Psyllid ID: psy8220
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 161 | ||||||
| 194900518 | 581 | GG16794 [Drosophila erecta] gi|190651507 | 0.801 | 0.222 | 0.465 | 3e-22 | |
| 21428328 | 581 | AT23067p [Drosophila melanogaster] | 0.801 | 0.222 | 0.465 | 3e-22 | |
| 28572990 | 581 | nucleostemin 1 [Drosophila melanogaster] | 0.801 | 0.222 | 0.465 | 3e-22 | |
| 195349203 | 581 | GM15388 [Drosophila sechellia] gi|194122 | 0.801 | 0.222 | 0.465 | 3e-22 | |
| 195500114 | 581 | GE26110 [Drosophila yakuba] gi|194183337 | 0.801 | 0.222 | 0.465 | 3e-22 | |
| 194742485 | 581 | GF17911 [Drosophila ananassae] gi|190626 | 0.826 | 0.228 | 0.471 | 4e-22 | |
| 195451637 | 579 | GK13906 [Drosophila willistoni] gi|19416 | 0.826 | 0.229 | 0.471 | 5e-22 | |
| 195151599 | 583 | GL21923 [Drosophila persimilis] gi|19411 | 0.801 | 0.221 | 0.458 | 3e-21 | |
| 198453139 | 583 | GA26447 [Drosophila pseudoobscura pseudo | 0.801 | 0.221 | 0.458 | 3e-21 | |
| 195394346 | 581 | GJ10591 [Drosophila virilis] gi|19414251 | 0.826 | 0.228 | 0.443 | 5e-21 |
| >gi|194900518|ref|XP_001979804.1| GG16794 [Drosophila erecta] gi|190651507|gb|EDV48762.1| GG16794 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
Score = 109 bits (273), Expect = 3e-22, Method: Compositional matrix adjust.
Identities = 68/146 (46%), Positives = 86/146 (58%), Gaps = 17/146 (11%)
Query: 19 RSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPG-KKLVIVINKAGK-PSTKIQSGSM 76
R V+E ADV+LEVVDARDP+GTRC E V G PG K+LV+V+NKA P + +
Sbjct: 145 RKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRDNLNN--- 201
Query: 77 AQIFQTWIPYNSIQSIYSSPRFSSRSQKDAQTERDL------KAINVSSCVGAELLMLLL 130
WI Y ++ + S++ Q + R L KA+ S C+GAELLM +L
Sbjct: 202 ------WIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAELLMSML 255
Query: 131 GNYTRNKDIKTSITVGVVGECNIAGS 156
GNY RNK IKTSI VGVVG N+ S
Sbjct: 256 GNYCRNKGIKTSIRVGVVGIPNVGKS 281
|
Source: Drosophila erecta Species: Drosophila erecta Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|21428328|gb|AAM49824.1| AT23067p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|28572990|ref|NP_732199.2| nucleostemin 1 [Drosophila melanogaster] gi|62510652|sp|Q8MT06.2|GNL3_DROME RecName: Full=Guanine nucleotide-binding protein-like 3 homolog; AltName: Full=Nucleostemin 1; AltName: Full=Nucleostemin homolog gi|28381326|gb|AAF55384.3| nucleostemin 1 [Drosophila melanogaster] gi|212287978|gb|ACJ23464.1| FI08004p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195349203|ref|XP_002041136.1| GM15388 [Drosophila sechellia] gi|194122741|gb|EDW44784.1| GM15388 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195500114|ref|XP_002097236.1| GE26110 [Drosophila yakuba] gi|194183337|gb|EDW96948.1| GE26110 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194742485|ref|XP_001953733.1| GF17911 [Drosophila ananassae] gi|190626770|gb|EDV42294.1| GF17911 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195451637|ref|XP_002073011.1| GK13906 [Drosophila willistoni] gi|194169096|gb|EDW83997.1| GK13906 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195151599|ref|XP_002016726.1| GL21923 [Drosophila persimilis] gi|194111783|gb|EDW33826.1| GL21923 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|198453139|ref|XP_002137602.1| GA26447 [Drosophila pseudoobscura pseudoobscura] gi|198132227|gb|EDY68160.1| GA26447 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195394346|ref|XP_002055806.1| GJ10591 [Drosophila virilis] gi|194142515|gb|EDW58918.1| GJ10591 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 161 | ||||||
| FB|FBgn0038473 | 581 | ns1 "nucleostemin 1" [Drosophi | 0.838 | 0.232 | 0.457 | 1.4e-21 | |
| ZFIN|ZDB-GENE-040723-1 | 571 | gnl3l "guanine nucleotide bind | 0.844 | 0.238 | 0.428 | 1.2e-19 | |
| WB|WBGene00003821 | 556 | nst-1 [Caenorhabditis elegans | 0.795 | 0.230 | 0.394 | 1.2e-16 | |
| UNIPROTKB|Q21086 | 556 | nst-1 "Guanine nucleotide-bind | 0.795 | 0.230 | 0.394 | 1.2e-16 | |
| UNIPROTKB|A8IVS6 | 380 | CHLREDRAFT_116921 "Predicted p | 0.279 | 0.118 | 0.478 | 7.7e-16 | |
| TAIR|locus:2077587 | 582 | NSN1 "AT3G07050" [Arabidopsis | 0.267 | 0.073 | 0.568 | 7.7e-16 | |
| UNIPROTKB|Q5ZCV4 | 591 | B1111C09.2 "Uncharacterized pr | 0.826 | 0.225 | 0.347 | 2.6e-14 | |
| UNIPROTKB|F1RUG1 | 574 | LOC100521120 "Uncharacterized | 0.832 | 0.233 | 0.380 | 4e-14 | |
| UNIPROTKB|K7GPE3 | 575 | LOC100521120 "Uncharacterized | 0.832 | 0.233 | 0.380 | 4e-14 | |
| UNIPROTKB|F1PAW6 | 649 | GNL3L "Uncharacterized protein | 0.832 | 0.206 | 0.373 | 5e-14 |
| FB|FBgn0038473 ns1 "nucleostemin 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 260 (96.6 bits), Expect = 1.4e-21, P = 1.4e-21
Identities = 64/140 (45%), Positives = 81/140 (57%)
Query: 19 RSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPG-KKLVIVINKAGK-PSTKIQSGSM 76
R V+E ADV+LEVVDARDP+GTRC E V G PG K+LV+V+NKA P + +
Sbjct: 145 RKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLNN--W 202
Query: 77 AQIFQTWIPYNXXXXXXXXXXXXXXXXKDAQTERDLKAINVSSCVGAELLMLLLGNYTRN 136
+ F+ P K + + + KA+ S C+GAELLM +LGNY RN
Sbjct: 203 IKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTE-KAMQGSVCIGAELLMSMLGNYCRN 261
Query: 137 KDIKTSITVGVVGECNIAGS 156
K IKTSI VGVVG N+ S
Sbjct: 262 KGIKTSIRVGVVGIPNVGKS 281
|
|
| ZFIN|ZDB-GENE-040723-1 gnl3l "guanine nucleotide binding protein-like 3 (nucleolar)-like" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003821 nst-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q21086 nst-1 "Guanine nucleotide-binding protein-like 3 homolog" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8IVS6 CHLREDRAFT_116921 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2077587 NSN1 "AT3G07050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZCV4 B1111C09.2 "Uncharacterized protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RUG1 LOC100521120 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GPE3 LOC100521120 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PAW6 GNL3L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 161 | |||
| cd04178 | 171 | cd04178, Nucleostemin_like, A circularly permuted | 7e-29 | |
| cd01859 | 157 | cd01859, MJ1464, An uncharacterized, circularly pe | 8e-12 | |
| cd01858 | 157 | cd01858, NGP_1, A novel nucleolar GTP-binding prot | 2e-11 | |
| cd01849 | 146 | cd01849, YlqF_related_GTPase, Circularly permuted | 2e-10 | |
| COG1161 | 322 | COG1161, COG1161, Predicted GTPases [General funct | 6e-10 | |
| cd01857 | 140 | cd01857, HSR1_MMR1, A circularly permuted subfamil | 2e-07 | |
| cd01856 | 171 | cd01856, YlqF, Circularly permuted YlqF GTPase | 8e-04 | |
| TIGR03596 | 276 | TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi | 0.001 | |
| PRK09563 | 287 | PRK09563, rbgA, GTPase YlqF; Reviewed | 0.002 |
| >gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
Score = 103 bits (260), Expect = 7e-29
Identities = 56/134 (41%), Positives = 72/134 (53%), Gaps = 21/134 (15%)
Query: 26 DVILEVVDARDPMGTRCKVAEDLVVGT-PGKKLVIVINKAGK-PSTKIQSGSMAQIFQTW 83
DVILEV+DARDP+G RC E V+ P KKLV+V+NK P + + W
Sbjct: 1 DVILEVLDARDPLGCRCPQVERAVLVLGPNKKLVLVLNKIDLVPK---------ENVEKW 51
Query: 84 IPYNSIQ--------SIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTR 135
+ Y + S + SR K + DL + S+C+GA+ L+ LL NY R
Sbjct: 52 LKYLRNEFPTVAFKASTQQQKKNLSRKSKKVKASDDLLS--SSACLGADALLKLLKNYAR 109
Query: 136 NKDIKTSITVGVVG 149
NK IKTSITVGVVG
Sbjct: 110 NKGIKTSITVGVVG 123
|
Nucleostemin (NS) is a nucleolar protein that functions as a regulator of cell growth and proliferation in stem cells and in several types of cancer cells, but is not expressed in the differentiated cells of most mammalian adult tissues. NS shuttles between the nucleolus and nucleoplasm bidirectionally at a rate that is fast and independent of cell type. Lowering GTP levels decreases the nucleolar retention of NS, and expression of NS is abruptly down-regulated during differentiation prior to terminal cell division. Found only in eukaryotes, NS consists of an N-terminal basic domain, a coiled-coil domain, a GTP-binding domain, an intermediate domain, and a C-terminal acidic domain. Experimental evidence indicates that NS uses its GTP-binding property as a molecular switch to control the transition between the nucleolus and nucleoplasm, and this process involves interaction between the basic, GTP-binding, and intermediate domains of the protein. Length = 171 |
| >gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206751 cd01858, NGP_1, A novel nucleolar GTP-binding protein, circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| KOG2484|consensus | 435 | 99.95 | ||
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 99.93 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 99.93 | |
| KOG2423|consensus | 572 | 99.93 | ||
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 99.92 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 99.91 | |
| COG1161 | 322 | Predicted GTPases [General function prediction onl | 99.91 | |
| KOG1424|consensus | 562 | 99.9 | ||
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 99.9 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 99.9 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 99.89 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 99.87 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 99.86 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 99.83 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 99.8 | |
| KOG2485|consensus | 335 | 99.79 | ||
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 99.79 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 99.76 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 99.75 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 99.74 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 99.73 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 99.73 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 99.67 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 99.65 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 99.63 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 99.63 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 99.56 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 99.49 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 99.4 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 99.39 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 99.39 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 99.25 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 99.24 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 99.17 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 99.16 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 99.14 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 99.12 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 99.11 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 99.1 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 99.1 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 99.09 | |
| PRK15467 | 158 | ethanolamine utilization protein EutP; Provisional | 99.08 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 99.08 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 99.08 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 99.07 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 99.06 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 99.04 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 99.04 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 99.03 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 99.02 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 99.02 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 99.0 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 98.98 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 98.97 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 98.96 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 98.96 | |
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 98.95 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 98.95 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 98.94 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 98.94 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 98.94 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 98.93 | |
| CHL00071 | 409 | tufA elongation factor Tu | 98.91 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 98.91 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 98.91 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 98.9 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 98.89 | |
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 98.88 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 98.88 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 98.87 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 98.87 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 98.87 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 98.87 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 98.86 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 98.85 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 98.85 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 98.83 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 98.83 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 98.83 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 98.83 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 98.82 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 98.82 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 98.82 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 98.82 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 98.82 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 98.81 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 98.81 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 98.79 | |
| PRK13768 | 253 | GTPase; Provisional | 98.79 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 98.79 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 98.79 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 98.78 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 98.78 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 98.77 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 98.77 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 98.77 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 98.76 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 98.76 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 98.76 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 98.73 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 98.73 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 98.73 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 98.73 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 98.73 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 98.72 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 98.72 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 98.72 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 98.72 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 98.71 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 98.71 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 98.7 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 98.69 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 98.69 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 98.68 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 98.68 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 98.68 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 98.67 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 98.67 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 98.67 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 98.67 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 98.67 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 98.66 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 98.66 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 98.65 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 98.65 | |
| PTZ00099 | 176 | rab6; Provisional | 98.65 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 98.65 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 98.65 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 98.65 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 98.64 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 98.64 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 98.64 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 98.64 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 98.64 | |
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 98.63 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 98.63 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 98.63 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 98.63 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 98.63 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 98.63 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 98.62 | |
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 98.62 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 98.62 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 98.61 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 98.61 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 98.61 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 98.61 | |
| KOG1489|consensus | 366 | 98.59 | ||
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 98.59 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 98.59 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 98.58 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 98.58 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 98.58 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 98.58 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 98.58 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 98.57 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 98.57 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 98.57 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 98.56 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 98.56 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 98.55 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 98.55 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 98.55 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 98.53 | |
| TIGR00437 | 591 | feoB ferrous iron transporter FeoB. FeoB (773 amin | 98.53 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 98.53 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 98.52 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 98.52 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 98.52 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 98.51 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 98.51 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 98.51 | |
| COG0536 | 369 | Obg Predicted GTPase [General function prediction | 98.51 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 98.51 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 98.51 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 98.51 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 98.5 | |
| cd01871 | 174 | Rac1_like Rac1-like subfamily. The Rac1-like subfa | 98.5 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 98.5 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 98.5 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 98.5 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 98.49 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 98.48 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 98.48 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 98.47 | |
| KOG1423|consensus | 379 | 98.47 | ||
| PRK00007 | 693 | elongation factor G; Reviewed | 98.45 | |
| KOG0462|consensus | 650 | 98.45 | ||
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 98.44 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 98.43 | |
| PLN03118 | 211 | Rab family protein; Provisional | 98.43 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 98.43 | |
| smart00176 | 200 | RAN Ran (Ras-related nuclear proteins) /TC4 subfam | 98.41 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 98.4 | |
| KOG1145|consensus | 683 | 98.4 | ||
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 98.4 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 98.4 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 98.4 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 98.39 | |
| COG2229 | 187 | Predicted GTPase [General function prediction only | 98.38 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 98.38 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 98.37 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 98.37 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 98.37 | |
| cd01875 | 191 | RhoG RhoG subfamily. RhoG is a GTPase with high se | 98.36 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 98.36 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 98.35 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 98.35 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 98.34 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 98.34 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 98.34 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 98.33 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 98.33 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 98.32 | |
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 98.32 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 98.31 | |
| PLN03108 | 210 | Rab family protein; Provisional | 98.29 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 98.28 | |
| COG4917 | 148 | EutP Ethanolamine utilization protein [Amino acid | 98.28 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 98.28 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 98.27 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 98.27 | |
| KOG1191|consensus | 531 | 98.26 | ||
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 98.26 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 98.25 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 98.25 | |
| COG3276 | 447 | SelB Selenocysteine-specific translation elongatio | 98.25 | |
| cd01873 | 195 | RhoBTB RhoBTB subfamily. Members of the RhoBTB sub | 98.25 | |
| COG0370 | 653 | FeoB Fe2+ transport system protein B [Inorganic io | 98.24 | |
| cd04133 | 176 | Rop_like Rop subfamily. The Rop (Rho-related prote | 98.23 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 98.23 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 98.22 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 98.21 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 98.2 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 98.2 | |
| cd04131 | 178 | Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 | 98.19 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 98.18 | |
| COG5257 | 415 | GCD11 Translation initiation factor 2, gamma subun | 98.17 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 98.15 | |
| cd01896 | 233 | DRG The developmentally regulated GTP-binding prot | 98.13 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 98.1 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 98.09 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 98.05 | |
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 98.03 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 98.03 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 98.01 | |
| cd04103 | 158 | Centaurin_gamma Centaurin gamma. The centaurins (a | 98.01 | |
| KOG0076|consensus | 197 | 98.0 | ||
| KOG0075|consensus | 186 | 97.98 | ||
| KOG0092|consensus | 200 | 97.94 | ||
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 97.92 | |
| KOG0078|consensus | 207 | 97.92 | ||
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 97.89 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 97.88 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 97.87 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 97.84 | |
| KOG0073|consensus | 185 | 97.82 | ||
| PTZ00416 | 836 | elongation factor 2; Provisional | 97.77 | |
| KOG1423|consensus | 379 | 97.75 | ||
| KOG0461|consensus | 522 | 97.74 | ||
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 97.72 | |
| KOG0410|consensus | 410 | 97.72 | ||
| PF06858 | 58 | NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte | 97.69 | |
| KOG1249|consensus | 572 | 97.68 | ||
| KOG0094|consensus | 221 | 97.66 | ||
| TIGR02836 | 492 | spore_IV_A stage IV sporulation protein A. A compa | 97.63 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 97.62 | |
| KOG1191|consensus | 531 | 97.6 | ||
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 97.59 | |
| KOG0084|consensus | 205 | 97.52 | ||
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 97.5 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 97.49 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 97.47 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 97.45 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 97.44 | |
| KOG0072|consensus | 182 | 97.43 | ||
| COG1084 | 346 | Predicted GTPase [General function prediction only | 97.42 | |
| COG3596 | 296 | Predicted GTPase [General function prediction only | 97.42 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 97.4 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 97.4 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 97.39 | |
| cd01899 | 318 | Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg | 97.38 | |
| KOG0468|consensus | 971 | 97.37 | ||
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 97.34 | |
| COG0536 | 369 | Obg Predicted GTPase [General function prediction | 97.33 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 97.33 | |
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 97.32 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 97.31 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 97.29 | |
| KOG0093|consensus | 193 | 97.27 | ||
| KOG1144|consensus | 1064 | 97.23 | ||
| KOG0070|consensus | 181 | 97.21 | ||
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 97.2 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 97.18 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 97.16 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 97.15 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 97.14 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 97.11 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 97.08 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 97.07 | |
| KOG1532|consensus | 366 | 97.03 | ||
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 97.03 | |
| cd01852 | 196 | AIG1 AIG1 (avrRpt2-induced gene 1). This represent | 96.97 | |
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 96.95 | |
| cd04102 | 202 | RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove | 96.93 | |
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 96.8 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 96.78 | |
| KOG1490|consensus | 620 | 96.75 | ||
| cd01850 | 276 | CDC_Septin CDC/Septin. Septins are a conserved fam | 96.75 | |
| PF00350 | 168 | Dynamin_N: Dynamin family; InterPro: IPR001401 Mem | 96.75 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 96.59 | |
| KOG1489|consensus | 366 | 96.58 | ||
| KOG1490|consensus | 620 | 96.57 | ||
| PRK09602 | 396 | translation-associated GTPase; Reviewed | 96.55 | |
| KOG0095|consensus | 213 | 96.54 | ||
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 96.54 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 96.46 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 96.46 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 96.42 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 96.42 | |
| KOG0466|consensus | 466 | 96.38 | ||
| KOG0410|consensus | 410 | 96.36 | ||
| KOG0098|consensus | 216 | 96.34 | ||
| PF05049 | 376 | IIGP: Interferon-inducible GTPase (IIGP); InterPro | 96.25 | |
| KOG0087|consensus | 222 | 96.25 | ||
| KOG0083|consensus | 192 | 96.25 | ||
| KOG0071|consensus | 180 | 96.21 | ||
| PLN00023 | 334 | GTP-binding protein; Provisional | 96.19 | |
| KOG0088|consensus | 218 | 96.16 | ||
| COG5258 | 527 | GTPBP1 GTPase [General function prediction only] | 96.14 | |
| KOG0395|consensus | 196 | 96.04 | ||
| PRK05439 | 311 | pantothenate kinase; Provisional | 96.03 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 95.95 | |
| KOG0394|consensus | 210 | 95.81 | ||
| TIGR00993 | 763 | 3a0901s04IAP86 chloroplast protein import componen | 95.78 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 95.75 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 95.73 | |
| KOG1486|consensus | 364 | 95.73 | ||
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 95.72 | |
| KOG0458|consensus | 603 | 95.6 | ||
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 95.6 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 95.42 | |
| KOG0079|consensus | 198 | 95.4 | ||
| cd03112 | 158 | CobW_like The function of this protein family is u | 95.37 | |
| smart00275 | 342 | G_alpha G protein alpha subunit. Subunit of G prot | 95.37 | |
| KOG0081|consensus | 219 | 95.31 | ||
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 95.26 | |
| COG3596 | 296 | Predicted GTPase [General function prediction only | 95.2 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 95.19 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 95.17 | |
| cd00066 | 317 | G-alpha G protein alpha subunit. The alpha subunit | 95.16 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 95.03 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 94.8 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 94.75 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 94.58 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 94.51 | |
| KOG1547|consensus | 336 | 94.5 | ||
| COG0523 | 323 | Putative GTPases (G3E family) [General function pr | 94.38 | |
| KOG2486|consensus | 320 | 94.36 | ||
| KOG0467|consensus | 887 | 94.3 | ||
| PLN02200 | 234 | adenylate kinase family protein | 94.11 | |
| KOG1487|consensus | 358 | 94.1 | ||
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 94.09 | |
| KOG0054|consensus | 1381 | 94.0 | ||
| PRK14974 | 336 | cell division protein FtsY; Provisional | 93.99 | |
| KOG0077|consensus | 193 | 93.81 | ||
| PRK05428 | 308 | HPr kinase/phosphorylase; Provisional | 93.78 | |
| KOG2486|consensus | 320 | 93.77 | ||
| KOG1143|consensus | 591 | 93.66 | ||
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 93.44 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 93.41 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 93.29 | |
| KOG2004|consensus | 906 | 93.29 | ||
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 93.28 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 93.13 | |
| KOG1954|consensus | 532 | 93.01 | ||
| KOG1707|consensus | 625 | 92.92 | ||
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 92.91 | |
| KOG0460|consensus | 449 | 92.89 | ||
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.85 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 92.84 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 92.82 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 92.76 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 92.72 | |
| KOG0074|consensus | 185 | 92.72 | ||
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 92.6 | |
| PF04670 | 232 | Gtr1_RagA: Gtr1/RagA G protein conserved region; I | 92.55 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 92.45 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 92.37 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 92.3 | |
| TIGR00679 | 304 | hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene | 92.21 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 92.08 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.04 | |
| KOG0057|consensus | 591 | 91.97 | ||
| KOG0781|consensus | 587 | 91.94 | ||
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 91.7 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 91.63 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 91.48 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 91.46 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 91.27 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 91.2 | |
| KOG0086|consensus | 214 | 91.07 | ||
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 91.04 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 90.92 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 90.73 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 90.68 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 90.56 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 90.48 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 90.43 | |
| cd03110 | 179 | Fer4_NifH_child This protein family's function is | 90.34 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 90.34 | |
| KOG2749|consensus | 415 | 90.33 | ||
| PF05049 | 376 | IIGP: Interferon-inducible GTPase (IIGP); InterPro | 90.33 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 90.29 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 90.25 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 90.18 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 90.13 | |
| KOG0090|consensus | 238 | 89.83 | ||
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 89.75 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 89.7 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 89.66 | |
| PLN02199 | 303 | shikimate kinase | 89.6 | |
| KOG0097|consensus | 215 | 89.53 | ||
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 89.45 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 89.44 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 89.4 | |
| KOG3905|consensus | 473 | 89.37 | ||
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 89.29 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 89.13 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 89.07 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 88.96 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 88.86 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 88.85 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 88.83 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 88.8 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 88.74 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 88.71 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 88.7 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 88.69 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 88.64 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 88.64 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 88.64 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 88.55 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 88.52 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 88.52 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 88.5 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 88.49 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 88.49 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 88.45 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 88.4 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 88.36 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 88.35 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 88.35 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 88.31 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 88.28 | |
| PRK06526 | 254 | transposase; Provisional | 88.25 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 88.17 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 88.16 | |
| KOG0066|consensus | 807 | 88.04 | ||
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 88.01 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 87.99 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 87.98 | |
| PHA02624 | 647 | large T antigen; Provisional | 87.91 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 87.88 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 87.86 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 87.81 | |
| KOG4658|consensus | 889 | 87.8 | ||
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 87.79 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 87.78 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 87.78 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 87.76 | |
| PF00519 | 432 | PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 | 87.68 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 87.65 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 87.6 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 87.59 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 87.58 | |
| COG1493 | 308 | HprK Serine kinase of the HPr protein, regulates c | 87.58 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 87.56 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 87.55 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 87.53 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 87.51 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 87.49 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 87.42 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 87.39 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 87.3 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 87.28 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 87.27 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 87.18 | |
| PHA02774 | 613 | E1; Provisional | 87.09 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 87.08 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 87.02 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 86.98 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 86.95 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 86.94 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 86.89 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 86.82 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 86.75 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 86.75 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 86.71 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 86.69 |
| >KOG2484|consensus | Back alignment and domain information |
|---|
Probab=99.95 E-value=5.2e-28 Score=193.55 Aligned_cols=137 Identities=39% Similarity=0.621 Sum_probs=118.4
Q ss_pred hHHHHHHHHHHHhhhccEEEEEEeCCCCCCCCcHHHHHHHhCC-CCCcEEEEeecCCCCCcccccccHHHHHHHHhhhhc
Q psy8220 10 RGVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGT-PGKKLVIVINKAGKPSTKIQSGSMAQIFQTWIPYNS 88 (161)
Q Consensus 10 ~~~~~~~~~~~~i~~aDviL~VvD~~~~~~~~~~~i~~~l~~~-~~k~~ilVlNK~Dl~~~~~~~~~~~~~~~~~~~~~~ 88 (161)
..++.+++ ++.++.+||||+|+|||+|+++.+.++++.+... +++.+|+|+||+||+|. +.++.|..|++
T Consensus 133 ~kaY~ke~-rkvve~sDVVleVlDARDPlgtR~~~vE~~V~~~~gnKkLILVLNK~DLVPr--------Ev~e~Wl~YLr 203 (435)
T KOG2484|consen 133 KKAYDKEF-RKVVEASDVVLEVLDARDPLGTRCPEVEEAVLQAHGNKKLILVLNKIDLVPR--------EVVEKWLVYLR 203 (435)
T ss_pred HHHHHHHH-HHHHhhhheEEEeeeccCCCCCCChhHHHHHHhccCCceEEEEeehhccCCH--------HHHHHHHHHHH
Confidence 44788888 8999999999999999999999999999988542 45999999999999998 88899999998
Q ss_pred cCCCCceeEEeecCCCCcchhhhhhhhccccccCHHHHHHHHHhHhhcCCCCCceEEEEEeecCCCcccccC
Q psy8220 89 IQSIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTRNKDIKTSITVGVVGECNIAGSIRDL 160 (161)
Q Consensus 89 ~~~~~~~i~iSa~~~~~~~~~~~~~~~~~~~~~g~~~L~~~l~~~~~~~~~~~~~~v~vvG~pNVGKSsl~~ 160 (161)
..+|.++|-|.++.++.+ ....+.+.+.|.+.|++.|.+|......++.|+|||||+|||||||+|.
T Consensus 204 --~~~ptv~fkast~~~~~~---~~~~~~s~c~gae~l~~~lgny~~~~~lk~sIrvGViG~PNVGKSSvIN 270 (435)
T KOG2484|consen 204 --REGPTVAFKASTQMQNSN---SKNLQSSVCFGAETLMKVLGNYCRKGELKTSIRVGIIGYPNVGKSSVIN 270 (435)
T ss_pred --hhCCcceeeccccccccc---ccccccchhhhHHHHHHHhcCcccccccCcceEeeeecCCCCChhHHHH
Confidence 678889998888755543 3344555678999999999999988777788999999999999999985
|
|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >KOG2423|consensus | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >COG1161 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1424|consensus | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >KOG2485|consensus | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >PRK15467 ethanolamine utilization protein EutP; Provisional | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >PTZ00099 rab6; Provisional | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >KOG1489|consensus | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >TIGR00437 feoB ferrous iron transporter FeoB | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >COG0536 Obg Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >cd01871 Rac1_like Rac1-like subfamily | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >KOG1423|consensus | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >KOG0462|consensus | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >KOG1145|consensus | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >COG2229 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd01875 RhoG RhoG subfamily | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >KOG1191|consensus | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01873 RhoBTB RhoBTB subfamily | Back alignment and domain information |
|---|
| >COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04133 Rop_like Rop subfamily | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd04131 Rnd Rnd subfamily | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >cd04103 Centaurin_gamma Centaurin gamma | Back alignment and domain information |
|---|
| >KOG0076|consensus | Back alignment and domain information |
|---|
| >KOG0075|consensus | Back alignment and domain information |
|---|
| >KOG0092|consensus | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0078|consensus | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0073|consensus | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >KOG1423|consensus | Back alignment and domain information |
|---|
| >KOG0461|consensus | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >KOG0410|consensus | Back alignment and domain information |
|---|
| >PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) | Back alignment and domain information |
|---|
| >KOG1249|consensus | Back alignment and domain information |
|---|
| >KOG0094|consensus | Back alignment and domain information |
|---|
| >TIGR02836 spore_IV_A stage IV sporulation protein A | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1191|consensus | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >KOG0084|consensus | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >KOG0072|consensus | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >cd01899 Ygr210 Ygr210 subfamily | Back alignment and domain information |
|---|
| >KOG0468|consensus | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >COG0536 Obg Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >KOG0093|consensus | Back alignment and domain information |
|---|
| >KOG1144|consensus | Back alignment and domain information |
|---|
| >KOG0070|consensus | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >KOG1532|consensus | Back alignment and domain information |
|---|
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >cd04102 RabL3 RabL3 (Rab-like3) subfamily | Back alignment and domain information |
|---|
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1490|consensus | Back alignment and domain information |
|---|
| >cd01850 CDC_Septin CDC/Septin | Back alignment and domain information |
|---|
| >PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >KOG1489|consensus | Back alignment and domain information |
|---|
| >KOG1490|consensus | Back alignment and domain information |
|---|
| >PRK09602 translation-associated GTPase; Reviewed | Back alignment and domain information |
|---|
| >KOG0095|consensus | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >KOG0466|consensus | Back alignment and domain information |
|---|
| >KOG0410|consensus | Back alignment and domain information |
|---|
| >KOG0098|consensus | Back alignment and domain information |
|---|
| >PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence | Back alignment and domain information |
|---|
| >KOG0087|consensus | Back alignment and domain information |
|---|
| >KOG0083|consensus | Back alignment and domain information |
|---|
| >KOG0071|consensus | Back alignment and domain information |
|---|
| >PLN00023 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0088|consensus | Back alignment and domain information |
|---|
| >COG5258 GTPBP1 GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0395|consensus | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0394|consensus | Back alignment and domain information |
|---|
| >TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1486|consensus | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >KOG0458|consensus | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0079|consensus | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >smart00275 G_alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >KOG0081|consensus | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00066 G-alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1547|consensus | Back alignment and domain information |
|---|
| >COG0523 Putative GTPases (G3E family) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2486|consensus | Back alignment and domain information |
|---|
| >KOG0467|consensus | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >KOG1487|consensus | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0054|consensus | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG0077|consensus | Back alignment and domain information |
|---|
| >PRK05428 HPr kinase/phosphorylase; Provisional | Back alignment and domain information |
|---|
| >KOG2486|consensus | Back alignment and domain information |
|---|
| >KOG1143|consensus | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >KOG2004|consensus | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1954|consensus | Back alignment and domain information |
|---|
| >KOG1707|consensus | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >KOG0460|consensus | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG0074|consensus | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0057|consensus | Back alignment and domain information |
|---|
| >KOG0781|consensus | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0086|consensus | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >cd03110 Fer4_NifH_child This protein family's function is unkown | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >KOG2749|consensus | Back alignment and domain information |
|---|
| >PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >KOG0090|consensus | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >KOG0097|consensus | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >KOG3905|consensus | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0066|consensus | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >KOG4658|consensus | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 161 | |||
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 2e-11 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 5e-10 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 4e-07 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 2e-06 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 4e-05 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 3e-04 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 4e-04 |
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 | Back alignment and structure |
|---|
Score = 59.2 bits (144), Expect = 2e-11
Identities = 26/136 (19%), Positives = 57/136 (41%), Gaps = 31/136 (22%)
Query: 19 RSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQ 78
++ D++ E+VDAR PM +R + ED++ K ++++NKA K +
Sbjct: 18 TEKLKLIDIVYELVDARIPMSSRNPMIEDIL---KNKPRIMLLNKADKADAAVT------ 68
Query: 79 IFQTWIPYNSIQSIYSSPRFSSRSQK----DAQTERDLKAINVSSCVGAELLMLLLGNYT 134
Q W + F ++ + ++ + L I + ++ ++ +
Sbjct: 69 --QQWKEH-----------FENQGIRSLSINSVNGQGLNQIVPA----SKEILQEKFDRM 111
Query: 135 RNKDIKT-SITVGVVG 149
R K +K +I ++G
Sbjct: 112 RAKGVKPRAIRALIIG 127
|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 99.92 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 99.86 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 99.8 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 99.8 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 99.78 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 99.78 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 99.73 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 99.64 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 99.63 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 99.59 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 99.58 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 99.3 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 99.28 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 99.27 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 99.19 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 99.16 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 99.15 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 99.15 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 99.12 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 99.1 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 99.08 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 99.07 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 99.05 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 99.01 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 98.95 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 98.94 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 98.94 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 98.9 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 98.89 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 98.88 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 98.88 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 98.87 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 98.86 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 98.86 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 98.86 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 98.86 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 98.85 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 98.84 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 98.84 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 98.84 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 98.84 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 98.83 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 98.83 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 98.81 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 98.81 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 98.81 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 98.8 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 98.79 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 98.79 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 98.79 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 98.78 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 98.78 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 98.78 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 98.78 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 98.77 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 98.77 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 98.76 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 98.76 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 98.76 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 98.76 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 98.76 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 98.76 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 98.76 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 98.75 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 98.74 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 98.74 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 98.74 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 98.74 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 98.74 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 98.74 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 98.73 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 98.73 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 98.73 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 98.71 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 98.71 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 98.71 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 98.7 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 98.7 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 98.7 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 98.7 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 98.69 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 98.69 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 98.69 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 98.68 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 98.68 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 98.68 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 98.68 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 98.68 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 98.68 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 98.67 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 98.66 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 98.66 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 98.66 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 98.65 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 98.65 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 98.65 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 98.65 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 98.65 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 98.65 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 98.65 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 98.65 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 98.65 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 98.64 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 98.64 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 98.64 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 98.64 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 98.63 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 98.63 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 98.62 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 98.62 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 98.62 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 98.62 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 98.61 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 98.61 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 98.61 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 98.61 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 98.61 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 98.61 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 98.61 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 98.6 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 98.6 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 98.59 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 98.59 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 98.59 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 98.58 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 98.58 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 98.58 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 98.56 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 98.56 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 98.55 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 98.54 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 98.54 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 98.53 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 98.52 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 98.52 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 97.92 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 98.52 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 98.51 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 98.51 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 98.49 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 98.48 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 98.48 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 98.48 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 98.48 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 98.47 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 98.46 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 98.46 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 98.45 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 98.44 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 98.44 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 98.43 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 98.43 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 98.42 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 98.41 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 98.4 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 98.39 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 98.39 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 98.37 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 98.36 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 98.36 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 98.34 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 98.34 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 98.33 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 98.33 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 98.31 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 98.31 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 98.31 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 98.3 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 98.29 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 98.28 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 98.28 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 98.25 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 98.25 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 98.25 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 98.23 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 98.22 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 98.22 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 98.2 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 98.19 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 98.18 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 98.15 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 98.14 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 98.13 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 98.08 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 98.08 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 98.06 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 98.06 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 98.02 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 98.01 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 98.0 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 97.95 | |
| 1wxq_A | 397 | GTP-binding protein; structural genomics, riken st | 97.92 | |
| 3l82_B | 227 | F-box only protein 4; TRFH domain, helix, GTPase d | 97.89 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 97.88 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 97.82 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 97.78 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 97.66 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 97.66 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 97.5 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 97.49 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 97.42 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 97.39 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 97.39 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 97.35 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 97.34 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.28 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 97.27 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 97.25 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 97.18 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 97.18 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 97.17 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 97.16 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 97.14 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 97.12 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 97.07 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 97.03 | |
| 3r7w_B | 331 | Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT | 97.03 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 97.02 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 97.0 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 96.9 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 96.86 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 96.86 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 96.84 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 96.81 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 96.77 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 96.69 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 96.62 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 96.53 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 96.52 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 96.47 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 96.44 | |
| 2xtz_A | 354 | Guanine nucleotide-binding protein alpha-1 subuni; | 96.4 | |
| 3ohm_A | 327 | Guanine nucleotide-binding protein G(Q) subunit A; | 96.21 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 96.18 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 96.15 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 96.1 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 96.03 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 96.03 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 95.95 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 95.91 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 95.86 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 95.83 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 95.78 | |
| 4fid_A | 340 | G protein alpha subunit; RAS-like domain, all-heli | 95.7 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 95.65 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 95.57 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 95.43 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 95.34 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 95.27 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 95.15 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 95.11 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 94.9 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 94.68 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 94.68 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 94.6 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 94.47 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 94.43 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 94.31 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 94.16 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 94.15 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 94.0 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 93.6 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 93.5 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 93.42 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 93.41 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 93.23 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 93.17 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 93.07 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 92.96 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 92.8 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 92.78 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 92.77 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 92.77 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 92.72 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 92.71 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 92.6 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 92.59 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 92.54 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 92.37 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 92.24 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 92.22 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 92.13 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 92.05 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 92.01 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 91.94 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 91.69 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 91.68 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 91.53 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 91.53 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 91.53 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 91.51 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 91.43 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 91.38 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 91.31 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 91.19 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 91.16 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 90.85 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 90.81 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 90.76 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 90.49 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 90.25 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 90.22 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 90.22 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 90.09 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 90.05 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 90.04 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 89.9 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 89.89 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 89.79 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 89.7 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 89.65 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 89.62 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 89.56 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 89.53 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 89.46 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 89.31 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 89.3 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 89.19 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 89.1 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 89.01 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 88.96 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 88.95 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 88.89 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 88.87 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 88.86 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 88.83 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 88.75 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 88.73 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 88.71 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 88.56 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 88.56 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 88.55 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 88.5 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 88.43 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 88.35 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 88.22 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 88.14 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 88.13 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 88.12 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 87.96 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 87.95 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 87.9 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 87.79 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 87.63 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 87.59 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 87.45 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 87.41 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 87.4 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 87.31 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 87.12 | |
| 1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 87.01 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 86.99 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 86.99 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 86.82 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 86.76 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 86.74 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 86.63 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 86.59 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 86.33 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 86.27 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 86.19 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 86.11 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 86.04 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 86.03 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 85.97 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 85.7 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 85.55 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 85.5 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 85.4 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 85.33 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 85.24 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 85.01 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 85.0 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 84.85 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 84.85 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 84.65 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 84.62 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 84.54 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 84.48 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 84.41 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 84.31 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 84.3 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 84.22 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 84.12 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 84.08 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 83.85 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 83.76 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 83.48 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 83.4 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 83.39 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 83.29 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 83.08 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 83.05 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 82.95 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 82.88 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 82.53 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 82.47 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 82.33 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 82.32 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 82.09 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 81.94 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 81.58 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 81.56 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 81.46 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 81.4 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 81.24 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 81.19 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 80.87 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 80.44 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 80.3 |
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
Probab=99.92 E-value=6.1e-25 Score=172.13 Aligned_cols=124 Identities=23% Similarity=0.290 Sum_probs=101.6
Q ss_pred CCcchHHHHHHHHHHHhhhccEEEEEEeCCCCCCCCcHHHHHHHhCCCCCcEEEEeecCCCCCcccccccHHHHHHHHhh
Q psy8220 6 PMEMRGVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQIFQTWIP 85 (161)
Q Consensus 6 p~~~~~~~~~~~~~~~i~~aDviL~VvD~~~~~~~~~~~i~~~l~~~~~k~~ilVlNK~Dl~~~~~~~~~~~~~~~~~~~ 85 (161)
|.|+.. .++++ ++.+++||+|++|+|+++|.++.++.+.+++ .++|.++|+||+||++. +..+.|.+
T Consensus 7 PGhm~k-a~~~~-~~~l~~aDvVl~VvDAr~p~~~~~~~l~~~l---~~kp~ilVlNK~DL~~~--------~~~~~~~~ 73 (282)
T 1puj_A 7 PGHMAK-ARREV-TEKLKLIDIVYELVDARIPMSSRNPMIEDIL---KNKPRIMLLNKADKADA--------AVTQQWKE 73 (282)
T ss_dssp --CTTH-HHHHH-HHHGGGCSEEEEEEETTSTTTTSCHHHHHHC---SSSCEEEEEECGGGSCH--------HHHHHHHH
T ss_pred chHHHH-HHHHH-HHHHhhCCEEEEEEeCCCCCccCCHHHHHHH---CCCCEEEEEECcccCCH--------HHHHHHHH
Confidence 889885 58888 7999999999999999999998888888876 46999999999999986 55678888
Q ss_pred hhccCCCCceeEEeecCCCCcchhhhhhhhccccccCHHHHHHHHHhHhhc-------CC-CCCceEEEEEeecCCCccc
Q psy8220 86 YNSIQSIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTRN-------KD-IKTSITVGVVGECNIAGSI 157 (161)
Q Consensus 86 ~~~~~~~~~~i~iSa~~~~~~~~~~~~~~~~~~~~~g~~~L~~~l~~~~~~-------~~-~~~~~~v~vvG~pNVGKSs 157 (161)
++.. .+.+++++||.++ .|+++|.+.+.+.++. .+ ...++++++||.|||||||
T Consensus 74 ~~~~-~g~~~i~iSA~~~-----------------~gi~~L~~~i~~~l~~~~~~~~~~~~~~~~~~v~~vG~~nvGKSs 135 (282)
T 1puj_A 74 HFEN-QGIRSLSINSVNG-----------------QGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKST 135 (282)
T ss_dssp HHHT-TTCCEEECCTTTC-----------------TTGGGHHHHHHHHHHHHHHHHHHTTCCCCCEEEEEEESTTSSHHH
T ss_pred HHHh-cCCcEEEEECCCc-----------------ccHHHHHHHHHHHHHHHHHHHHhcCCCCCCceEEEEecCCCchHH
Confidence 8752 3568899999988 8899988888776642 11 2356899999999999999
Q ss_pred ccC
Q psy8220 158 RDL 160 (161)
Q Consensus 158 l~~ 160 (161)
|++
T Consensus 136 liN 138 (282)
T 1puj_A 136 LIN 138 (282)
T ss_dssp HHH
T ss_pred HHH
Confidence 985
|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 161 | ||||
| d1puja_ | 273 | c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti | 9e-10 |
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Probable GTPase YlqF species: Bacillus subtilis [TaxId: 1423]
Score = 53.7 bits (128), Expect = 9e-10
Identities = 23/119 (19%), Positives = 43/119 (36%), Gaps = 3/119 (2%)
Query: 19 RSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQ 78
++ D++ E+VDAR PM +R + ED++ K ++++NKA K +
Sbjct: 10 TEKLKLIDIVYELVDARIPMSSRNPMIEDIL---KNKPRIMLLNKADKADAAVTQQWKEH 66
Query: 79 IFQTWIPYNSIQSIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTRNK 137
I SI S+ + + + L++G K
Sbjct: 67 FENQGIRSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGK 125
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 161 | |||
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 99.94 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 99.56 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 99.47 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 99.46 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 99.43 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 99.41 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 99.36 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 99.25 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 99.23 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 99.19 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 99.17 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 99.17 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 99.13 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 99.11 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 99.1 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 99.05 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 98.92 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 98.91 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 98.83 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 98.75 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 98.74 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 98.69 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 98.65 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 98.62 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 98.6 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 98.6 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 98.6 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 98.55 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 98.54 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 98.54 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 98.53 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 98.52 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 98.49 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 98.49 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 98.49 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.48 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 98.46 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 98.43 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.42 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 98.42 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 98.4 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 98.4 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 98.4 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 98.4 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 98.38 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 98.36 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 98.36 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 98.36 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 98.36 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 98.34 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 98.33 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 98.32 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 98.32 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 98.32 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 98.32 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 98.3 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 98.27 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 98.25 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 98.23 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 98.2 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 98.18 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 98.14 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 98.14 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 98.12 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 98.11 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 98.1 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 98.08 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 98.07 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 98.04 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 97.98 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.97 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 97.92 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 97.88 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 97.87 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 97.84 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 97.76 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 97.75 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 97.73 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 97.7 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 97.68 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 97.5 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 97.48 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 97.28 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.24 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 97.18 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 97.06 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 96.86 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 96.8 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 95.79 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.16 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 94.94 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 94.9 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 94.88 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.78 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 94.75 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 94.3 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 94.17 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 94.13 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 93.72 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 93.31 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 93.21 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 92.86 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 92.82 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 92.74 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 92.69 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 92.59 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 92.46 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 92.35 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 92.17 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 92.05 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 91.59 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 91.58 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 91.46 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 91.35 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 91.16 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 91.13 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 90.28 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 89.4 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 88.54 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 86.92 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 86.54 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 86.14 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 84.84 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 84.6 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 84.46 | |
| d1s2da_ | 167 | Purine transdeoxyribosylase {Lactobacillus helveti | 81.81 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 81.63 |
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Probable GTPase YlqF species: Bacillus subtilis [TaxId: 1423]
Probab=99.94 E-value=1.8e-27 Score=183.73 Aligned_cols=122 Identities=23% Similarity=0.273 Sum_probs=97.4
Q ss_pred cchHHHHHHHHHHHhhhccEEEEEEeCCCCCCCCcHHHHHHHhCCCCCcEEEEeecCCCCCcccccccHHHHHHHHhhhh
Q psy8220 8 EMRGVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQIFQTWIPYN 87 (161)
Q Consensus 8 ~~~~~~~~~~~~~~i~~aDviL~VvD~~~~~~~~~~~i~~~l~~~~~k~~ilVlNK~Dl~~~~~~~~~~~~~~~~~~~~~ 87 (161)
||.. .++++ ++.++.+|+||+|+||+.|.++.++.+.+++. ++|+|+|+||+||++. +....|.+++
T Consensus 1 Hm~k-a~r~i-~~~i~~~DvIl~V~DaR~P~ss~~~~l~~~~~---~Kp~IlVlNK~DLv~~--------~~~~~w~~~f 67 (273)
T d1puja_ 1 HMAK-ARREV-TEKLKLIDIVYELVDARIPMSSRNPMIEDILK---NKPRIMLLNKADKADA--------AVTQQWKEHF 67 (273)
T ss_dssp CTTH-HHHHH-HHHGGGCSEEEEEEETTSTTTTSCHHHHHHCS---SSCEEEEEECGGGSCH--------HHHHHHHHHH
T ss_pred CHHH-HHHHH-HHHHHhCCEEEEEEECCCCCCCCCHHHHHHHc---CCCeEEEEECccCCch--------HHHHHHHHHH
Confidence 5664 58899 79999999999999999999999999998774 5999999999999987 6678899988
Q ss_pred ccCCCCceeEEeecCCCCcchhhhhhhhccccccCHHHHHHHHHhHhhc-------C-CCCCceEEEEEeecCCCccccc
Q psy8220 88 SIQSIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTRN-------K-DIKTSITVGVVGECNIAGSIRD 159 (161)
Q Consensus 88 ~~~~~~~~i~iSa~~~~~~~~~~~~~~~~~~~~~g~~~L~~~l~~~~~~-------~-~~~~~~~v~vvG~pNVGKSsl~ 159 (161)
.. .+.+.+++|+.++ .|...+.+.+.+.+.. . ....+++|+|||+|||||||||
T Consensus 68 ~~-~~~~~i~isa~~~-----------------~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~v~vvG~PNvGKSsli 129 (273)
T d1puja_ 68 EN-QGIRSLSINSVNG-----------------QGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKSTLI 129 (273)
T ss_dssp HT-TTCCEEECCTTTC-----------------TTGGGHHHHHHHHHHHHHHHHHHTTCCCCCEEEEEEESTTSSHHHHH
T ss_pred Hh-cCCccceeecccC-----------------CCccccchhhhhhhhhhhhhhhhccCCCCceEEEEEecCccchhhhh
Confidence 63 3566888999887 4555554444433321 2 2346799999999999999998
Q ss_pred C
Q psy8220 160 L 160 (161)
Q Consensus 160 ~ 160 (161)
+
T Consensus 130 N 130 (273)
T d1puja_ 130 N 130 (273)
T ss_dssp H
T ss_pred h
Confidence 5
|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1s2da_ c.23.14.1 (A:) Purine transdeoxyribosylase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|