Psyllid ID: psy8181


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-
MSKLYHKFDQEKEVHSTSPPPPPSSPGDNLMIVESPSPSDMVPQPVCKAPTSILENILMRSKAENVQKELRHIPSLNSPPSSPTEMAYSYKKSARYGNLPVSPDSTHQHLHRSVSPVQASEANYPPSGHISLQSGYHSSNGPSIIIQSPPQSNGNYSPPSSSSNIYSQQPPIHHLMTVMPPLQHSFKPSHHSPRSLSPDDGSCGSPLSPNSQGSRGYRSLPYPLKKKDGKMHYECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNKRYISLSGLR
cccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHccccccccccccccccccEcccccccEEEEEEcccccccEccccccccccccHHHcccccccEEEEEEccccccccccccccccccHHHEHHHcccccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHccccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHcccc
msklyhkfdqekevhstspppppsspgdnlmivespspsdmvpqpvckaptsILENILMRSKAENVQKElrhipslnsppssptemaysykksarygnlpvspdsthqhlhrsvspvqaseanyppsghislqsgyhssngpsiiiqsppqsngnysppssssniysqqppihhlmtvmpplqhsfkpshhsprslspddgscgsplspnsqgsrgyrslpyplkkkdgkmhyecNVCYKTFGQLSNLKVHLRthngerpfqcnictKSFTQLAHLQKHhlvhtgekpheciycqkrfsstsnlkthmrlhsgqkpyhcevcparFTQYVHLKLHKrlhtnerpyvckgcnkryislsglr
msklyhkfdqekevhstspppppsspGDNLMIVESPSPSDMVPQPVCKAPTSILENILMRSKAENVQKELrhipslnsppsspTEMAYSYKKSARYGNLPVSPDSTHQHLHRSVSPVQASEANYPPSGHISLQSGYHSSNGPSIIIQSPPQSNGNYSPPSSSSNIYSQQPPIHHLMTVMPPLQHSFKPSHHSPRSLSPDDGSCGSPlspnsqgsrgyrSLPYPLKKKDGKMHYECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKrlhtnerpyvckgcnkryislsglr
MSKLYHKFDQEKEVHSTspppppsspGDNLMIVESPSPSDMVPQPVCKAPTSILENILMRSKAENVQKELRHIPSLNSPPSSPTEMAYSYKKSARYGNLPVSPDSTHQHLHRSVSPVQASEANYPPSGHISLQSGYHSSNGPSIIIqsppqsngnysppssssniysqqppiHHLMTVMPPLQHSFKPSHHSPRSLSPDDGSCGSPLSPNSQGSRGYRSLPYPLKKKDGKMHYECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNKRYISLSGLR
************************************************************************************************************************************************************************************************************************************GKMHYECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNKRYISL****
*****HK*DQEKEVHSTSPPPPPSSPGDNLMIVESPSPSDMVPQPVCKAPTSILENILMR******************PPSSPTEMAYSYKKSARYGNLPVSPDSTHQHLHRSVSPVQASEANYPPSGHISLQSGYHSSNGPSIIIQSPPQSNGNYSPPSSSSNIYSQQPPIHHLMTVMPPLQHSFKPSHHSPRSLSPDDGSCGSPLSPNSQGSRGYRSLPYPLKKKDGKMHYECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNKRYISLS*L*
**************************GDNLMIVESPSPSDMVPQPVCKAPTSILENILMRSKAENVQKELRHIPSLN*********AYSYKKSARYGNLPVS*********************YPPSGHISLQSGYHSSNGPSIIIQSPP****************SQQPPIHHLMTVMPPLQH*******************************GYRSLPYPLKKKDGKMHYECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNKRYISLSGLR
MSKLYHKFDQEKEVHSTSPPPPPSSPGDNLMIVESPSPSDMVPQPVCKAPTSILENILMRSKAENVQKELRHIPSLNSPPSSPTEMAYSYKKSARYGNLPVSPDSTHQHLHRSVSPVQASEANYPPSGHISLQSGYHSSNGPSIIIQSPPQSNGNYSPPSSSSNIYSQQPPIHHLMTVMPPLQHSFKPSHHSPRSLSPDDGSCGSPLSPNSQGSRGYRSLPYPLKKKDGKMHYECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNKRYI******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKLYHKFDQEKEVHSTSPPPPPSSPGDNLMIVESPSPSDMVPQPVCKAPTSILENILMRSKAENVQKELRHIPSLNSPPSSPTEMAYSYKKSARYGNLPVSPDSTHQHLHRSVSPVQASEANYPPSGHISLQSGYHSSNGPSIIIQSPPQSNGNYSPPSSSSNIYSQQPPIHHLMTVMPPLQHSFKPSHHSPRSLSPDDGSCGSPLSPNSQGSRGYRSLPYPLKKKDGKMHYECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNKRYISLSGLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query361 2.2.26 [Sep-21-2011]
Q60636 856 PR domain zinc finger pro yes N/A 0.490 0.206 0.661 6e-66
O75626 825 PR domain zinc finger pro yes N/A 0.493 0.215 0.653 2e-65
Q8IZ20524 Zinc finger protein 683 O no N/A 0.346 0.238 0.641 8e-50
Q96NI8 536 Zinc finger protein 570 O no N/A 0.329 0.222 0.5 2e-33
Q61116 645 Zinc finger protein 235 O no N/A 0.343 0.192 0.443 2e-33
Q9XSR1873 Zinc finger protein 252 O no N/A 0.318 0.131 0.516 3e-33
Q14590 738 Zinc finger protein 235 O no N/A 0.315 0.154 0.478 3e-33
Q9Y2H8683 Zinc finger protein 510 O no N/A 0.357 0.188 0.473 1e-32
Q8NHY6 868 Zinc finger protein 28 ho no N/A 0.329 0.137 0.507 1e-32
Q5R5U3 672 Zinc finger protein 271 O no N/A 0.349 0.187 0.507 2e-32
>sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 Back     alignment and function desciption
 Score =  251 bits (641), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 140/180 (77%), Gaps = 3/180 (1%)

Query: 183 QHSFKPSHHSPRSLSPD-DGSCGSPLSPNSQGSRGYRSLPYPLKKKDGKMHYECNVCYKT 241
           +H  +P   S    +P  DG+    L  N +   GY++LPYPLKK++GK+ YECNVC KT
Sbjct: 557 EHVVQPKATSSVMAAPSTDGAMN--LIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKT 614

Query: 242 FGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECIYCQKRFSST 301
           FGQLSNLKVHLR H+GERPF+C  C K FTQLAHLQKH+LVHTGEKPHEC  C KRFSST
Sbjct: 615 FGQLSNLKVHLRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSST 674

Query: 302 SNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNKRYISLSGLR 361
           SNLKTH+RLHSG+KPY C+VCPA+FTQ+VHLKLHKRLHT ERP+ C  C+K YI L  L+
Sbjct: 675 SNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLHKRLHTRERPHKCAQCHKSYIHLCSLK 734




Transcriptional repressor that binds specifically to the PRDI element in the promoter of the beta-interferon gene. Drives the maturation of B-lymphocytes into Ig secreting cells.
Mus musculus (taxid: 10090)
>sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 Back     alignment and function description
>sp|Q8IZ20|ZN683_HUMAN Zinc finger protein 683 OS=Homo sapiens GN=ZNF683 PE=2 SV=3 Back     alignment and function description
>sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 Back     alignment and function description
>sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 Back     alignment and function description
>sp|Q9XSR1|ZN252_CANFA Zinc finger protein 252 OS=Canis familiaris GN=ZNF252 PE=2 SV=1 Back     alignment and function description
>sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 Back     alignment and function description
>sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 Back     alignment and function description
>sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 Back     alignment and function description
>sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query361
189237878 982 PREDICTED: similar to Blimp-1 CG5249-PA 0.952 0.350 0.519 2e-93
270008250 934 Blimp-1 [Tribolium castaneum] 0.952 0.368 0.519 2e-93
170042691 1035 blimp-1 [Culex quinquefasciatus] gi|1678 0.855 0.298 0.555 1e-92
157137294 1020 zinc finger protein [Aedes aegypti] gi|1 0.844 0.299 0.549 2e-91
157105294 1020 zinc finger protein [Aedes aegypti] gi|1 0.850 0.300 0.552 3e-91
158296119 1029 AGAP006592-PA [Anopheles gambiae str. PE 0.839 0.294 0.533 8e-90
195016603 1250 GH16462 [Drosophila grimshawi] gi|193897 0.778 0.224 0.563 9e-89
195377232 1239 GJ13412 [Drosophila virilis] gi|19415455 0.778 0.226 0.561 1e-88
194867124 1207 GG15278 [Drosophila erecta] gi|190653791 0.778 0.232 0.564 1e-87
195337689 1164 GM14713 [Drosophila sechellia] gi|194128 0.842 0.261 0.556 5e-87
>gi|189237878|ref|XP_001815724.1| PREDICTED: similar to Blimp-1 CG5249-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  348 bits (893), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 210/404 (51%), Positives = 257/404 (63%), Gaps = 60/404 (14%)

Query: 6   HKFDQEKEVHSTSPP-----PPPSSPGDNLMIVESPSPS----------DMVPQPVCKAP 50
           H+ D+E    +  P      P   +P   +++++SP P           ++ PQ V    
Sbjct: 484 HEMDKESHTDAAVPEVTTLTPRIITPPSTVIVIDSPPPEVPNNKPFYEPEVKPQNVISRY 543

Query: 51  T----SILENILMRSKAE-NVQKELRHIPSLNSPPSSPTEMAYSYKKSARYGNLPVSPDS 105
           T    SILENIL+R++ + N     +  P+   PPSSPTEMAYSYKKS RYG +P SPDS
Sbjct: 544 TPPTSSILENILLRNRIDTNNNDNNQRQPNATPPPSSPTEMAYSYKKSHRYGTVPCSPDS 603

Query: 106 T-HQHLHRSVSPVQASEANYPPS-------------GHISLQSGY--HSSNG-------- 141
           + +  +   + P  A   N+PPS              H+   + Y  + SNG        
Sbjct: 604 SSNVQVQNMLPPSPAMLKNHPPSPVQPLYVPHDNYPNHMQPSNYYNIYPSNGIPHSTITS 663

Query: 142 ---PSIIIQSPPQSNG-NYSPPSSSSNIYSQQPPIHHLMTVMPPLQHSFKPSHHSPRSLS 197
               +    +    NG N   P+S  N+       HHL+T +PPLQ S + S   P S S
Sbjct: 664 TPTTTYSPPATHHHNGSNLMIPASHINL------THHLLTPLPPLQTSGRSS---PCSRS 714

Query: 198 PDDGSCGSPLSPNSQGSRGYRSLPYPLKKKDGKMHYECNVCYKTFGQLSNLKVHLRTHNG 257
           P+ GS   P SPN+  +RGYRSLPYPLKKKDGKMHYECNVC KTFGQLSNLKVHLRTH+G
Sbjct: 715 PEGGS---PGSPNTNQNRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSG 771

Query: 258 ERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECIYCQKRFSSTSNLKTHMRLHSGQKPY 317
           ERPF+CN+CTKSFTQLAHLQKHHLVHTGE+PHEC  C+KRFSSTSNLKTH+RLHSGQKPY
Sbjct: 772 ERPFKCNVCTKSFTQLAHLQKHHLVHTGERPHECGICKKRFSSTSNLKTHLRLHSGQKPY 831

Query: 318 HCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNKRYISLSGLR 361
            C+ CPA+FTQ+VHLKLHKRLHTNERPY+C+ C K YIS SGLR
Sbjct: 832 ACDFCPAKFTQFVHLKLHKRLHTNERPYICQECGKNYISASGLR 875




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270008250|gb|EFA04698.1| Blimp-1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170042691|ref|XP_001849050.1| blimp-1 [Culex quinquefasciatus] gi|167866177|gb|EDS29560.1| blimp-1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157137294|ref|XP_001663975.1| zinc finger protein [Aedes aegypti] gi|108869740|gb|EAT33965.1| AAEL013770-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157105294|ref|XP_001648805.1| zinc finger protein [Aedes aegypti] gi|108880149|gb|EAT44374.1| AAEL004255-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|158296119|ref|XP_316619.4| AGAP006592-PA [Anopheles gambiae str. PEST] gi|157016360|gb|EAA11397.4| AGAP006592-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195016603|ref|XP_001984446.1| GH16462 [Drosophila grimshawi] gi|193897928|gb|EDV96794.1| GH16462 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195377232|ref|XP_002047396.1| GJ13412 [Drosophila virilis] gi|194154554|gb|EDW69738.1| GJ13412 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194867124|ref|XP_001972008.1| GG15278 [Drosophila erecta] gi|190653791|gb|EDV51034.1| GG15278 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195337689|ref|XP_002035461.1| GM14713 [Drosophila sechellia] gi|194128554|gb|EDW50597.1| GM14713 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query361
FB|FBgn0035625 1203 Blimp-1 "Blimp-1" [Drosophila 0.681 0.204 0.636 8.8e-94
ZFIN|ZDB-GENE-030131-2193 776 prdm1a "PR domain containing 1 0.429 0.199 0.741 3.7e-68
MGI|MGI:99655 856 Prdm1 "PR domain containing 1, 0.490 0.206 0.661 4.7e-68
UNIPROTKB|O75626 825 PRDM1 "PR domain zinc finger p 0.493 0.215 0.653 7.7e-68
UNIPROTKB|F1RYP9 828 PRDM1 "Uncharacterized protein 0.495 0.216 0.655 9.8e-68
RGD|1311765 824 Prdm1 "PR domain containing 1, 0.490 0.214 0.655 2.6e-67
UNIPROTKB|F1PFR8 822 PRDM1 "Uncharacterized protein 0.493 0.216 0.653 3.3e-67
UNIPROTKB|E1BJ30 828 PRDM1 "Uncharacterized protein 0.493 0.214 0.653 1.4e-64
UNIPROTKB|F1NKI2 812 PRDM1 "Uncharacterized protein 0.493 0.219 0.648 3.3e-63
WB|WBGene00003847 817 blmp-1 [Caenorhabditis elegans 0.426 0.188 0.690 7.8e-62
FB|FBgn0035625 Blimp-1 "Blimp-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 836 (299.3 bits), Expect = 8.8e-94, Sum P(2) = 8.8e-94
 Identities = 161/253 (63%), Positives = 180/253 (71%)

Query:   113 SVSPVQASEANYPPSGHISLQSGYHSSNGPSIIIXXXXXXXXXXXXXXXXXXXXXXXXXX 172
             S SP      +Y  +   +  S  HSS+ P                              
Sbjct:   756 SPSPGYPGYPHYGAAATSTFHSPPHSSHSP--FDRQSNASSGAGSATNLHLLQTSTQMLN 813

Query:   173 HHLMTVMPPLQHSFKPSHHSP-RSLSPDDGSC---GSPLSPNSQGSRGYRSLPYPLKKKD 228
             H LM  + PLQ    P   SP  SLSPD  SC   GSPLSPNS  SRGYRSLPYPLKKKD
Sbjct:   814 HPLMQPLTPLQR-LSPLRISPPSSLSPDGNSCPRSGSPLSPNSLASRGYRSLPYPLKKKD 872

Query:   229 GKMHYECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKP 288
             GKMHYECNVC KTFGQLSNLKVHLRTH+GERPF+CN+CTKSFTQLAHLQKHHLVHTGEKP
Sbjct:   873 GKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKP 932

Query:   289 HECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCK 348
             H+C  C+KRFSSTSNLKTH+RLHSGQKPY C++CP +FTQ+VHLKLHKRLHTN+RPYVC+
Sbjct:   933 HQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQ 992

Query:   349 GCNKRYISLSGLR 361
             GC+K+YIS SGLR
Sbjct:   993 GCDKKYISASGLR 1005


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0035152 "regulation of tube architecture, open tracheal system" evidence=IMP
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0071390 "cellular response to ecdysone" evidence=IEP
GO:0001078 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription" evidence=IDA
ZFIN|ZDB-GENE-030131-2193 prdm1a "PR domain containing 1a, with ZNF domain" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:99655 Prdm1 "PR domain containing 1, with ZNF domain" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O75626 PRDM1 "PR domain zinc finger protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYP9 PRDM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1311765 Prdm1 "PR domain containing 1, with ZNF domain" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PFR8 PRDM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJ30 PRDM1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKI2 PRDM1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00003847 blmp-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O75626PRDM1_HUMANNo assigned EC number0.65360.49300.2157yesN/A
Q60636PRDM1_MOUSENo assigned EC number0.66110.49030.2067yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query361
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 5e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 7e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 2e-04
pfam12756100 pfam12756, zf-C2H2_2, C2H2 type zinc-finger (2 cop 7e-04
COG5151421 COG5151, SSL1, RNA polymerase II transcription ini 0.004
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 39.7 bits (93), Expect = 5e-05
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 247 NLKVHLRTHNGERPFQCNICTKSFTQ 272
           NL+ H+RTH GE+P++C +C KSF+ 
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|221755 pfam12756, zf-C2H2_2, C2H2 type zinc-finger (2 copies) Back     alignment and domain information
>gnl|CDD|227480 COG5151, SSL1, RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 361
KOG2462|consensus279 99.94
KOG2462|consensus279 99.91
KOG3576|consensus267 99.69
KOG1074|consensus 958 99.64
KOG1074|consensus958 99.6
KOG3608|consensus467 99.6
KOG3576|consensus267 99.58
KOG3608|consensus 467 99.53
KOG3623|consensus 1007 99.48
KOG3623|consensus 1007 99.38
PLN03086567 PRLI-interacting factor K; Provisional 99.09
PLN03086567 PRLI-interacting factor K; Provisional 99.02
PHA00733128 hypothetical protein 98.85
PHA0276855 hypothetical protein; Provisional 98.82
PHA00733128 hypothetical protein 98.66
PHA0276855 hypothetical protein; Provisional 98.51
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.5
KOG3993|consensus500 98.36
KOG3993|consensus500 98.27
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.16
PHA0061644 hypothetical protein 98.05
PHA0073279 hypothetical protein 97.8
PHA0073279 hypothetical protein 97.7
PHA0061644 hypothetical protein 97.65
COG5189423 SFP1 Putative transcriptional repressor regulating 97.39
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.33
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.31
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.15
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.0
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.96
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.9
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.88
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.77
PRK04860160 hypothetical protein; Provisional 96.68
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.55
KOG2231|consensus 669 96.48
COG5189423 SFP1 Putative transcriptional repressor regulating 96.42
COG5048467 FOG: Zn-finger [General function prediction only] 96.41
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.27
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.16
smart0035526 ZnF_C2H2 zinc finger. 96.1
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.95
KOG1146|consensus 1406 95.85
COG5048467 FOG: Zn-finger [General function prediction only] 95.26
smart0035526 ZnF_C2H2 zinc finger. 94.89
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 94.72
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.71
PRK04860160 hypothetical protein; Provisional 94.57
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.23
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.28
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 93.19
KOG2231|consensus 669 93.01
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 92.7
COG5236 493 Uncharacterized conserved protein, contains RING Z 92.04
KOG2785|consensus 390 91.81
KOG2482|consensus 423 91.22
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 90.92
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 90.62
KOG2893|consensus 341 90.25
KOG4173|consensus253 89.66
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 87.41
KOG1146|consensus1406 86.39
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 86.02
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 84.67
KOG2893|consensus 341 83.91
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 83.67
KOG2186|consensus 276 83.63
COG404965 Uncharacterized protein containing archaeal-type C 83.56
KOG2482|consensus423 82.13
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 81.65
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 80.8
>KOG2462|consensus Back     alignment and domain information
Probab=99.94  E-value=2.6e-28  Score=226.05  Aligned_cols=130  Identities=33%  Similarity=0.660  Sum_probs=121.6

Q ss_pred             CCcceecCCCcccccChhhHHHHHhhhcC---CCceeCCcccccccchHHHHhhhhhccCCCCccccccccccCChhHHH
Q psy8181         229 GKMHYECNVCYKTFGQLSNLKVHLRTHNG---ERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECIYCQKRFSSTSNLK  305 (361)
Q Consensus       229 ~~k~y~C~~Cgk~F~s~s~L~~H~~~H~~---ek~~~C~~Cgk~F~~~~~L~~H~~~H~gekpf~C~~Cgk~F~s~s~L~  305 (361)
                      ....|+|..|||.+.+..+|.+|.++|-.   .+.+.|.+|++.|.....|.+|+++|+  .+++|.+|||.|.+.+.|+
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQ  204 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQ  204 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhh
Confidence            34569999999999999999999999854   677999999999999999999999997  6799999999999999999


Q ss_pred             HHHhhhcCCCCeeCCCCCcccCChHHHHHHHHHhCCCCCcccCCCCcccCCCCCC
Q psy8181         306 THMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNKRYISLSGL  360 (361)
Q Consensus       306 ~H~r~H~gekpy~C~~Cgk~F~~~s~L~~H~r~H~~eKpYkC~~CgK~F~~~s~L  360 (361)
                      .|+|+|+|||||.|..|+|+|.++++|+.|+++|.+.|.|+|..|+|+|..++.|
T Consensus       205 GHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyL  259 (279)
T KOG2462|consen  205 GHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYL  259 (279)
T ss_pred             cccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999988766



>KOG2462|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query361
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-28
2i13_A 190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-05
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-19
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-18
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-04
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-16
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-16
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 6e-09
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 4e-15
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-14
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 5e-13
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-14
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 6e-14
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-14
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-14
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-14
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 5e-14
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 8e-14
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-13
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-13
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 3e-13
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 4e-13
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-12
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-08
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-11
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 3e-11
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-11
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-07
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 9e-11
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-10
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 3e-10
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 7e-06
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-10
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-09
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 3e-09
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-08
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 3e-04
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 2e-08
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 2e-04
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 4e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 8e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 3e-04
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-06
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 1e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 2e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 4e-04
2ena_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-05
2emc_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-05
2yth_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-05
2yth_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2yti_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-05
2emm_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-05
2enf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-05
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-05
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2eq2_A46 Solution Structure Of The 16th C2h2 Type Zinc Finge 1e-04
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2em6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2eoq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 1e-04
2ytg_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2yu8_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ytn_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2emh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ep2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2emk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2emj_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 4e-04
2ytf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2eoe_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2en1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2eon_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2eq0_A46 Solution Structure Of The 8th C2h2 Type Zinc Finger 7e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 124 bits (310), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 58/132 (43%), Positives = 78/132 (59%) Query: 229 GKMHYECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKP 288 G+ Y C C K+F + +L H RTH GE+P++C C KSF+ L +H HTGEKP Sbjct: 18 GEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKP 77 Query: 289 HECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCK 348 ++C C K FS +NL+ H R H+G+KPY C C F+Q HL+ H+R HT E+PY C Sbjct: 78 YKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCP 137 Query: 349 GCNKRYISLSGL 360 C K + L Sbjct: 138 ECGKSFSREDNL 149
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ENA|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 311- 343) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EMC|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 641- 673) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2YTH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 479- 511) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2YTH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 479- 511) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2YTI|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 564- 596) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EMM|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 544- 576) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2ENF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 340- 372) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EQ2|A Chain A, Solution Structure Of The 16th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EM6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 199- 231) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EOQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 283- 315) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2YTG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 369- 401) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2YU8|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 648- 680) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTN|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 732- 764) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EMH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 491- 523) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EP2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 603- 635) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EMK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 668- 700) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EMJ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 612- 644) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2YTF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 607- 639) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EOE|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 508- 540) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EN1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 563- 595) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EON|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 397- 429) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2EQ0|A Chain A, Solution Structure Of The 8th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query361
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-48
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-47
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-43
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-43
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-45
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-38
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-33
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-29
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-43
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-39
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-34
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-31
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-23
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-43
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-37
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-42
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-32
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-19
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-42
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-38
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-24
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-40
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-36
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-39
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-35
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-27
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-38
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-36
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-27
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-36
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-34
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-25
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-34
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-32
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-24
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-32
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-28
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-19
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-31
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-28
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-24
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-31
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-28
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-23
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-30
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-28
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-22
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-30
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-29
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-22
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-29
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-27
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-27
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-26
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-21
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-15
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-27
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-25
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-23
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-27
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-24
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-21
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-13
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-25
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-23
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-21
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-25
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-23
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-20
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-13
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-24
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-19
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-23
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-21
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-20
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-22
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-22
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-20
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-20
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-20
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-18
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-13
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-19
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-18
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-17
2epa_A72 Krueppel-like factor 10; transforming growth facto 8e-15
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-16
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-13
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-15
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 9e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-15
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-14
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-13
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-12
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-13
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-14
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-13
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-13
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-13
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-14
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-13
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-13
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-14
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-14
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-14
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-13
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-14
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-14
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-12
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-14
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-13
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-10
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-14
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-13
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-13
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-13
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-14
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-14
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-14
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-10
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-14
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-12
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-13
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-14
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-13
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-14
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-13
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-14
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-13
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-14
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-14
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-13
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-13
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-13
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-13
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-13
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-13
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-11
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-13
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-13
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-10
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-13
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-10
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-12
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-13
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-13
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-13
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-12
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 7e-12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 8e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-12
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-12
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-12
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-11
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 8e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-10
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 6e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 7e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 8e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 9e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 5e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 9e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 6e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 2e-06
1ard_A29 Yeast transcription factor ADR1; transcription reg 7e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 2e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 3e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 5e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 4e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 4e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 5e-05
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-04
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 2e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 5e-04
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 7e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  160 bits (408), Expect = 3e-48
 Identities = 57/129 (44%), Positives = 76/129 (58%)

Query: 233 YECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQLAHLQKHHLVHTGEKPHECI 292
           Y C  C K+F +  +L  H RTH GE+P++C  C KSF+    L +H   HTGEKP++C 
Sbjct: 22  YACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCP 81

Query: 293 YCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNK 352
            C K FS  +NL+ H R H+G+KPY C  C   F+Q  HL+ H+R HT E+PY C  C K
Sbjct: 82  ECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGK 141

Query: 353 RYISLSGLR 361
            +     L 
Sbjct: 142 SFSREDNLH 150


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query361
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.9
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.9
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.87
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.87
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.87
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.84
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.83
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.8
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.77
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.74
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.74
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.74
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.72
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.72
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.71
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.7
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.7
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.69
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.68
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.68
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.68
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.67
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.65
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.64
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.63
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.62
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.61
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.6
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.6
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.59
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.55
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.53
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.53
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.52
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.52
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.51
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.51
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.5
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.48
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.48
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.48
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.47
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.45
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.44
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.42
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.42
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.41
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.39
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.38
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.35
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.34
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.32
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.32
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.32
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.31
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.31
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.29
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.28
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.28
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.27
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.27
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.26
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.26
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.25
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.23
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.22
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.19
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.18
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.17
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.15
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.14
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.01
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.0
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.0
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.98
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.97
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.97
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.96
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.95
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.94
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.94
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.94
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.94
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.94
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.93
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.92
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.92
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.91
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.91
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.91
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.9
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.89
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.88
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.88
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.87
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.86
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.86
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.83
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.8
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.8
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.79
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.79
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.78
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.78
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.78
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.78
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.78
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.78
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.77
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.77
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.77
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.77
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.75
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.75
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.75
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.75
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.74
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.74
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.73
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.72
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.72
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.72
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.7
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.7
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.69
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.69
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.69
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.67
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.67
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.66
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.64
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.64
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.64
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.63
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.63
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.6
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.59
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.56
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.52
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.52
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.51
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.46
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.44
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.43
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.41
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.33
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.3
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.27
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.26
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.17
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.12
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.1
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.09
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.09
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.09
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.09
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.08
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.07
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.03
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.0
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.98
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.98
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.97
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.97
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.97
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.95
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.95
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.94
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.93
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.93
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.92
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.9
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.89
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.87
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.87
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.86
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.06
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.84
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.05
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.83
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.78
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.78
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.76
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.74
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.69
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.66
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.65
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.63
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.63
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.61
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.59
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.74
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.55
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.53
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.52
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.51
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.48
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.47
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.56
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.43
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.54
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.42
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.4
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.37
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.34
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.26
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.15
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.89
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.59
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.15
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.85
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.75
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.51
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.97
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.93
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 92.48
2e72_A49 POGO transposable element with ZNF domain; zinc fi 84.62
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 82.53
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 80.24
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.96  E-value=1.4e-30  Score=231.26  Aligned_cols=160  Identities=38%  Similarity=0.734  Sum_probs=136.9

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCcceecCCCcccccChhhHHHHHhhhcCCCceeCCcccccccch
Q psy8181         194 RSLSPDDGSCGSPLSPNSQGSRGYRSLPYPLKKKDGKMHYECNVCYKTFGQLSNLKVHLRTHNGERPFQCNICTKSFTQL  273 (361)
Q Consensus       194 ~s~s~~c~~C~~~f~~~s~l~~h~~sl~~h~k~~~~~k~y~C~~Cgk~F~s~s~L~~H~~~H~~ek~~~C~~Cgk~F~~~  273 (361)
                      +...+.|..|+..|.....|.       .|++.+.++++|.|..|++.|.....|..|++.|+++++|.|..|++.|...
T Consensus        18 ~~~~~~C~~C~~~f~~~~~l~-------~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~   90 (190)
T 2i13_A           18 GEKPYACPECGKSFSRSDHLA-------EHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQR   90 (190)
T ss_dssp             -------------CCSSHHHH-------HGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCH
T ss_pred             CCCCCcCCCCccccCCHHHHH-------HHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCH
Confidence            345689999999998877644       4557788899999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhhhccCCCCccccccccccCChhHHHHHHhhhcCCCCeeCCCCCcccCChHHHHHHHHHhCCCCCcccCCCCcc
Q psy8181         274 AHLQKHHLVHTGEKPHECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLHTNERPYVCKGCNKR  353 (361)
Q Consensus       274 ~~L~~H~~~H~gekpf~C~~Cgk~F~s~s~L~~H~r~H~gekpy~C~~Cgk~F~~~s~L~~H~r~H~~eKpYkC~~CgK~  353 (361)
                      ..|..|++.|+++++|.|..|++.|.....|..|+++|+++++|.|..|++.|.....|..|+++|+++++|+|.+|++.
T Consensus        91 ~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~  170 (190)
T 2i13_A           91 ANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKS  170 (190)
T ss_dssp             HHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCE
T ss_pred             HHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCC
Q psy8181         354 YISLSGL  360 (361)
Q Consensus       354 F~~~s~L  360 (361)
                      |.+...|
T Consensus       171 f~~~~~L  177 (190)
T 2i13_A          171 FSRRDAL  177 (190)
T ss_dssp             ESSHHHH
T ss_pred             cCCHHHH
Confidence            9987665



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 361
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 5e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-11
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-09
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-09
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-08
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 5e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-07
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 7e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 5e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 8e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 4e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 4e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.004
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 8e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 8e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 3e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 6e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.001
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 6e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.002
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 0.001
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 0.003
d2dmda226 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {H 0.003
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 54.5 bits (132), Expect = 5e-11
 Identities = 16/32 (50%), Positives = 23/32 (71%)

Query: 282 VHTGEKPHECIYCQKRFSSTSNLKTHMRLHSG 313
           +H+GEKP+ C+ C K FS +S L  H R+H+G
Sbjct: 1   IHSGEKPYGCVECGKAFSRSSILVQHQRVHTG 32


>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query361
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.45
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.31
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.0
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.96
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.89
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.83
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.81
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.76
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.74
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.72
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.7
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.69
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.67
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.66
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.64
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.62
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.59
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.59
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.52
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.46
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.44
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.43
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.42
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.41
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.37
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.36
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.32
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.32
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.28
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.13
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.09
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.03
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.01
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.0
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.0
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.86
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.74
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.73
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.7
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.68
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.68
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.53
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.5
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.36
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.35
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.25
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.19
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.06
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.0
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.0
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.96
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.91
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.7
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.64
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.64
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.59
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.33
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.31
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.31
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.26
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.22
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.91
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.77
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.67
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.67
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.64
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.63
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.61
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.48
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.47
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.21
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.94
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.93
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.52
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.4
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 94.34
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.82
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 93.78
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.75
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.7
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.3
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.23
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.12
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.78
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.69
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.98
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.73
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.39
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 90.67
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 90.06
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 89.58
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 89.45
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.21
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.13
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 89.01
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 88.32
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 87.62
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 86.93
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 86.59
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 86.43
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.3
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 86.23
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 86.09
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 86.05
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 82.86
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 82.68
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 81.27
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 80.81
d1y0jb136 U-shaped transcription factor, different fingers { 80.11
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.45  E-value=2.1e-14  Score=100.77  Aligned_cols=53  Identities=38%  Similarity=0.757  Sum_probs=47.9

Q ss_pred             CCCccccccccccCChhHHHHHHhhhcCCCCeeCCCCCcccCChHHHHHHHHHh
Q psy8181         286 EKPHECIYCQKRFSSTSNLKTHMRLHSGQKPYHCEVCPARFTQYVHLKLHKRLH  339 (361)
Q Consensus       286 ekpf~C~~Cgk~F~s~s~L~~H~r~H~gekpy~C~~Cgk~F~~~s~L~~H~r~H  339 (361)
                      |++|.| .||+.|.....|..|+++|+|+++|.|.+||++|...+.|..|+++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            578999 49999999999999999999999999999999999999999999887



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure