain 87.47
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 86.46
PF0839437 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: 84.14
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 81.1
>KOG1701|consensus Back     alignment and domain information
Probab=100.00  E-value=7.8e-39  Score=262.11  Aligned_cols=165  Identities=29%  Similarity=0.708  Sum_probs=151.7

Q ss_pred             CccCCcccCcCCcccCCCCCCCCCCCcccCCCeecchhhHHhhhcccccccccccccccccccccccCCcccccceeeee
Q psy8131           1 MEYKTRQWHEKCFACVVCKTPIGTKSFIPREQEIYCANCYEEKFATRCVKCNKTFFRLREKGTFQSHSGRINKVYSILFY   80 (198)
Q Consensus         1 ~~~~~~~~H~~CF~C~~C~~~L~~~~f~~~~g~~yC~~cy~~~~~~~C~~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (198)
                      +++|++.||.+||+|..|++.|.++.||..|+++||+.||... ..+|..|++                           
T Consensus       291 c~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~t-lekC~~Cg~---------------------------  342 (468)
T KOG1701|consen  291 VEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDT-LEKCNKCGE---------------------------  342 (468)
T ss_pred             HHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHH-HHHHhhhhh---------------------------
Confidence            3689999999999999999999999999999999999999886 569999999                           


Q ss_pred             eeeeeeccCceEeCCcCccccCCCCccCcCCCCCCceeec-CCcccchhhHhhhhccCCCCCCCCCcCCCCc---eEEee
Q psy8131          81 FLFQIITSGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSR-EDKPFCADCFGELFAKRCYSCKKPITGIGGT---RFISF  156 (198)
Q Consensus        81 ~~~~~i~~~~~~~~~~~~H~~CF~C~~C~~~l~~~~~~~~-~g~~yC~~c~~~~~~~~C~~C~~~I~~~~~~---~~~~~  156 (198)
                          +|.+..+.+.|+.||+.||+|..|++.|++..|.++ ++++||.+||+++|+++|+.|++||.+.+|.   ..|++
T Consensus       343 ----~I~d~iLrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~~G~~etvRvva  418 (468)
T KOG1701|consen  343 ----PIMDRILRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPRDGKDETVRVVA  418 (468)
T ss_pred             ----HHHHHHHHhcccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCCCCCcceEEEEE
Confidence                777888899999999999999999999999999876 6999999999999999999999999876544   35789


Q ss_pred             CCCcccccCcccCcCCCCCC----CCceEecCCceeCcccccccC
Q psy8131         157 EDRHWHNDCFMCASCQSSLV----GRGFITDGEDIICPDCAKAKL  197 (198)
Q Consensus       157 ~~~~~H~~Cf~C~~C~~~l~----~~~~~~~~~~~~C~~C~~~~~  197 (198)
                      +++.||.+|++|..|+..|+    +...+..|+.++|+.|..+++
T Consensus       419 mdr~fHv~CY~CEDCg~~LS~e~e~qgCyPld~HllCk~Ch~~Rl  463 (468)
T KOG1701|consen  419 MDRDFHVNCYKCEDCGLLLSSEEEGQGCYPLDGHLLCKTCHLKRL  463 (468)
T ss_pred             ccccccccceehhhcCccccccCCCCcceeccCceeechhhhhhh
Confidence            99999999999999999995    567899999999999988765



>KOG2272|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
2cuq_A80 Solution Structure Of Second Lim Domain From Human 3e-18
2cuq_A80 Solution Structure Of Second Lim Domain From Human 9e-07
1x4l_A72 Solution Structure Of Lim Domain In Four And A Half 8e-17
2d8z_A70 Solution Structure Of The Third Lim Domain Of Four 9e-13
2d8z_A70 Solution Structure Of The Third Lim Domain Of Four 2e-04
1x68_A76 Solution Structures Of The C-Terminal Lim Domain Of 2e-12
2cur_A69 Solution Structure Of Skeletal Muscle Lim-Protein 1 2e-12
2cur_A69 Solution Structure Of Skeletal Muscle Lim-Protein 1 2e-05
2egq_A77 Solution Structure Of The Fourth Lim Domain From Hu 4e-12
1x4k_A72 Solution Structure Of Lim Domain In Lim-Protein 3 L 5e-10
1wyh_A72 Solution Structure Of The Lim Domain From Human Ske 6e-09
2xqn_T126 Complex Of The 2nd And 3rd Lim Domains Of Tes With 2e-08
1x63_A82 Solution Structure Of The Second Lim Domain Of Skel 2e-08
1x63_A82 Solution Structure Of The Second Lim Domain Of Skel 1e-05
2cup_A101 Solution Structure Of The Skeletal Muscle Lim-Prote 7e-08
2cup_A101 Solution Structure Of The Skeletal Muscle Lim-Prote 2e-04
2xjy_A131 Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 3e-06
2ehe_A82 Solution Structure Of The First Lim Domain From Hum 1e-05
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 3e-05
2jtn_A182 Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl 4e-05
1b8t_A192 Solution Structure Of The Chicken Crp1 Length = 192 7e-05
3mmk_A169 The Structural Basis For Partial Redundancy In A Cl 3e-04
1cxx_A113 Mutant R122a Of Quail Cysteine And Glycine-Rich Pro 7e-04
1qli_A113 Quail Cysteine And Glycine-Rich Protein, Nmr, 15 Mi 7e-04
>pdb|2CUQ|A Chain A, Solution Structure Of Second Lim Domain From Human Skeletal Muscle Lim-Protein 2 Length = 80 Back     alignment and structure

Iteration: 1

Score = 87.8 bits (216), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 43/98 (43%), Positives = 54/98 (55%), Gaps = 31/98 (31%) Query: 39 CYEEKFATRCVKCNKTFFRLREKGTFQSHSGRINKVYSILFYFLFQIITSGGVTYKNEPW 98 CYE KFA RC +C+KT +T GGVTY+++PW Sbjct: 9 CYENKFAPRCARCSKT-------------------------------LTQGGVTYRDQPW 37 Query: 99 HRECFTCSNCSTSLAGQRFTSREDKPFCADCFGELFAK 136 HREC C+ C T LAGQ+FTSR++ P+C CFGELFA Sbjct: 38 HRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAS 75
>pdb|2CUQ|A Chain A, Solution Structure Of Second Lim Domain From Human Skeletal Muscle Lim-Protein 2 Length = 80 Back     alignment and structure
>pdb|1X4L|A Chain A, Solution Structure Of Lim Domain In Four And A Half Lim Domains Protein 2 Length = 72 Back     alignment and structure
>pdb|2D8Z|A Chain A, Solution Structure Of The Third Lim Domain Of Four And A Half Lim Domains Protein 2 (Fhl-2) Length = 70 Back     alignment and structure
>pdb|2D8Z|A Chain A, Solution Structure Of The Third Lim Domain Of Four And A Half Lim Domains Protein 2 (Fhl-2) Length = 70 Back     alignment and structure
>pdb|1X68|A Chain A, Solution Structures Of The C-Terminal Lim Domain Of Human Fhl5 Protein Length = 76 Back     alignment and structure
>pdb|2CUR|A Chain A, Solution Structure Of Skeletal Muscle Lim-Protein 1 Length = 69 Back     alignment and structure
>pdb|2CUR|A Chain A, Solution Structure Of Skeletal Muscle Lim-Protein 1 Length = 69 Back     alignment and structure
>pdb|2EGQ|A Chain A, Solution Structure Of The Fourth Lim Domain From Human Four And A Half Lim Domains 1 Length = 77 Back     alignment and structure
>pdb|1X4K|A Chain A, Solution Structure Of Lim Domain In Lim-Protein 3 Length = 72 Back     alignment and structure
>pdb|1WYH|A Chain A, Solution Structure Of The Lim Domain From Human Skeletal Muscle Lim-Protein 2 Length = 72 Back     alignment and structure
>pdb|2XQN|T Chain T, Complex Of The 2nd And 3rd Lim Domains Of Tes With The Evh1 Domain Of Mena And The N-Terminal Domain Of Actin-Like Protein Arp7a Length = 126 Back     alignment and structure
>pdb|1X63|A Chain A, Solution Structure Of The Second Lim Domain Of Skeletal Muscle Lim Protein 1 Length = 82 Back     alignment and structure
>pdb|1X63|A Chain A, Solution Structure Of The Second Lim Domain Of Skeletal Muscle Lim Protein 1 Length = 82 Back     alignment and structure
>pdb|2CUP|A Chain A, Solution Structure Of The Skeletal Muscle Lim-Protein 1 Length = 101 Back     alignment and structure
>pdb|2CUP|A Chain A, Solution Structure Of The Skeletal Muscle Lim-Protein 1 Length = 101 Back     alignment and structure
>pdb|2XJY|A Chain A, Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 Crystal Form Length = 131 Back     alignment and structure
>pdb|2EHE|A Chain A, Solution Structure Of The First Lim Domain From Human Four And A Half Lim Domains Protein 3 Length = 82 Back     alignment and structure
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure
>pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 Back     alignment and structure
>pdb|1B8T|A Chain A, Solution Structure Of The Chicken Crp1 Length = 192 Back     alignment and structure
>pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 Back     alignment and structure
>pdb|1CXX|A Chain A, Mutant R122a Of Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Structure Length = 113 Back     alignment and structure
>pdb|1QLI|A Chain A, Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Average Structure Length = 113 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 8e-30
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-23
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 7e-08
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 1e-25
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 9e-18
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 1e-13
2rgt_A 169 Fusion of LIM/homeobox protein LHX3, linker, INSU 4e-06
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 7e-24
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 6e-10
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 2e-09
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 9e-23
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 3e-16
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 1e-10
2cuq_A80 Four and A half LIM domains 3; structural genomics 1e-21
2cuq_A80 Four and A half LIM domains 3; structural genomics 2e-14
2cuq_A80 Four and A half LIM domains 3; structural genomics 3e-11
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 2e-21
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 5e-15
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 3e-08
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 2e-21
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 1e-10
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 5e-09
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 3e-21
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 6e-16
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 4e-07
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 6e-21
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 1e-11
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 5e-10
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 2e-18
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 1e-13
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 2e-10
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 3e-18
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 9e-15
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 2e-14
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 4e-18
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 2e-11
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 5e-11
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 3e-17
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 2e-11
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 4e-11
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 9e-17
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 2e-14
1rut_X 188 Flinc4, fusion protein of LMO4 protein and LIM dom 7e-06
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 1e-16
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 4e-15
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 1e-11
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 3e-16
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 1e-13
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 4e-06
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 3e-14
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 6e-14
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 2e-11
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 3e-14
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 4e-11
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 8e-11
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 3e-14
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 1e-13
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 2e-11
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 1e-13
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 7e-10
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 3e-08
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 2e-13
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 3e-11
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 5e-10
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 8e-13
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 1e-09
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 3e-09
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 2e-12
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 8e-10
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 2e-08
3f6q_B72 LIM and senescent cell antigen-like-containing dom 2e-12
3f6q_B72 LIM and senescent cell antigen-like-containing dom 2e-09
3f6q_B72 LIM and senescent cell antigen-like-containing dom 1e-08
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 7e-12
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 2e-10
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 9e-10
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 1e-11
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 3e-09
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 3e-05
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 1e-11
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 2e-09
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 9e-05
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 3e-11
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 5e-10
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 2e-09
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 7e-11
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 8e-10
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 9e-10
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 2e-10
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 3e-07
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 4e-04
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 2e-10
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 2e-07
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 4e-05
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 3e-10
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 1e-06
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 4e-04
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 3e-10
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 7e-06
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 4e-10
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 2e-09
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 2e-06
2cor_A79 Pinch protein; LIM domain, particularly interestin 2e-09
2cor_A79 Pinch protein; LIM domain, particularly interestin 8e-07
2cor_A79 Pinch protein; LIM domain, particularly interestin 4e-05
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 2e-09
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 1e-07
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 1e-08
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 5e-08
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 4e-06
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 1e-07
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 9e-07
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 2e-04
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 1e-06
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 2e-06
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 3e-06
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 5e-06
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 7e-06
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 1e-05
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 3e-04
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
 Score =  105 bits (265), Expect = 8e-30
 Identities = 32/117 (27%), Positives = 57/117 (48%), Gaps = 5/117 (4%)

Query: 84  QIITSGGVT-YKNEPWHRECFTCSNCSTSLAGQRFTSREDKPFCADCFGELFAKRCYSCK 142
           ++I S   T  +N+ WH + F C +C + LAG+ +    DKP C  C+ +  A  C  C 
Sbjct: 11  ELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCH 70

Query: 143 KPITGIGGTRFISFEDRHWH--NDCFMCASCQSSLVGRGFITDGEDIICPDCAKAKL 197
             I      + +++ +  WH   +CF+C+ C   L+G+ F+     + C    K ++
Sbjct: 71  NAID--PEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRM 125


>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.97
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.97
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.96
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.96
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.96
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.95
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.95
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.95
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.94
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.94
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.94
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.93
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.92
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.89
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.88
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.85
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.85
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.85
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.84
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.83
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.81
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.8
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.8
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.8
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.8
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.79
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.78
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.78
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.78
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.76
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.75
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.73
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.73
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.72
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.71
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.7
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.7
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.7
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.69
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.68
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.68
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.66
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.65
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.65
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.65
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.65
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.63
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.63
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.62
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.61
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.61
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.6
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.6
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.6
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.6
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.59
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.59
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.59
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.58
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.58
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.58
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.58
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.58
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.58
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.57
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.56
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.56
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.55
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.55
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.54
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.53
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.53
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.53
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.52
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.52
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.51
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.51
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.5
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.49
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.48
2co8_A82 NEDD9 interacting protein with calponin homology a 99.47
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.46
2co8_A82 NEDD9 interacting protein with calponin homology a 99.45
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.44
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.7
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.15
1jjd_A55 Metallothionein, SMTA; zinc finger, zinc cluster, 86.86
2ecm_A55 Ring finger and CHY zinc finger domain- containing 84.93
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 83.6
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 82.57
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 80.7
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 80.37
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=7.1e-32  Score=194.07  Aligned_cols=122  Identities=27%  Similarity=0.705  Sum_probs=111.2

Q ss_pred             hcccccccccccccccccccccccCCcccccceeeeeeeeeeec-cCceEeCCcCccccCCCCccCcCCCCCCceeecCC
Q psy8131          44 FATRCVKCNKTFFRLREKGTFQSHSGRINKVYSILFYFLFQIIT-SGGVTYKNEPWHRECFTCSNCSTSLAGQRFTSRED  122 (198)
Q Consensus        44 ~~~~C~~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~-~~~~~~~~~~~H~~CF~C~~C~~~l~~~~~~~~~g  122 (198)
                      ++++|.+|+++                               |. +..+.++|+.||++||+|+.|+++|++..|+++||
T Consensus         2 ~~~~C~~C~~~-------------------------------I~~~~~~~a~~~~~H~~CF~C~~C~~~L~~~~f~~~~g   50 (126)
T 2xqn_T            2 EKPRCAGCDEL-------------------------------IFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVND   50 (126)
T ss_dssp             CCCBBTTTSSB-------------------------------CCSSCEEEETTEEECGGGSBCTTTCCBCTTSEEEEETT
T ss_pred             cCCCCccCCCE-------------------------------eCCceEEeeCCCCccCCCCCcCCCCCCCCcCEEEeECC
Confidence            57899999994                               44 44678999999999999999999999888999999


Q ss_pred             cccchhhHhhhhccCCCCCCCCCcCCCCceEEeeCCCccc--ccCcccCcCCCCCCCCceEecCCceeCcccccccCC
Q psy8131         123 KPFCADCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWH--NDCFMCASCQSSLVGRGFITDGEDIICPDCAKAKLM  198 (198)
Q Consensus       123 ~~yC~~c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~~~H--~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~C~~~~~~  198 (198)
                      ++||+.||.++++++|++|+++|.+.  +.+|++.++.||  ++||+|..|+++|.++.|+..++++||..++.++|.
T Consensus        51 ~~yC~~cy~~~~~~~C~~C~~~I~~~--~~~~~a~~~~~H~~~~CF~C~~C~~~l~~~~f~~~~~~~yC~~~~~~~f~  126 (126)
T 2xqn_T           51 KPVCKPCYVKNHAVVCQGCHNAIDPE--VQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS  126 (126)
T ss_dssp             EEEEHHHHHHHSCCBCTTTCSBCCTT--SCEEEETTEEEESSTTTSBCTTTCCBCTTSEEEEETTEEESSHHHHHSCC
T ss_pred             EEechHHhCcCcCccCcccCCcCCcC--ceEEECCCCEeeCCCCCcCcCCCCCccCCCeeEeECCEEcchHHhhhhcC
Confidence            99999999999999999999999962  478999999999  999999999999999999999999999977777663



>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1jjd_A Metallothionein, SMTA; zinc finger, zinc cluster, metal binding PR; NMR {Synechococcus elongatus} SCOP: g.46.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d1x4la129 g.39.1.3 (A:8-36) Four and a half LIM domains prot 2e-11
d1x68a129 g.39.1.3 (A:8-36) Four and a half LIM domains prot 2e-11
d2cuqa132 g.39.1.3 (A:43-74) Four and a half LIM domains 3, 1e-10
d1x4ka132 g.39.1.3 (A:35-66) Four and a half LIM domains pro 2e-10
d1wyha132 g.39.1.3 (A:35-66) Four and a half LIM domains 3, 7e-10
d2d8za232 g.39.1.3 (A:33-64) Four and a half LIM domains pro 1e-09
d2d8za232 g.39.1.3 (A:33-64) Four and a half LIM domains pro 0.003
d2cuqa235 g.39.1.3 (A:8-42) Four and a half LIM domains 3, F 2e-09
d2cuqa235 g.39.1.3 (A:8-42) Four and a half LIM domains 3, F 3e-05
d2cura226 g.39.1.3 (A:8-32) Four and a half LIM domains prot 1e-06
d2d8za126 g.39.1.3 (A:8-32) Four and a half LIM domains prot 3e-06
d1x4la230 g.39.1.3 (A:37-66) Four and a half LIM domains pro 1e-05
d1x63a137 g.39.1.3 (A:8-44) Four and a half LIM domains prot 3e-05
d1x3ha135 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ 1e-04
d2cura131 g.39.1.3 (A:33-63) Four and a half LIM domains pro 1e-04
d1g47a235 g.39.1.3 (A:36-70) Pinch (particularly interesting 4e-04
d1g47a235 g.39.1.3 (A:36-70) Pinch (particularly interesting 8e-04
d1x68a234 g.39.1.3 (A:37-70) Four and a half LIM domains pro 5e-04
d1x63a232 g.39.1.3 (A:45-76) Four and a half LIM domains pro 8e-04
d2dara245 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En 0.001
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Four and a half LIM domains protein 2, FHL2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 54.1 bits (130), Expect = 2e-11
 Identities = 19/29 (65%), Positives = 24/29 (82%)

Query: 138 CYSCKKPITGIGGTRFISFEDRHWHNDCF 166
           C  C  PI+G+GGT++ISFE+R WHNDCF
Sbjct: 1   CAGCTNPISGLGGTKYISFEERQWHNDCF 29


>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2cura2 g.39.1.3 (A:8-32) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2d8za1 g.39.1.3 (A:8-32) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1g47a235 Pinch (particularly interesting new Cys-His) prote 99.2
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.98
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.96
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.95
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.94
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.93
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.76
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.72
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 98.69
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.67
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.67
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.66
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 98.66
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.65
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 98.63
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.62
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.61
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.61
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.6
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.58
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.52
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.48
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.48
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.44
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 98.42
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 98.39
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.37
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.32
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.3
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 98.3
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.29
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.29
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.24
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.2
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 98.2
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.17
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 98.16
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 98.15
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 98.14
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.12
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.12
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.11
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.09
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 98.08
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 98.07
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.07
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.07
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 98.06
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 98.03
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 98.01
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.93
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.93
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.91
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.91
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.86
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.82
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.81
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.78
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.76
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.76
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.73
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.68
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 97.67
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 97.66
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.62
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.58
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.54
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.53
d2co8a236 Nedd9 interacting protein with calponin homology, 97.52
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.51
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.47
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 97.46
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.45
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.43
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.41
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 97.22
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 97.2
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.19
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.19
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.07
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.06
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.03
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.0
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 96.91
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 96.83
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 96.83
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.83
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.72
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.71
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 96.69
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.62
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 96.54
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 96.5
d2co8a236 Nedd9 interacting protein with calponin homology, 96.41
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 96.39
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.32
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 96.29
d2cora131 Pinch (particularly interesting new Cys-His) prote 96.18
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.13
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.1
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 96.03
d2cora131 Pinch (particularly interesting new Cys-His) prote 95.95
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 95.92
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 95.8
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.75
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 95.67
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 95.67
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 95.33
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 94.99
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 94.9
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 94.84
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 94.82
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 94.82
d1g47a135 Pinch (particularly interesting new Cys-His) prote 94.55
d2cora235 Pinch (particularly interesting new Cys-His) prote 94.39
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 94.16
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 93.95
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 93.93
d1g47a135 Pinch (particularly interesting new Cys-His) prote 93.9
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 93.86
d2cora235 Pinch (particularly interesting new Cys-His) prote 93.44
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 92.19
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 92.13
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 91.46
d1x4la230 Four and a half LIM domains protein 2, FHL2 {Human 90.14
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 89.61
d1x4la230 Four and a half LIM domains protein 2, FHL2 {Human 89.6
d1j2oa233 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 89.47
d1j2oa233 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 88.12
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 88.1
d2co8a133 Nedd9 interacting protein with calponin homology, 81.81
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 81.38
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Leupaxin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.30  E-value=1.5e-13  Score=73.82  Aligned_cols=35  Identities=31%  Similarity=0.890  Sum_probs=32.6

Q ss_pred             hhHhhhhccCCCCCCCCCcCCCCceEEeeCCCcccccCc
Q psy8131         128 DCFGELFAKRCYSCKKPITGIGGTRFISFEDRHWHNDCF  166 (198)
Q Consensus       128 ~c~~~~~~~~C~~C~~~I~~~~~~~~~~~~~~~~H~~Cf  166 (198)
                      +||.++|+|+|++|++||.+    .+|+|+|+.||++||
T Consensus         1 ~DY~~~fapkC~~C~~~I~g----~~v~Al~~~wHpeCF   35 (35)
T d1x3ha1           1 KDFLAMFSPKCGGCNRPVLE----NYLSAMDTVWHPECF   35 (35)
T ss_dssp             CCCCCCCSCBCTTTCCBCCS----SCEEETTEEECTTTC
T ss_pred             CcHHHHhChhhhhcCCcccc----hheeecCCccCcccC
Confidence            36889999999999999998    789999999999998



>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure