Psyllid ID: psy8220


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MRSVKPMEMRGVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQIFQTWIPYNSIQSIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTRNKDIKTSITVGVVGECNIAGSIRDLE
ccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccccHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccEEEEEEccccccccccccc
cccccccHHHHHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEEEcccccccHHccc
mrsvkpmemRGVVVQEIERSVVEAADVILEVVdardpmgtrckvaedlvvgtpgkKLVIVINKagkpstkiqsgsMAQIFQTwipynsiqsiyssprfssrsqkdaqterdlkaiNVSSCVGAELLMLLLGnytrnkdiktSITVGVVGecniagsirdle
mrsvkpmemrgvVVQEIERSVVEAADVILEvvdardpmgtrckvaedlvvgtpgkkLVIVINKAgkpstkiqsgSMAQIFQTWIPYNSIQSIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTRnkdiktsitvgvvgecniagsirdle
MRSVKPMEMRGVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQIFQTWIPYNsiqsiyssprfssrsqKDAQTERDLKAINVSSCVGAELLMLLLGNYTRNKDIKTSITVGVVGECNIAGSIRDLE
**********GVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGK***KIQSGSMAQIFQTWIPYNSIQSIY******************LKAINVSSCVGAELLMLLLGNYTRNKDIKTSITVGVVGECNIAGS*****
***********VVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQIFQTWIPYNSIQSIYSS*************************VGAELLML**************ITVGVVGECNIAGSI****
********MRGVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGK********SMAQIFQTWIPYNSIQSIYS***************RDLKAINVSSCVGAELLMLLLGNYTRNKDIKTSITVGVVGECNIAGSIRDLE
******MEMRGVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQIFQTWIPYNSIQSIYSSPRFSSRS****************SCVGAELLMLLLGNYTRNKDIKTSITVGVVGECNIAG******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSVKPMEMRGVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQIFQTWIPYNSIQSIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTRNKDIKTSITVGVVGECNIAGSIRDLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
Q8MT06 581 Guanine nucleotide-bindin yes N/A 0.801 0.222 0.465 6e-24
Q21086 556 Guanine nucleotide-bindin yes N/A 0.795 0.230 0.415 3e-18
Q54KS4 615 Guanine nucleotide-bindin yes N/A 0.770 0.201 0.339 3e-15
Q9NVN8 582 Guanine nucleotide-bindin yes N/A 0.776 0.214 0.370 4e-15
Q6PGG6 577 Guanine nucleotide-bindin yes N/A 0.763 0.213 0.370 2e-14
Q3T0J9 575 Guanine nucleotide-bindin yes N/A 0.826 0.231 0.35 2e-14
Q9BVP2 549 Guanine nucleotide-bindin no N/A 0.838 0.245 0.298 8e-12
Q6DRP2 561 Guanine nucleotide-bindin no N/A 0.819 0.235 0.309 1e-11
P40010 520 Nuclear GTP-binding prote yes N/A 0.826 0.255 0.318 5e-11
O74791 470 GTPase grn1 OS=Schizosacc yes N/A 0.863 0.295 0.343 7e-11
>sp|Q8MT06|GNL3_DROME Guanine nucleotide-binding protein-like 3 homolog OS=Drosophila melanogaster GN=ns1 PE=1 SV=2 Back     alignment and function desciption
 Score =  109 bits (273), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 86/146 (58%), Gaps = 17/146 (11%)

Query: 19  RSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPG-KKLVIVINKAGK-PSTKIQSGSM 76
           R V+E ADV+LEVVDARDP+GTRC   E  V G PG K+LV+V+NKA   P   + +   
Sbjct: 145 RKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLNN--- 201

Query: 77  AQIFQTWIPYNSIQSIYSSPRFSSRSQKDAQTERDL------KAINVSSCVGAELLMLLL 130
                 WI Y       ++ + S++ Q +    R L      KA+  S C+GAELLM +L
Sbjct: 202 ------WIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAELLMSML 255

Query: 131 GNYTRNKDIKTSITVGVVGECNIAGS 156
           GNY RNK IKTSI VGVVG  N+  S
Sbjct: 256 GNYCRNKGIKTSIRVGVVGIPNVGKS 281




May play a role in regulating cellular proliferation.
Drosophila melanogaster (taxid: 7227)
>sp|Q21086|GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans GN=nst-1 PE=3 SV=1 Back     alignment and function description
>sp|Q54KS4|GNL3_DICDI Guanine nucleotide-binding protein-like 3 homolog OS=Dictyostelium discoideum GN=gnl3 PE=3 SV=1 Back     alignment and function description
>sp|Q9NVN8|GNL3L_HUMAN Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens GN=GNL3L PE=1 SV=1 Back     alignment and function description
>sp|Q6PGG6|GNL3L_MOUSE Guanine nucleotide-binding protein-like 3-like protein OS=Mus musculus GN=Gnl3l PE=1 SV=1 Back     alignment and function description
>sp|Q3T0J9|GNL3L_BOVIN Guanine nucleotide-binding protein-like 3-like protein OS=Bos taurus GN=GNL3L PE=2 SV=1 Back     alignment and function description
>sp|Q9BVP2|GNL3_HUMAN Guanine nucleotide-binding protein-like 3 OS=Homo sapiens GN=GNL3 PE=1 SV=2 Back     alignment and function description
>sp|Q6DRP2|GNL3_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio GN=gnl3 PE=2 SV=1 Back     alignment and function description
>sp|P40010|NUG1_YEAST Nuclear GTP-binding protein NUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUG1 PE=1 SV=1 Back     alignment and function description
>sp|O74791|GRN1_SCHPO GTPase grn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=grn1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
194900518 581 GG16794 [Drosophila erecta] gi|190651507 0.801 0.222 0.465 3e-22
21428328 581 AT23067p [Drosophila melanogaster] 0.801 0.222 0.465 3e-22
28572990 581 nucleostemin 1 [Drosophila melanogaster] 0.801 0.222 0.465 3e-22
195349203 581 GM15388 [Drosophila sechellia] gi|194122 0.801 0.222 0.465 3e-22
195500114 581 GE26110 [Drosophila yakuba] gi|194183337 0.801 0.222 0.465 3e-22
194742485 581 GF17911 [Drosophila ananassae] gi|190626 0.826 0.228 0.471 4e-22
195451637 579 GK13906 [Drosophila willistoni] gi|19416 0.826 0.229 0.471 5e-22
195151599 583 GL21923 [Drosophila persimilis] gi|19411 0.801 0.221 0.458 3e-21
198453139 583 GA26447 [Drosophila pseudoobscura pseudo 0.801 0.221 0.458 3e-21
195394346 581 GJ10591 [Drosophila virilis] gi|19414251 0.826 0.228 0.443 5e-21
>gi|194900518|ref|XP_001979804.1| GG16794 [Drosophila erecta] gi|190651507|gb|EDV48762.1| GG16794 [Drosophila erecta] Back     alignment and taxonomy information
 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 86/146 (58%), Gaps = 17/146 (11%)

Query: 19  RSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPG-KKLVIVINKAGK-PSTKIQSGSM 76
           R V+E ADV+LEVVDARDP+GTRC   E  V G PG K+LV+V+NKA   P   + +   
Sbjct: 145 RKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRDNLNN--- 201

Query: 77  AQIFQTWIPYNSIQSIYSSPRFSSRSQKDAQTERDL------KAINVSSCVGAELLMLLL 130
                 WI Y       ++ + S++ Q +    R L      KA+  S C+GAELLM +L
Sbjct: 202 ------WIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAELLMSML 255

Query: 131 GNYTRNKDIKTSITVGVVGECNIAGS 156
           GNY RNK IKTSI VGVVG  N+  S
Sbjct: 256 GNYCRNKGIKTSIRVGVVGIPNVGKS 281




Source: Drosophila erecta

Species: Drosophila erecta

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|21428328|gb|AAM49824.1| AT23067p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|28572990|ref|NP_732199.2| nucleostemin 1 [Drosophila melanogaster] gi|62510652|sp|Q8MT06.2|GNL3_DROME RecName: Full=Guanine nucleotide-binding protein-like 3 homolog; AltName: Full=Nucleostemin 1; AltName: Full=Nucleostemin homolog gi|28381326|gb|AAF55384.3| nucleostemin 1 [Drosophila melanogaster] gi|212287978|gb|ACJ23464.1| FI08004p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195349203|ref|XP_002041136.1| GM15388 [Drosophila sechellia] gi|194122741|gb|EDW44784.1| GM15388 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195500114|ref|XP_002097236.1| GE26110 [Drosophila yakuba] gi|194183337|gb|EDW96948.1| GE26110 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194742485|ref|XP_001953733.1| GF17911 [Drosophila ananassae] gi|190626770|gb|EDV42294.1| GF17911 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195451637|ref|XP_002073011.1| GK13906 [Drosophila willistoni] gi|194169096|gb|EDW83997.1| GK13906 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195151599|ref|XP_002016726.1| GL21923 [Drosophila persimilis] gi|194111783|gb|EDW33826.1| GL21923 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198453139|ref|XP_002137602.1| GA26447 [Drosophila pseudoobscura pseudoobscura] gi|198132227|gb|EDY68160.1| GA26447 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195394346|ref|XP_002055806.1| GJ10591 [Drosophila virilis] gi|194142515|gb|EDW58918.1| GJ10591 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
FB|FBgn0038473 581 ns1 "nucleostemin 1" [Drosophi 0.838 0.232 0.457 1.4e-21
ZFIN|ZDB-GENE-040723-1 571 gnl3l "guanine nucleotide bind 0.844 0.238 0.428 1.2e-19
WB|WBGene00003821 556 nst-1 [Caenorhabditis elegans 0.795 0.230 0.394 1.2e-16
UNIPROTKB|Q21086 556 nst-1 "Guanine nucleotide-bind 0.795 0.230 0.394 1.2e-16
UNIPROTKB|A8IVS6 380 CHLREDRAFT_116921 "Predicted p 0.279 0.118 0.478 7.7e-16
TAIR|locus:2077587 582 NSN1 "AT3G07050" [Arabidopsis 0.267 0.073 0.568 7.7e-16
UNIPROTKB|Q5ZCV4 591 B1111C09.2 "Uncharacterized pr 0.826 0.225 0.347 2.6e-14
UNIPROTKB|F1RUG1 574 LOC100521120 "Uncharacterized 0.832 0.233 0.380 4e-14
UNIPROTKB|K7GPE3 575 LOC100521120 "Uncharacterized 0.832 0.233 0.380 4e-14
UNIPROTKB|F1PAW6 649 GNL3L "Uncharacterized protein 0.832 0.206 0.373 5e-14
FB|FBgn0038473 ns1 "nucleostemin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 260 (96.6 bits), Expect = 1.4e-21, P = 1.4e-21
 Identities = 64/140 (45%), Positives = 81/140 (57%)

Query:    19 RSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPG-KKLVIVINKAGK-PSTKIQSGSM 76
             R V+E ADV+LEVVDARDP+GTRC   E  V G PG K+LV+V+NKA   P   + +   
Sbjct:   145 RKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLNN--W 202

Query:    77 AQIFQTWIPYNXXXXXXXXXXXXXXXXKDAQTERDLKAINVSSCVGAELLMLLLGNYTRN 136
              + F+   P                  K  + + + KA+  S C+GAELLM +LGNY RN
Sbjct:   203 IKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTE-KAMQGSVCIGAELLMSMLGNYCRN 261

Query:   137 KDIKTSITVGVVGECNIAGS 156
             K IKTSI VGVVG  N+  S
Sbjct:   262 KGIKTSIRVGVVGIPNVGKS 281




GO:0005525 "GTP binding" evidence=IEA
GO:0046626 "regulation of insulin receptor signaling pathway" evidence=IMP
GO:0040014 "regulation of multicellular organism growth" evidence=IMP
GO:0005730 "nucleolus" evidence=IDA
GO:0042254 "ribosome biogenesis" evidence=IBA
GO:0003924 "GTPase activity" evidence=IBA
ZFIN|ZDB-GENE-040723-1 gnl3l "guanine nucleotide binding protein-like 3 (nucleolar)-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00003821 nst-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q21086 nst-1 "Guanine nucleotide-binding protein-like 3 homolog" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A8IVS6 CHLREDRAFT_116921 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
TAIR|locus:2077587 NSN1 "AT3G07050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZCV4 B1111C09.2 "Uncharacterized protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUG1 LOC100521120 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GPE3 LOC100521120 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAW6 GNL3L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 7e-29
cd01859157 cd01859, MJ1464, An uncharacterized, circularly pe 8e-12
cd01858157 cd01858, NGP_1, A novel nucleolar GTP-binding prot 2e-11
cd01849146 cd01849, YlqF_related_GTPase, Circularly permuted 2e-10
COG1161 322 COG1161, COG1161, Predicted GTPases [General funct 6e-10
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 2e-07
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 8e-04
TIGR03596 276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 0.001
PRK09563 287 PRK09563, rbgA, GTPase YlqF; Reviewed 0.002
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
 Score =  103 bits (260), Expect = 7e-29
 Identities = 56/134 (41%), Positives = 72/134 (53%), Gaps = 21/134 (15%)

Query: 26  DVILEVVDARDPMGTRCKVAEDLVVGT-PGKKLVIVINKAGK-PSTKIQSGSMAQIFQTW 83
           DVILEV+DARDP+G RC   E  V+   P KKLV+V+NK    P          +  + W
Sbjct: 1   DVILEVLDARDPLGCRCPQVERAVLVLGPNKKLVLVLNKIDLVPK---------ENVEKW 51

Query: 84  IPYNSIQ--------SIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTR 135
           + Y   +        S     +  SR  K  +   DL +   S+C+GA+ L+ LL NY R
Sbjct: 52  LKYLRNEFPTVAFKASTQQQKKNLSRKSKKVKASDDLLS--SSACLGADALLKLLKNYAR 109

Query: 136 NKDIKTSITVGVVG 149
           NK IKTSITVGVVG
Sbjct: 110 NKGIKTSITVGVVG 123


Nucleostemin (NS) is a nucleolar protein that functions as a regulator of cell growth and proliferation in stem cells and in several types of cancer cells, but is not expressed in the differentiated cells of most mammalian adult tissues. NS shuttles between the nucleolus and nucleoplasm bidirectionally at a rate that is fast and independent of cell type. Lowering GTP levels decreases the nucleolar retention of NS, and expression of NS is abruptly down-regulated during differentiation prior to terminal cell division. Found only in eukaryotes, NS consists of an N-terminal basic domain, a coiled-coil domain, a GTP-binding domain, an intermediate domain, and a C-terminal acidic domain. Experimental evidence indicates that NS uses its GTP-binding property as a molecular switch to control the transition between the nucleolus and nucleoplasm, and this process involves interaction between the basic, GTP-binding, and intermediate domains of the protein. Length = 171

>gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206751 cd01858, NGP_1, A novel nucleolar GTP-binding protein, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
KOG2484|consensus 435 99.95
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.93
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 99.93
KOG2423|consensus 572 99.93
PRK09563 287 rbgA GTPase YlqF; Reviewed 99.92
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.91
COG1161 322 Predicted GTPases [General function prediction onl 99.91
KOG1424|consensus 562 99.9
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.9
COG1160 444 Predicted GTPases [General function prediction onl 99.9
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.89
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.87
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.86
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.83
PRK13796 365 GTPase YqeH; Provisional 99.8
KOG2485|consensus 335 99.79
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.79
PRK03003 472 GTP-binding protein Der; Reviewed 99.76
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.75
PRK12289 352 GTPase RsgA; Reviewed 99.74
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.73
PRK00093 435 GTP-binding protein Der; Reviewed 99.73
TIGR00157 245 ribosome small subunit-dependent GTPase A. The Aqu 99.67
PRK00098 298 GTPase RsgA; Reviewed 99.65
COG1159298 Era GTPase [General function prediction only] 99.63
cd01854 287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 99.63
PRK12288 347 GTPase RsgA; Reviewed 99.56
PRK01889 356 GTPase RsgA; Reviewed 99.49
COG1160444 Predicted GTPases [General function prediction onl 99.4
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.39
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.39
PRK00089292 era GTPase Era; Reviewed 99.25
PRK15494339 era GTPase Era; Provisional 99.24
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.17
COG0486454 ThdF Predicted GTPase [General function prediction 99.16
COG2262411 HflX GTPases [General function prediction only] 99.14
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.12
PRK09866 741 hypothetical protein; Provisional 99.11
COG1162 301 Predicted GTPases [General function prediction onl 99.1
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.1
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.09
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.08
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.08
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.08
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.07
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.06
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.04
cd00881189 GTP_translation_factor GTP translation factor fami 99.04
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.03
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.02
PRK00093435 GTP-binding protein Der; Reviewed 99.02
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.0
PRK03003472 GTP-binding protein Der; Reviewed 98.98
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 98.97
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 98.96
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.96
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.95
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 98.95
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.94
PRK12299335 obgE GTPase CgtA; Reviewed 98.94
PRK12736 394 elongation factor Tu; Reviewed 98.94
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 98.93
CHL00071 409 tufA elongation factor Tu 98.91
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.91
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.91
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 98.9
PRK00049 396 elongation factor Tu; Reviewed 98.89
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 98.88
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.88
PRK12298390 obgE GTPase CgtA; Reviewed 98.87
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.87
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.87
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.87
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.86
PRK12296 500 obgE GTPase CgtA; Reviewed 98.85
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.85
PLN03127 447 Elongation factor Tu; Provisional 98.83
PRK04000 411 translation initiation factor IF-2 subunit gamma; 98.83
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.83
PRK11058426 GTPase HflX; Provisional 98.83
PRK05433 600 GTP-binding protein LepA; Provisional 98.82
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 98.82
PRK12735 396 elongation factor Tu; Reviewed 98.82
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 98.82
cd01878204 HflX HflX subfamily. A distinct conserved domain w 98.82
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 98.81
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.81
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.79
PRK13768253 GTPase; Provisional 98.79
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 98.79
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.79
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 98.78
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.78
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.77
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.77
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 98.77
TIGR00485 394 EF-Tu translation elongation factor TU. This align 98.76
PRK12297424 obgE GTPase CgtA; Reviewed 98.76
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 98.76
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.73
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 98.73
smart00178184 SAR Sar1p-like members of the Ras-family of small 98.73
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.73
PLN00223181 ADP-ribosylation factor; Provisional 98.73
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.72
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 98.72
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.72
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.72
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.71
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.71
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.7
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 98.69
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 98.69
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.68
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.68
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.68
PTZ00133182 ADP-ribosylation factor; Provisional 98.67
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.67
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.67
PLN03126 478 Elongation factor Tu; Provisional 98.67
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 98.67
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.66
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.66
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.65
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.65
PTZ00099176 rab6; Provisional 98.65
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.65
PRK04213201 GTP-binding protein; Provisional 98.65
CHL00189 742 infB translation initiation factor 2; Provisional 98.65
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 98.64
COG0218200 Predicted GTPase [General function prediction only 98.64
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 98.64
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.64
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.64
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 98.63
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.63
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 98.63
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.63
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.63
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.63
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.62
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 98.62
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.62
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.61
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.61
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.61
PRK12317 425 elongation factor 1-alpha; Reviewed 98.61
KOG1489|consensus366 98.59
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.59
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.59
PTZ00369189 Ras-like protein; Provisional 98.58
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.58
PRK10218 607 GTP-binding protein; Provisional 98.58
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.58
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.58
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.57
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 98.57
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.57
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.56
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 98.56
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 98.55
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 98.55
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 98.55
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.53
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 98.53
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 98.53
PTZ00141 446 elongation factor 1- alpha; Provisional 98.52
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 98.52
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.52
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 98.51
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 98.51
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.51
COG0536369 Obg Predicted GTPase [General function prediction 98.51
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.51
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 98.51
PLN03110216 Rab GTPase; Provisional 98.51
cd00876160 Ras Ras family. The Ras family of the Ras superfam 98.5
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 98.5
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.5
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 98.5
PF00025175 Arf: ADP-ribosylation factor family The prints ent 98.5
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 98.49
PRK05306 787 infB translation initiation factor IF-2; Validated 98.48
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 98.48
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 98.47
KOG1423|consensus379 98.47
PRK00007 693 elongation factor G; Reviewed 98.45
KOG0462|consensus 650 98.45
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.44
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 98.43
PLN03118211 Rab family protein; Provisional 98.43
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 98.43
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 98.41
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 98.4
KOG1145|consensus 683 98.4
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.4
PRK14845 1049 translation initiation factor IF-2; Provisional 98.4
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.4
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 98.39
COG2229187 Predicted GTPase [General function prediction only 98.38
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 98.38
PRK04004 586 translation initiation factor IF-2; Validated 98.37
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 98.37
PRK12739 691 elongation factor G; Reviewed 98.37
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 98.36
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 98.36
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 98.35
PLN03071219 GTP-binding nuclear protein Ran; Provisional 98.35
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 98.34
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 98.34
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 98.34
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 98.33
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 98.33
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 98.32
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 98.32
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 98.31
PLN03108210 Rab family protein; Provisional 98.29
PLN00043 447 elongation factor 1-alpha; Provisional 98.28
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.28
PRK00741 526 prfC peptide chain release factor 3; Provisional 98.28
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 98.27
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 98.27
KOG1191|consensus531 98.26
PF03193 161 DUF258: Protein of unknown function, DUF258; Inter 98.26
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 98.25
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.25
COG3276 447 SelB Selenocysteine-specific translation elongatio 98.25
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 98.25
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 98.24
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 98.23
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 98.23
PRK12740 668 elongation factor G; Reviewed 98.22
TIGR00503 527 prfC peptide chain release factor 3. This translat 98.21
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 98.2
PRK13351 687 elongation factor G; Reviewed 98.2
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 98.19
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 98.18
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 98.17
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.15
cd01896233 DRG The developmentally regulated GTP-binding prot 98.13
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 98.1
PRK09435332 membrane ATPase/protein kinase; Provisional 98.09
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.05
COG1217 603 TypA Predicted membrane GTPase involved in stress 98.03
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 98.03
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 98.01
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 98.01
KOG0076|consensus197 98.0
KOG0075|consensus186 97.98
KOG0092|consensus200 97.94
COG0486 454 ThdF Predicted GTPase [General function prediction 97.92
KOG0078|consensus207 97.92
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 97.89
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 97.88
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 97.87
COG1084346 Predicted GTPase [General function prediction only 97.84
KOG0073|consensus185 97.82
PTZ00416 836 elongation factor 2; Provisional 97.77
KOG1423|consensus 379 97.75
KOG0461|consensus 522 97.74
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 97.72
KOG0410|consensus410 97.72
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 97.69
KOG1249|consensus 572 97.68
KOG0094|consensus221 97.66
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 97.63
PLN00116 843 translation elongation factor EF-2 subunit; Provis 97.62
KOG1191|consensus 531 97.6
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.59
KOG0084|consensus205 97.52
TIGR03156 351 GTP_HflX GTP-binding protein HflX. This protein fa 97.5
TIGR00101199 ureG urease accessory protein UreG. This model rep 97.49
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 97.47
PRK12298 390 obgE GTPase CgtA; Reviewed 97.45
PRK07560 731 elongation factor EF-2; Reviewed 97.44
KOG0072|consensus182 97.43
COG1084 346 Predicted GTPase [General function prediction only 97.42
COG3596296 Predicted GTPase [General function prediction only 97.42
TIGR00450 442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 97.4
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 97.4
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 97.39
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 97.38
KOG0468|consensus 971 97.37
PRK05291 449 trmE tRNA modification GTPase TrmE; Reviewed 97.34
COG0536 369 Obg Predicted GTPase [General function prediction 97.33
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 97.33
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 97.32
PRK12299 335 obgE GTPase CgtA; Reviewed 97.31
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 97.29
KOG0093|consensus193 97.27
KOG1144|consensus 1064 97.23
KOG0070|consensus181 97.21
PRK12297 424 obgE GTPase CgtA; Reviewed 97.2
PRK12296 500 obgE GTPase CgtA; Reviewed 97.18
PRK15494 339 era GTPase Era; Provisional 97.16
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 97.15
TIGR00991 313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 97.14
cd01878 204 HflX HflX subfamily. A distinct conserved domain w 97.11
TIGR02729 329 Obg_CgtA Obg family GTPase CgtA. This model descri 97.08
PRK11058 426 GTPase HflX; Provisional 97.07
KOG1532|consensus366 97.03
COG1163 365 DRG Predicted GTPase [General function prediction 97.03
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 96.97
cd04105203 SR_beta Signal recognition particle receptor, beta 96.95
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 96.93
COG1163365 DRG Predicted GTPase [General function prediction 96.8
COG0050 394 TufB GTPases - translation elongation factors [Tra 96.78
KOG1490|consensus 620 96.75
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 96.75
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 96.75
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 96.59
KOG1489|consensus 366 96.58
KOG1490|consensus 620 96.57
PRK09602396 translation-associated GTPase; Reviewed 96.55
KOG0095|consensus213 96.54
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 96.54
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 96.46
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 96.46
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.42
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 96.42
KOG0466|consensus 466 96.38
KOG0410|consensus 410 96.36
KOG0098|consensus216 96.34
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 96.25
KOG0087|consensus222 96.25
KOG0083|consensus192 96.25
KOG0071|consensus180 96.21
PLN00023334 GTP-binding protein; Provisional 96.19
KOG0088|consensus218 96.16
COG5258 527 GTPBP1 GTPase [General function prediction only] 96.14
KOG0395|consensus196 96.04
PRK05439 311 pantothenate kinase; Provisional 96.03
COG2262 411 HflX GTPases [General function prediction only] 95.95
KOG0394|consensus210 95.81
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 95.78
PLN03210 1153 Resistant to P. syringae 6; Provisional 95.75
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 95.73
KOG1486|consensus 364 95.73
PF09439181 SRPRB: Signal recognition particle receptor beta s 95.72
KOG0458|consensus 603 95.6
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 95.6
PRK09435 332 membrane ATPase/protein kinase; Provisional 95.42
KOG0079|consensus198 95.4
cd03112158 CobW_like The function of this protein family is u 95.37
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 95.37
KOG0081|consensus219 95.31
PRK10463 290 hydrogenase nickel incorporation protein HypB; Pro 95.26
COG3596 296 Predicted GTPase [General function prediction only 95.2
COG1100219 GTPase SAR1 and related small G proteins [General 95.19
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 95.17
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 95.16
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.03
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 94.8
cd01882 225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 94.75
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 94.58
PRK09866 741 hypothetical protein; Provisional 94.51
KOG1547|consensus 336 94.5
COG0523323 Putative GTPases (G3E family) [General function pr 94.38
KOG2486|consensus 320 94.36
KOG0467|consensus 887 94.3
PLN02200 234 adenylate kinase family protein 94.11
KOG1487|consensus 358 94.1
COG1072 283 CoaA Panthothenate kinase [Coenzyme metabolism] 94.09
KOG0054|consensus 1381 94.0
PRK14974 336 cell division protein FtsY; Provisional 93.99
KOG0077|consensus193 93.81
PRK05428 308 HPr kinase/phosphorylase; Provisional 93.78
KOG2486|consensus320 93.77
KOG1143|consensus 591 93.66
TIGR01526 325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 93.44
PLN03126 478 Elongation factor Tu; Provisional 93.41
PLN03127 447 Elongation factor Tu; Provisional 93.29
KOG2004|consensus 906 93.29
PRK15455 644 PrkA family serine protein kinase; Provisional 93.28
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 93.13
KOG1954|consensus 532 93.01
KOG1707|consensus 625 92.92
TIGR00064 272 ftsY signal recognition particle-docking protein F 92.91
KOG0460|consensus 449 92.89
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 92.85
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 92.84
PRK08154 309 anaerobic benzoate catabolism transcriptional regu 92.82
COG4987 573 CydC ABC-type transport system involved in cytochr 92.76
COG1134 249 TagH ABC-type polysaccharide/polyol phosphate tran 92.72
KOG0074|consensus185 92.72
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 92.6
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 92.55
COG4181 228 Predicted ABC-type transport system involved in ly 92.45
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 92.37
PRK10416 318 signal recognition particle-docking protein FtsY; 92.3
TIGR00679 304 hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene 92.21
PF1355562 AAA_29: P-loop containing region of AAA domain 92.08
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 92.04
KOG0057|consensus 591 91.97
KOG0781|consensus 587 91.94
PRK05537 568 bifunctional sulfate adenylyltransferase subunit 1 91.7
CHL00189 742 infB translation initiation factor 2; Provisional 91.63
PRK08099 399 bifunctional DNA-binding transcriptional repressor 91.48
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 91.46
PRK14489 366 putative bifunctional molybdopterin-guanine dinucl 91.27
COG1132 567 MdlB ABC-type multidrug transport system, ATPase a 91.2
KOG0086|consensus214 91.07
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 91.04
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 90.92
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 90.73
PLN02796 347 D-glycerate 3-kinase 90.68
PRK04220 301 2-phosphoglycerate kinase; Provisional 90.56
PF05621 302 TniB: Bacterial TniB protein; InterPro: IPR008868 90.48
PRK00411 394 cdc6 cell division control protein 6; Reviewed 90.43
cd03110179 Fer4_NifH_child This protein family's function is 90.34
TIGR02868 529 CydC thiol reductant ABC exporter, CydC subunit. T 90.34
KOG2749|consensus 415 90.33
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 90.33
COG2074 299 2-phosphoglycerate kinase [Carbohydrate transport 90.29
PRK00771 437 signal recognition particle protein Srp54; Provisi 90.25
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 90.18
PF00437 270 T2SE: Type II/IV secretion system protein; InterPr 90.13
KOG0090|consensus238 89.83
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 89.75
PRK06851 367 hypothetical protein; Provisional 89.7
COG1149284 MinD superfamily P-loop ATPase containing an inser 89.66
PLN02199 303 shikimate kinase 89.6
KOG0097|consensus215 89.53
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 89.45
PRK12727 559 flagellar biosynthesis regulator FlhF; Provisional 89.44
PRK09183 259 transposase/IS protein; Provisional 89.4
KOG3905|consensus 473 89.37
PRK05306 787 infB translation initiation factor IF-2; Validated 89.29
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 89.13
CHL00095 821 clpC Clp protease ATP binding subunit 89.07
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 88.96
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 88.86
COG3854 308 SpoIIIAA ncharacterized protein conserved in bacte 88.85
PRK12723 388 flagellar biosynthesis regulator FlhF; Provisional 88.83
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 88.8
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 88.74
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 88.71
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 88.7
PLN03046 460 D-glycerate 3-kinase; Provisional 88.69
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 88.64
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 88.64
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP- 88.64
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 88.55
PRK13900 332 type IV secretion system ATPase VirB11; Provisiona 88.52
PRK14238 271 phosphate transporter ATP-binding protein; Provisi 88.52
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 88.5
CHL00181 287 cbbX CbbX; Provisional 88.49
PRK14257 329 phosphate ABC transporter ATP-binding protein; Pro 88.49
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 88.45
PTZ00243 1560 ABC transporter; Provisional 88.4
TIGR02203 571 MsbA_lipidA lipid A export permease/ATP-binding pr 88.36
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 88.35
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 88.35
TIGR03797 686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 88.31
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 88.28
PRK06526 254 transposase; Provisional 88.25
TIGR01193 708 bacteriocin_ABC ABC-type bacteriocin transporter. 88.17
PRK14252 265 phosphate ABC transporter ATP-binding protein; Pro 88.16
KOG0066|consensus 807 88.04
TIGR02857 529 CydD thiol reductant ABC exporter, CydD subunit. U 88.01
PRK12402 337 replication factor C small subunit 2; Reviewed 87.99
PRK13531 498 regulatory ATPase RavA; Provisional 87.98
PHA02624 647 large T antigen; Provisional 87.91
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 87.88
COG1341 398 Predicted GTPase or GTP-binding protein [General f 87.86
PLN02165 334 adenylate isopentenyltransferase 87.81
KOG4658|consensus 889 87.8
TIGR03796 710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 87.79
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 87.78
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 87.78
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 87.76
PF00519 432 PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 87.68
COG0488 530 Uup ATPase components of ABC transporters with dup 87.65
PRK13546 264 teichoic acids export protein ATP-binding subunit; 87.6
PLN03232 1495 ABC transporter C family member; Provisional 87.59
PRK14268 258 phosphate ABC transporter ATP-binding protein; Pro 87.58
COG1493 308 HprK Serine kinase of the HPr protein, regulates c 87.58
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 87.56
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 87.55
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 87.53
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 87.51
PRK10867 433 signal recognition particle protein; Provisional 87.49
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 87.42
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 87.39
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 87.3
PLN03130 1622 ABC transporter C family member; Provisional 87.28
cd03288 257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 87.27
cd03291 282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 87.18
PHA02774 613 E1; Provisional 87.09
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 87.08
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 87.02
COG4167 267 SapF ABC-type antimicrobial peptide transport syst 86.98
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 86.95
PF01695 178 IstB_IS21: IstB-like ATP binding protein; InterPro 86.94
PRK14246 257 phosphate ABC transporter ATP-binding protein; Pro 86.89
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, Ls 86.82
CHL00195 489 ycf46 Ycf46; Provisional 86.75
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 86.75
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 86.71
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 86.69
>KOG2484|consensus Back     alignment and domain information
Probab=99.95  E-value=5.2e-28  Score=193.55  Aligned_cols=137  Identities=39%  Similarity=0.621  Sum_probs=118.4

Q ss_pred             hHHHHHHHHHHHhhhccEEEEEEeCCCCCCCCcHHHHHHHhCC-CCCcEEEEeecCCCCCcccccccHHHHHHHHhhhhc
Q psy8220          10 RGVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGT-PGKKLVIVINKAGKPSTKIQSGSMAQIFQTWIPYNS   88 (161)
Q Consensus        10 ~~~~~~~~~~~~i~~aDviL~VvD~~~~~~~~~~~i~~~l~~~-~~k~~ilVlNK~Dl~~~~~~~~~~~~~~~~~~~~~~   88 (161)
                      ..++.+++ ++.++.+||||+|+|||+|+++.+.++++.+... +++.+|+|+||+||+|.        +.++.|..|++
T Consensus       133 ~kaY~ke~-rkvve~sDVVleVlDARDPlgtR~~~vE~~V~~~~gnKkLILVLNK~DLVPr--------Ev~e~Wl~YLr  203 (435)
T KOG2484|consen  133 KKAYDKEF-RKVVEASDVVLEVLDARDPLGTRCPEVEEAVLQAHGNKKLILVLNKIDLVPR--------EVVEKWLVYLR  203 (435)
T ss_pred             HHHHHHHH-HHHHhhhheEEEeeeccCCCCCCChhHHHHHHhccCCceEEEEeehhccCCH--------HHHHHHHHHHH
Confidence            44788888 8999999999999999999999999999988542 45999999999999998        88899999998


Q ss_pred             cCCCCceeEEeecCCCCcchhhhhhhhccccccCHHHHHHHHHhHhhcCCCCCceEEEEEeecCCCcccccC
Q psy8220          89 IQSIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTRNKDIKTSITVGVVGECNIAGSIRDL  160 (161)
Q Consensus        89 ~~~~~~~i~iSa~~~~~~~~~~~~~~~~~~~~~g~~~L~~~l~~~~~~~~~~~~~~v~vvG~pNVGKSsl~~  160 (161)
                        ..+|.++|-|.++.++.+   ....+.+.+.|.+.|++.|.+|......++.|+|||||+|||||||+|.
T Consensus       204 --~~~ptv~fkast~~~~~~---~~~~~~s~c~gae~l~~~lgny~~~~~lk~sIrvGViG~PNVGKSSvIN  270 (435)
T KOG2484|consen  204 --REGPTVAFKASTQMQNSN---SKNLQSSVCFGAETLMKVLGNYCRKGELKTSIRVGIIGYPNVGKSSVIN  270 (435)
T ss_pred             --hhCCcceeeccccccccc---ccccccchhhhHHHHHHHhcCcccccccCcceEeeeecCCCCChhHHHH
Confidence              678889998888755543   3344555678999999999999988777788999999999999999985



>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>KOG1249|consensus Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>PRK05428 HPr kinase/phosphorylase; Provisional Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG2004|consensus Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>KOG0781|consensus Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>KOG2749|consensus Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 2e-11
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 5e-10
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 4e-07
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 2e-06
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 4e-05
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 3e-04
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 4e-04
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
 Score = 59.2 bits (144), Expect = 2e-11
 Identities = 26/136 (19%), Positives = 57/136 (41%), Gaps = 31/136 (22%)

Query: 19  RSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQ 78
              ++  D++ E+VDAR PM +R  + ED++     K  ++++NKA K    +       
Sbjct: 18  TEKLKLIDIVYELVDARIPMSSRNPMIEDIL---KNKPRIMLLNKADKADAAVT------ 68

Query: 79  IFQTWIPYNSIQSIYSSPRFSSRSQK----DAQTERDLKAINVSSCVGAELLMLLLGNYT 134
             Q W  +           F ++  +    ++   + L  I  +    ++ ++    +  
Sbjct: 69  --QQWKEH-----------FENQGIRSLSINSVNGQGLNQIVPA----SKEILQEKFDRM 111

Query: 135 RNKDIKT-SITVGVVG 149
           R K +K  +I   ++G
Sbjct: 112 RAKGVKPRAIRALIIG 127


>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 99.92
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 99.86
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.8
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.8
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.78
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 99.78
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.73
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.64
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.63
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.59
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.58
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.3
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.28
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 99.27
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.19
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.16
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.15
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.15
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.12
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.1
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.08
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.07
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.05
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.01
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.95
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.94
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 98.94
1wb1_A 482 Translation elongation factor SELB; selenocysteine 98.9
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.89
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.88
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 98.88
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.87
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.86
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.86
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.86
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.86
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.85
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.84
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.84
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.84
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.84
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.83
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.83
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 98.81
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.81
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 98.81
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.8
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.79
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 98.79
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.79
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.78
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 98.78
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 98.78
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.78
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.77
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.77
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.76
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.76
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.76
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.76
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 98.76
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.76
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.76
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.75
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.74
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.74
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.74
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.74
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.74
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.74
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 98.73
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.73
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.73
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 98.71
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.71
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.71
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 98.7
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.7
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.7
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.7
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.69
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.69
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.69
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.68
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.68
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.68
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.68
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.68
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 98.68
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.67
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.66
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.66
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.66
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.65
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.65
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.65
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.65
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.65
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.65
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.65
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.65
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.65
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 98.64
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.64
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.64
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.64
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.63
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.63
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.62
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.62
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.62
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.62
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.61
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.61
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.61
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 98.61
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.61
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.61
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.61
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.6
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.6
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.59
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.59
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.59
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.58
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.58
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.58
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.56
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.56
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.55
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.54
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.54
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.53
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 98.52
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 98.52
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.92
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.52
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.51
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.51
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 98.49
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.48
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.48
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.48
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.48
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.47
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.46
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.46
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.45
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.44
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.44
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.43
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.43
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 98.42
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.41
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 98.4
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.39
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.39
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 98.37
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 98.36
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.36
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.34
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 98.34
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 98.33
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 98.33
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 98.31
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 98.31
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.31
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 98.3
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.29
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.28
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 98.28
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.25
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 98.25
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 98.25
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.23
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 98.22
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.22
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.2
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 98.19
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.18
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.15
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.14
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.13
3lxw_A247 GTPase IMAP family member 1; immunity, structural 98.08
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.08
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 98.06
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.06
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.02
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 98.01
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.0
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 97.95
1wxq_A397 GTP-binding protein; structural genomics, riken st 97.92
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 97.89
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 97.88
3lxx_A239 GTPase IMAP family member 4; structural genomics c 97.82
1nrj_B218 SR-beta, signal recognition particle receptor beta 97.78
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 97.66
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.66
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.5
2ged_A 193 SR-beta, signal recognition particle receptor beta 97.49
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 97.42
2hf9_A226 Probable hydrogenase nickel incorporation protein 97.39
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.39
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.35
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 97.34
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 97.28
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 97.27
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 97.25
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 97.18
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 97.18
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 97.17
2ged_A193 SR-beta, signal recognition particle receptor beta 97.16
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 97.14
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.12
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.07
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 97.03
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 97.03
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 97.02
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 97.0
2hf9_A 226 Probable hydrogenase nickel incorporation protein 96.9
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 96.86
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 96.86
1lnz_A 342 SPO0B-associated GTP-binding protein; GTPase, OBG, 96.84
1ko7_A 314 HPR kinase/phosphatase; protein kinase, phosphotra 96.81
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 96.77
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 96.69
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 96.62
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 96.53
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 96.52
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 96.47
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 96.44
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 96.4
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 96.21
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 96.18
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 96.15
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 96.1
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 96.03
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 96.03
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 95.95
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 95.91
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 95.86
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 95.83
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 95.78
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 95.7
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.65
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 95.57
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 95.43
3ec2_A 180 DNA replication protein DNAC; helicase loader, rep 95.34
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 95.27
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.15
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 95.11
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 94.9
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 94.68
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 94.68
1jbk_A 195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.6
1jal_A363 YCHF protein; nucleotide-binding fold, structural 94.47
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 94.43
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 94.31
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 94.16
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 94.15
2p65_A 187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.0
1tue_A 212 Replication protein E1; helicase, replication, E1E 93.6
2chg_A 226 Replication factor C small subunit; DNA-binding pr 93.5
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 93.42
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 93.41
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 93.23
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 93.17
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 93.07
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 92.96
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 92.8
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 92.78
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 92.77
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 92.77
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 92.72
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 92.71
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 92.6
2w58_A 202 DNAI, primosome component (helicase loader); ATP-b 92.59
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 92.54
3bos_A 242 Putative DNA replication factor; P-loop containing 92.37
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 92.24
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 92.22
2og2_A 359 Putative signal recognition particle receptor; nuc 92.13
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 92.05
2kjq_A149 DNAA-related protein; solution structure, NESG, st 92.01
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 91.94
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 91.69
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 91.68
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 91.53
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 91.53
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 91.53
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 91.51
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 91.43
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 91.38
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 91.31
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 91.19
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 91.16
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 90.85
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 90.81
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 90.76
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 90.49
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 90.25
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 90.22
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 90.22
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 90.09
2xxa_A 433 Signal recognition particle protein; protein trans 90.05
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 90.04
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 89.9
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 89.89
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 89.79
2ghi_A 260 Transport protein; multidrug resistance protein, M 89.7
1sgw_A 214 Putative ABC transporter; structural genomics, P p 89.65
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 89.62
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 89.56
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 89.53
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 89.46
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 89.31
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 89.3
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 89.19
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 89.1
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 89.01
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 88.96
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 88.95
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 88.89
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 88.87
2r6a_A 454 DNAB helicase, replicative helicase; replication, 88.86
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 88.83
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 88.75
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 88.73
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 88.71
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 88.56
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 88.56
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 88.55
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 88.5
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 88.43
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 88.35
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 88.22
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 88.14
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 88.13
2qgz_A 308 Helicase loader, putative primosome component; str 88.12
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 87.96
3end_A 307 Light-independent protochlorophyllide reductase ir 87.95
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 87.9
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 87.79
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 87.63
2ewv_A 372 Twitching motility protein PILT; pilus retraction 87.59
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 87.45
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 87.41
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 87.4
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 87.31
2r44_A 331 Uncharacterized protein; putative ATPase, structur 87.12
1knx_A 312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 87.01
2chq_A 319 Replication factor C small subunit; DNA-binding pr 86.99
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 86.99
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 86.82
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 86.76
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 86.74
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 86.63
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 86.59
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 86.33
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 86.27
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 86.19
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 86.11
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 86.04
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 86.03
2pt7_A 330 CAG-ALFA; ATPase, protein-protein complex, type IV 85.97
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 85.7
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 85.55
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 85.5
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 85.4
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 85.33
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 85.24
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 85.01
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 85.0
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 84.85
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 84.85
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 84.65
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 84.62
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 84.54
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 84.48
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 84.41
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 84.31
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 84.3
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 84.22
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 84.12
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 84.08
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 83.85
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 83.76
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 83.48
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 83.4
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 83.39
3pvs_A 447 Replication-associated recombination protein A; ma 83.29
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 83.08
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 83.05
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 82.95
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 82.88
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 82.53
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 82.47
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 82.33
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 82.32
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 82.09
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 81.94
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 81.58
1p9r_A 418 General secretion pathway protein E; bacterial typ 81.56
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 81.46
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 81.4
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 81.24
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 81.19
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 80.87
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 80.44
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 80.3
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
Probab=99.92  E-value=6.1e-25  Score=172.13  Aligned_cols=124  Identities=23%  Similarity=0.290  Sum_probs=101.6

Q ss_pred             CCcchHHHHHHHHHHHhhhccEEEEEEeCCCCCCCCcHHHHHHHhCCCCCcEEEEeecCCCCCcccccccHHHHHHHHhh
Q psy8220           6 PMEMRGVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQIFQTWIP   85 (161)
Q Consensus         6 p~~~~~~~~~~~~~~~i~~aDviL~VvD~~~~~~~~~~~i~~~l~~~~~k~~ilVlNK~Dl~~~~~~~~~~~~~~~~~~~   85 (161)
                      |.|+.. .++++ ++.+++||+|++|+|+++|.++.++.+.+++   .++|.++|+||+||++.        +..+.|.+
T Consensus         7 PGhm~k-a~~~~-~~~l~~aDvVl~VvDAr~p~~~~~~~l~~~l---~~kp~ilVlNK~DL~~~--------~~~~~~~~   73 (282)
T 1puj_A            7 PGHMAK-ARREV-TEKLKLIDIVYELVDARIPMSSRNPMIEDIL---KNKPRIMLLNKADKADA--------AVTQQWKE   73 (282)
T ss_dssp             --CTTH-HHHHH-HHHGGGCSEEEEEEETTSTTTTSCHHHHHHC---SSSCEEEEEECGGGSCH--------HHHHHHHH
T ss_pred             chHHHH-HHHHH-HHHHhhCCEEEEEEeCCCCCccCCHHHHHHH---CCCCEEEEEECcccCCH--------HHHHHHHH
Confidence            889885 58888 7999999999999999999998888888876   46999999999999986        55678888


Q ss_pred             hhccCCCCceeEEeecCCCCcchhhhhhhhccccccCHHHHHHHHHhHhhc-------CC-CCCceEEEEEeecCCCccc
Q psy8220          86 YNSIQSIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTRN-------KD-IKTSITVGVVGECNIAGSI  157 (161)
Q Consensus        86 ~~~~~~~~~~i~iSa~~~~~~~~~~~~~~~~~~~~~g~~~L~~~l~~~~~~-------~~-~~~~~~v~vvG~pNVGKSs  157 (161)
                      ++.. .+.+++++||.++                 .|+++|.+.+.+.++.       .+ ...++++++||.|||||||
T Consensus        74 ~~~~-~g~~~i~iSA~~~-----------------~gi~~L~~~i~~~l~~~~~~~~~~~~~~~~~~v~~vG~~nvGKSs  135 (282)
T 1puj_A           74 HFEN-QGIRSLSINSVNG-----------------QGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKST  135 (282)
T ss_dssp             HHHT-TTCCEEECCTTTC-----------------TTGGGHHHHHHHHHHHHHHHHHHTTCCCCCEEEEEEESTTSSHHH
T ss_pred             HHHh-cCCcEEEEECCCc-----------------ccHHHHHHHHHHHHHHHHHHHHhcCCCCCCceEEEEecCCCchHH
Confidence            8752 3568899999988                 8899988888776642       11 2356899999999999999


Q ss_pred             ccC
Q psy8220         158 RDL  160 (161)
Q Consensus       158 l~~  160 (161)
                      |++
T Consensus       136 liN  138 (282)
T 1puj_A          136 LIN  138 (282)
T ss_dssp             HHH
T ss_pred             HHH
Confidence            985



>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d1puja_ 273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 9e-10
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]
 Score = 53.7 bits (128), Expect = 9e-10
 Identities = 23/119 (19%), Positives = 43/119 (36%), Gaps = 3/119 (2%)

Query: 19  RSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQ 78
              ++  D++ E+VDAR PM +R  + ED++     K  ++++NKA K    +       
Sbjct: 10  TEKLKLIDIVYELVDARIPMSSRNPMIEDIL---KNKPRIMLLNKADKADAAVTQQWKEH 66

Query: 79  IFQTWIPYNSIQSIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTRNK 137
                I   SI S+                +     +         +  L++G     K
Sbjct: 67  FENQGIRSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGK 125


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 99.94
d1u0la2 225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 99.56
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.47
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.46
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 99.43
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.41
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.36
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.25
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.23
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.19
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.17
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.17
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.13
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.11
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.1
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.05
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 98.92
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.91
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.83
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.75
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.74
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.69
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.65
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.62
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 98.6
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.6
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.55
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.54
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.54
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.53
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.49
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.49
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.49
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.48
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.46
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.43
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.42
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.42
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.4
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.38
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.36
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.36
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.32
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 98.32
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.27
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.25
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.23
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 98.18
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.12
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.11
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.08
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.07
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.04
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 97.98
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.97
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 97.92
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 97.88
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 97.87
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 97.84
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 97.76
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.75
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.73
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 97.7
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 97.68
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 97.5
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.48
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 97.28
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.24
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.18
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.06
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.86
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.8
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.79
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.16
d1jbka_ 195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.94
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.9
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 94.88
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.78
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 94.75
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 94.3
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 94.17
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 94.13
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 93.72
d1tuea_ 205 Replication protein E1 helicase domain {Human papi 93.31
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 93.21
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.86
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 92.82
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 92.74
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 92.69
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 92.59
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 92.46
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 92.35
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 92.17
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 92.05
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.59
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 91.58
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 91.46
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 91.35
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 91.16
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 91.13
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 90.28
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 89.4
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 88.54
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 86.92
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 86.54
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 86.14
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 84.84
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 84.6
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 84.46
d1s2da_167 Purine transdeoxyribosylase {Lactobacillus helveti 81.81
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 81.63
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]
Probab=99.94  E-value=1.8e-27  Score=183.73  Aligned_cols=122  Identities=23%  Similarity=0.273  Sum_probs=97.4

Q ss_pred             cchHHHHHHHHHHHhhhccEEEEEEeCCCCCCCCcHHHHHHHhCCCCCcEEEEeecCCCCCcccccccHHHHHHHHhhhh
Q psy8220           8 EMRGVVVQEIERSVVEAADVILEVVDARDPMGTRCKVAEDLVVGTPGKKLVIVINKAGKPSTKIQSGSMAQIFQTWIPYN   87 (161)
Q Consensus         8 ~~~~~~~~~~~~~~i~~aDviL~VvD~~~~~~~~~~~i~~~l~~~~~k~~ilVlNK~Dl~~~~~~~~~~~~~~~~~~~~~   87 (161)
                      ||.. .++++ ++.++.+|+||+|+||+.|.++.++.+.+++.   ++|+|+|+||+||++.        +....|.+++
T Consensus         1 Hm~k-a~r~i-~~~i~~~DvIl~V~DaR~P~ss~~~~l~~~~~---~Kp~IlVlNK~DLv~~--------~~~~~w~~~f   67 (273)
T d1puja_           1 HMAK-ARREV-TEKLKLIDIVYELVDARIPMSSRNPMIEDILK---NKPRIMLLNKADKADA--------AVTQQWKEHF   67 (273)
T ss_dssp             CTTH-HHHHH-HHHGGGCSEEEEEEETTSTTTTSCHHHHHHCS---SSCEEEEEECGGGSCH--------HHHHHHHHHH
T ss_pred             CHHH-HHHHH-HHHHHhCCEEEEEEECCCCCCCCCHHHHHHHc---CCCeEEEEECccCCch--------HHHHHHHHHH
Confidence            5664 58899 79999999999999999999999999998774   5999999999999987        6678899988


Q ss_pred             ccCCCCceeEEeecCCCCcchhhhhhhhccccccCHHHHHHHHHhHhhc-------C-CCCCceEEEEEeecCCCccccc
Q psy8220          88 SIQSIYSSPRFSSRSQKDAQTERDLKAINVSSCVGAELLMLLLGNYTRN-------K-DIKTSITVGVVGECNIAGSIRD  159 (161)
Q Consensus        88 ~~~~~~~~i~iSa~~~~~~~~~~~~~~~~~~~~~g~~~L~~~l~~~~~~-------~-~~~~~~~v~vvG~pNVGKSsl~  159 (161)
                      .. .+.+.+++|+.++                 .|...+.+.+.+.+..       . ....+++|+|||+|||||||||
T Consensus        68 ~~-~~~~~i~isa~~~-----------------~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~v~vvG~PNvGKSsli  129 (273)
T d1puja_          68 EN-QGIRSLSINSVNG-----------------QGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKSTLI  129 (273)
T ss_dssp             HT-TTCCEEECCTTTC-----------------TTGGGHHHHHHHHHHHHHHHHHHTTCCCCCEEEEEEESTTSSHHHHH
T ss_pred             Hh-cCCccceeecccC-----------------CCccccchhhhhhhhhhhhhhhhccCCCCceEEEEEecCccchhhhh
Confidence            63 3566888999887                 4555554444433321       2 2346799999999999999998


Q ss_pred             C
Q psy8220         160 L  160 (161)
Q Consensus       160 ~  160 (161)
                      +
T Consensus       130 N  130 (273)
T d1puja_         130 N  130 (273)
T ss_dssp             H
T ss_pred             h
Confidence            5



>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s2da_ c.23.14.1 (A:) Purine transdeoxyribosylase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure