Psyllid ID: psy8311

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----

MSPTFCDHCGSLLSSVTSRLRAAHQRSSSDSDLPLVDEENVFGRAITRRRGAIKHQKVHQVKGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHKKCHDKLLTKCSGSGRESESTIYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEELQVVDLLYEIYEVIVFGFQYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEVCFSFCNTFSPPRLSDEKALDVPI

cccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccc

ccccEccccccEcHcccccccEEEEEccEEEEEEccccccccccccccccccccHccEEEEccccEEEEccccccEccccccEcccccccEEEEcccccEEcHHHHccccccccccccccccccccccEEEEcccccEEEEccccccEccccccEcccccccEEEEccccHHHHHHHHHHHcccccccccccccccccccEEEEccccccEccccccEcccccccEEEEccccccHHHHHHHHcccHccccccc

msptfcdhcgsLLSSVTSRLRAAhqrsssdsdlplvdeenvFGRAITRRRGAIKHQKVHQVKGHYFVakffrqptfcAFCKDFlwgfgkqgyqcqtcqtavhkkchdklltkcsgsgresestIYLRErfkidvphrfkpynfmsptfcdhcgsllyglfrqglkceeLQVVDLLYEIYEVIVFGFQYLRErfkidvphrfkpynfmsptfcdhcgsllyglfrqglkcevcfsfcntfspprlsdekaldvpi

msptfcdhcgSLLSSVTSRLRAAHqrsssdsdlplvdeENVFGRAITRrrgaikhqkvhqVKGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHKKCHDKlltkcsgsgresestiylrerfkidvpHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEELQVVDLLYEIYEVIVFGFQYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEVCFSFCNtfspprlsdekaldvpi

***************************************NVFGRAITRRRGAIKHQKVHQVKGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHKKCHDKLLTKCSG*****ESTIYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEELQVVDLLYEIYEVIVFGFQYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEVCFSFCNTF***************

MSPTFCDHCGSLLSSVTSRLRAAHQRSSSDS**************************VHQVKGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHKKCHDKLLTKCSGSGRESESTIYL**RFKIDVPHRFKPYNFMSPTFCDHC*******************VDLLYEIYEVIVFGFQYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEVCFSFCNTFSPPRLSDEKALDVPI

********CGSLLSSVT**************DLPLVDEENVFGRAITRRRGAIKHQKVHQVKGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHKKCHDKLLTKC*********TIYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEELQVVDLLYEIYEVIVFGFQYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEVCFSFCNTFSPPRLS*********

*SPTFCDHCGSLLSSVTSRLRAAHQRSSSDSDLPLVDE***********RGAIKHQKVHQVKGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHKKCHDKLLTKCSGSGRESESTIYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEELQVVDLLYEIYEVIVFGFQYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEVCFSFCNTFSPPRLSDEKALDVP*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		254
FB\|FBgn0259680		671	Pkcdelta "Protein kinase C del	0.503	0.190	0.789	2.6e-54
WB\|WBGene00006599		704	tpa-1 [Caenorhabditis elegans	0.582	0.210	0.589	1.9e-51
ZFIN\|ZDB-GENE-041210-195		721	prkcq "protein kinase C, theta	0.606	0.213	0.562	9.6e-46
UNIPROTKB\|E1C5S5		687	PRKCD "Uncharacterized protein	0.496	0.183	0.619	1.4e-45
UNIPROTKB\|F1P3G1		699	PRKCD "Uncharacterized protein	0.496	0.180	0.619	1.9e-45
ZFIN\|ZDB-GENE-030131-6503		684	prkcda "protein kinase C, delt	0.547	0.203	0.566	2.3e-45
UNIPROTKB\|F1PDX2		672	PRKCD "Protein kinase C delta	0.472	0.178	0.633	5.6e-45
UNIPROTKB\|Q5PU49		674	PRKCD "Protein kinase C delta	0.472	0.178	0.633	5.6e-45
UNIPROTKB\|I3LR85		675	PRKCD "Uncharacterized protein	0.472	0.177	0.625	1.3e-44
RGD\|67383		673	Prkcd "protein kinase C, delta	0.511	0.193	0.583	1.6e-44

FB\|FBgn0259680 Pkcdelta "Protein kinase C delta" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 561 (202.5 bits), Expect = 2.6e-54, P = 2.6e-54
 Identities = 101/128 (78%), Positives = 106/128 (82%)

Query:    44 RAITRRRGAIKHQKVHQVKGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHK 103
             R+IT RRGAIKHQK H + GH FVAKFFRQPTFCAFC  FLWGFGKQGYQC  CQT VHK
Sbjct:   125 RSITNRRGAIKHQKTHDINGHRFVAKFFRQPTFCAFCNLFLWGFGKQGYQCIICQTVVHK 184

Query:   104 KCHDKLLTKCSGSGRESESTIYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQG 163
             KCHDKLL KCSGS   S STI LRERFKID+PHRFKP+ FMSPTFCDHCGSL+ G F QG
Sbjct:   185 KCHDKLLGKCSGSVFTSASTILLRERFKIDMPHRFKPHTFMSPTFCDHCGSLMGGFFIQG 244

Query:   164 LKCEELQV 171
             LKCEE  V
Sbjct:   245 LKCEECDV 252

GO:0004697 "protein kinase C activity" evidence=ISS

GO:0019992 "diacylglycerol binding" evidence=ISS

GO:0004674 "protein serine/threonine kinase activity" evidence=NAS

GO:0006468 "protein phosphorylation" evidence=IEA;NAS

GO:0005524 "ATP binding" evidence=IEA

GO:0035556 "intracellular signal transduction" evidence=IEA

WB\|WBGene00006599 tpa-1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-041210-195 prkcq "protein kinase C, theta" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C5S5 PRKCD "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P3G1 PRKCD "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-6503 prkcda "protein kinase C, delta a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PDX2 PRKCD "Protein kinase C delta type" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5PU49 PRKCD "Protein kinase C delta type" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LR85 PRKCD "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

RGD\|67383 Prkcd "protein kinase C, delta" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

 Score = 469 (170.2 bits), Expect = 1.6e-44, P = 1.6e-44
 Identities = 77/132 (58%), Positives = 101/132 (76%)

Query:    37 DEENVFGRAITRRRGAIKHQKVHQVKGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQT 96
             +EE +F      RRGAIK  K+H +K H F+A FF QPTFC+ CK+F+WG  KQGY+C+ 
Sbjct:   134 EEEAMF--PTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQ 191

Query:    97 CQTAVHKKCHDKLLTKCSGSGRESESTIYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLL 156
             C  A+HKKC DK++ +C+G+   S  TI+ +ERF ID+PHRFK YN+MSPTFCDHCG+LL
Sbjct:   192 CNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGTLL 251

Query:   157 YGLFRQGLKCEE 168
             +GL +QGLKCE+
Sbjct:   252 WGLVKQGLKCED 263

GO:0001666 "response to hypoxia" evidence=IEP

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISO

GO:0004697 "protein kinase C activity" evidence=ISO;ISS

GO:0004699 "calcium-independent protein kinase C activity" evidence=IDA

GO:0005515 "protein binding" evidence=IPI

GO:0005524 "ATP binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISO;IDA

GO:0005737 "cytoplasm" evidence=ISO;IDA

GO:0005739 "mitochondrion" evidence=IDA

GO:0005783 "endoplasmic reticulum" evidence=ISO;ISS

GO:0005829 "cytosol" evidence=ISO;IDA

GO:0005886 "plasma membrane" evidence=ISO;IDA

GO:0005911 "cell-cell junction" evidence=IEA;ISO

GO:0006468 "protein phosphorylation" evidence=ISO;IDA

GO:0006915 "apoptotic process" evidence=IEA;ISO

GO:0006917 "induction of apoptosis" evidence=IDA

GO:0006979 "response to oxidative stress" evidence=IMP

GO:0007049 "cell cycle" evidence=IEA

GO:0007568 "aging" evidence=IEP

GO:0008022 "protein C-terminus binding" evidence=IEA;ISO

GO:0008047 "enzyme activator activity" evidence=IEA;ISO

GO:0009408 "response to heat" evidence=IEP

GO:0009612 "response to mechanical stimulus" evidence=IEP

GO:0009749 "response to glucose stimulus" evidence=IEP

GO:0010243 "response to organic nitrogen" evidence=IEP

GO:0014070 "response to organic cyclic compound" evidence=IEP

GO:0015810 "aspartate transport" evidence=IMP

GO:0016020 "membrane" evidence=IDA

GO:0016064 "immunoglobulin mediated immune response" evidence=IEA;ISO

GO:0016363 "nuclear matrix" evidence=IEA;ISO

GO:0018107 "peptidyl-threonine phosphorylation" evidence=IEA;ISO

GO:0019899 "enzyme binding" evidence=ISO

GO:0019901 "protein kinase binding" evidence=IPI

GO:0023021 "termination of signal transduction" evidence=IEA;ISO

GO:0030837 "negative regulation of actin filament polymerization" evidence=ISO;ISS

GO:0032613 "interleukin-10 production" evidence=IEA;ISO

GO:0032615 "interleukin-12 production" evidence=IEA;ISO

GO:0032869 "cellular response to insulin stimulus" evidence=IEP

GO:0032930 "positive regulation of superoxide anion generation" evidence=ISO;ISS

GO:0032963 "collagen metabolic process" evidence=IMP

GO:0034351 "negative regulation of glial cell apoptotic process" evidence=ISO;ISS

GO:0035307 "positive regulation of protein dephosphorylation" evidence=IEA;ISO

GO:0035556 "intracellular signal transduction" evidence=IEA;IDA

GO:0042100 "B cell proliferation" evidence=IEA;ISO

GO:0042119 "neutrophil activation" evidence=IEA;ISO

GO:0042149 "cellular response to glucose starvation" evidence=IEP

GO:0042493 "response to drug" evidence=IEP

GO:0042542 "response to hydrogen peroxide" evidence=IEP

GO:0042742 "defense response to bacterium" evidence=ISO;ISS

GO:0043065 "positive regulation of apoptotic process" evidence=IMP

GO:0043200 "response to amino acid stimulus" evidence=IEP

GO:0043406 "positive regulation of MAP kinase activity" evidence=IMP

GO:0043407 "negative regulation of MAP kinase activity" evidence=IEA;ISO

GO:0043410 "positive regulation of MAPK cascade" evidence=IMP

GO:0043560 "insulin receptor substrate binding" evidence=IEA;ISO

GO:0045471 "response to ethanol" evidence=IEP

GO:0046326 "positive regulation of glucose import" evidence=IMP

GO:0046627 "negative regulation of insulin receptor signaling pathway" evidence=IEA;ISO

GO:0046777 "protein autophosphorylation" evidence=IDA

GO:0046872 "metal ion binding" evidence=IEA

GO:0048471 "perinuclear region of cytoplasm" evidence=IEA

GO:0050732 "negative regulation of peptidyl-tyrosine phosphorylation" evidence=IEA;ISO

GO:0051490 "negative regulation of filopodium assembly" evidence=ISO;ISS

GO:0070976 "TIR domain binding" evidence=IPI

GO:0090331 "negative regulation of platelet aggregation" evidence=ISO;ISS

GO:0090398 "cellular senescence" evidence=IEA;ISO

GO:1900163 "positive regulation of phospholipid scramblase activity" evidence=IEA;ISO

GO:2000304 "positive regulation of ceramide biosynthetic process" evidence=IEA;ISO

GO:2000753 "positive regulation of glucosylceramide catabolic process" evidence=IEA;ISO

GO:2000755 "positive regulation of sphingomyelin catabolic process" evidence=IEA;ISO

GO:2001022 "positive regulation of response to DNA damage stimulus" evidence=IEA;ISO

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		254
pfam00130		53	pfam00130, C1_1, Phorbol esters/diacylglycerol bin	2e-15
cd00029		50	cd00029, C1, Protein kinase C conserved region 1 (	1e-13
smart00109		50	smart00109, C1, Protein kinase C conserved region	5e-12
pfam00130		53	pfam00130, C1_1, Phorbol esters/diacylglycerol bin	7e-09
pfam00130		53	pfam00130, C1_1, Phorbol esters/diacylglycerol bin	7e-08
cd00029		50	cd00029, C1, Protein kinase C conserved region 1 (	1e-07
cd00029		50	cd00029, C1, Protein kinase C conserved region 1 (	1e-06
smart00109		50	smart00109, C1, Protein kinase C conserved region	2e-05
smart00109		50	smart00109, C1, Protein kinase C conserved region	4e-04

>gnl\|CDD\|215738 pfam00130, C1_1, Phorbol esters/diacylglycerol binding domain (C1 domain)	Back alignment and domain information

 Score = 68.2 bits (167), Expect = 2e-15
 Identities = 25/50 (50%), Positives = 33/50 (66%)

Query: 64  HYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHKKCHDKLLTKC 113
           H+FV + F+ PTFC  C +FLWG GKQG +C  C   VHK+CH  +  +C
Sbjct: 1   HHFVHRTFKSPTFCDHCGEFLWGLGKQGLKCSWCGLNVHKRCHSLVPPEC 50

This domain is also known as the Protein kinase C conserved region 1 (C1) domain. Length = 53

>gnl\|CDD\|237996 cd00029, C1, Protein kinase C conserved region 1 (C1)	Back alignment and domain information

>gnl\|CDD\|197519 smart00109, C1, Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains)	Back alignment and domain information

>gnl\|CDD\|215738 pfam00130, C1_1, Phorbol esters/diacylglycerol binding domain (C1 domain)	Back alignment and domain information

>gnl\|CDD\|215738 pfam00130, C1_1, Phorbol esters/diacylglycerol binding domain (C1 domain)	Back alignment and domain information

>gnl\|CDD\|237996 cd00029, C1, Protein kinase C conserved region 1 (C1)	Back alignment and domain information

>gnl\|CDD\|237996 cd00029, C1, Protein kinase C conserved region 1 (C1)	Back alignment and domain information

>gnl\|CDD\|197519 smart00109, C1, Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains)	Back alignment and domain information

>gnl\|CDD\|197519 smart00109, C1, Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		254
KOG0696\|consensus		683		99.92
KOG4236\|consensus		888		99.9
KOG0694\|consensus		694		99.81
KOG0696\|consensus		683		99.8
KOG0695\|consensus		593		99.6
PF00130		53	C1_1: Phorbol esters/diacylglycerol binding domain	99.42
KOG4236\|consensus		888		99.34
KOG0694\|consensus		694		99.34
PF00130		53	C1_1: Phorbol esters/diacylglycerol binding domain	99.28
cd00029		50	C1 Protein kinase C conserved region 1 (C1) . Cyst	99.23
smart00109		49	C1 Protein kinase C conserved region 1 (C1) domain	99.06
cd00029		50	C1 Protein kinase C conserved region 1 (C1) . Cyst	99.04
smart00109		49	C1 Protein kinase C conserved region 1 (C1) domain	98.83
KOG1169\|consensus		634		98.57
KOG1011\|consensus		1283		98.4
KOG1011\|consensus		1283		98.28
KOG0695\|consensus		593		98.09
KOG4239\|consensus		348		98.05
KOG1169\|consensus		634		97.89
KOG2996\|consensus		865		97.47
KOG4239\|consensus		348		97.2
KOG2996\|consensus		865		97.16
KOG3564\|consensus		604		97.07
KOG1170\|consensus		1099		96.84
PF03107		30	C1_2: C1 domain; InterPro: IPR004146 This short do	96.19
KOG0193\|consensus		678		95.97
PF07649		30	C1_3: C1-like domain; InterPro: IPR011424 This sho	94.56
PF03107		30	C1_2: C1 domain; InterPro: IPR004146 This short do	94.4
KOG0193\|consensus		678		93.66
KOG1453\|consensus		918		92.93
KOG1170\|consensus		1099		91.44
KOG1453\|consensus		918		91.31
KOG3564\|consensus		604		91.13
PF07649		30	C1_3: C1-like domain; InterPro: IPR011424 This sho	90.31
PF08746		43	zf-RING-like: RING-like domain; InterPro: IPR01485	88.4
PF00628		51	PHD: PHD-finger; InterPro: IPR019787 Zinc finger (	84.08

>KOG0696\|consensus	Back alignment and domain information

Probab=99.92  E-value=6.5e-27  Score=210.32  Aligned_cols=128  Identities=48%  Similarity=1.017  Sum_probs=115.3

Q ss_pred             ccccCcccccceeecCCCeEEEEeecCCccCcccccccCcccccceeccccceEEccccccccccccCCCCCCCcchhhh
Q psy8311          47 TRRRGAIKHQKVHQVKGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHKKCHDKLLTKCSGSGRESESTIYL  126 (254)
Q Consensus        47 ~~r~~~~~~~~~~~~~~H~f~~~~~~~p~~C~~C~~~i~g~~~qg~~C~~C~~~~Hk~C~~~~~~~C~~~~~~~~~~~~~  126 (254)
                      .-|+||++++.++.+++|.|.+..|++||||++|.+||||+++||++|++|.+++|++|++.+...|++.......+.  
T Consensus        29 f~RkGAlrqKnvhevk~HkF~aRFFKqPTfCsHCkDFiwGfgKQGfQCqvC~fvvHkrChefVtF~CPGadkg~dtDd--  106 (683)
T KOG0696|consen   29 FLRKGALRQKNVHEVKSHKFIARFFKQPTFCSHCKDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDD--  106 (683)
T ss_pred             HHhhhhhhhcchhhhccceeeehhccCCchhhhhhhheeccccCceeeeEEeehhhhhhcceEEEECCCCCCCCCCCC--
Confidence            358999999999999999999999999999999999999999999999999999999999999999998876544332  


Q ss_pred             hhccccccccccccccCCCCccccccccccccccccceecccceeeeeeeeeeeEE
Q psy8311         127 RERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEELQVVDLLYEIYEVI  182 (254)
Q Consensus       127 ~~~~~~~~~H~~~~~~~~~pt~C~~C~~~i~gl~kqgl~C~~C~~~~h~~~~~~~~  182 (254)
                           ....|.|..+++.+||||+||+.++.|+..||++|+.|++.||+. |++.+
T Consensus       107 -----pr~kHkf~~~tYssPTFCDhCGsLLyGl~HQGmKC~~C~mNVH~r-Cv~nV  156 (683)
T KOG0696|consen  107 -----PRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHHR-CVENV  156 (683)
T ss_pred             -----cccccceeeeecCCCchhhhHHHHHHHHHhcccccccccchHHHH-HhhcC
Confidence                 236799999999999999999999999999999999999999865 44433

>KOG4236\|consensus	Back alignment and domain information

>KOG0694\|consensus	Back alignment and domain information

>KOG0696\|consensus	Back alignment and domain information

>KOG0695\|consensus	Back alignment and domain information

>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger	Back alignment and domain information

>KOG4236\|consensus	Back alignment and domain information

>KOG0694\|consensus	Back alignment and domain information

>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger	Back alignment and domain information

>cd00029 C1 Protein kinase C conserved region 1 (C1)	Back alignment and domain information

>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains)	Back alignment and domain information

>cd00029 C1 Protein kinase C conserved region 1 (C1)	Back alignment and domain information

>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains)	Back alignment and domain information

>KOG1169\|consensus	Back alignment and domain information

>KOG1011\|consensus	Back alignment and domain information

>KOG1011\|consensus	Back alignment and domain information

>KOG0695\|consensus	Back alignment and domain information

>KOG4239\|consensus	Back alignment and domain information

>KOG1169\|consensus	Back alignment and domain information

>KOG2996\|consensus	Back alignment and domain information

>KOG4239\|consensus	Back alignment and domain information

>KOG2996\|consensus	Back alignment and domain information

>KOG3564\|consensus	Back alignment and domain information

>KOG1170\|consensus	Back alignment and domain information

>PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines	Back alignment and domain information

>KOG0193\|consensus	Back alignment and domain information

>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines	Back alignment and domain information

>PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines	Back alignment and domain information

>KOG0193\|consensus	Back alignment and domain information

>KOG1453\|consensus	Back alignment and domain information

>KOG1170\|consensus	Back alignment and domain information

>KOG1453\|consensus	Back alignment and domain information

>KOG3564\|consensus	Back alignment and domain information

>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines	Back alignment and domain information

>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO)	Back alignment and domain information

>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		254
3pfq_A		674	PKC-B, PKC-beta, protein kinase C beta type; phosp	6e-52
3pfq_A		674	PKC-B, PKC-beta, protein kinase C beta type; phosp	3e-26
3pfq_A		674	PKC-B, PKC-beta, protein kinase C beta type; phosp	2e-18
2enn_A		77	NPKC-theta, protein kinase C theta type; zinc bind	4e-32
2enn_A		77	NPKC-theta, protein kinase C theta type; zinc bind	3e-11
2enn_A		77	NPKC-theta, protein kinase C theta type; zinc bind	1e-09
2yuu_A		83	NPKC-delta, protein kinase C delta type; metal bin	1e-29
2yuu_A		83	NPKC-delta, protein kinase C delta type; metal bin	7e-12
2yuu_A		83	NPKC-delta, protein kinase C delta type; metal bin	3e-10
2db6_A		74	SH3 and cysteine rich domain 3; STAC3, C1 domain,	9e-20
2db6_A		74	SH3 and cysteine rich domain 3; STAC3, C1 domain,	3e-15
2db6_A		74	SH3 and cysteine rich domain 3; STAC3, C1 domain,	1e-13
2eli_A		85	Protein kinase C alpha type; PKC-alpha, PKC-A, str	2e-19
2eli_A		85	Protein kinase C alpha type; PKC-alpha, PKC-A, str	3e-15
2eli_A		85	Protein kinase C alpha type; PKC-alpha, PKC-A, str	6e-14
1y8f_A		66	UNC-13 homolog A, MUNC13-1; cysteine-rich domain,	2e-18
1y8f_A		66	UNC-13 homolog A, MUNC13-1; cysteine-rich domain,	7e-15
1y8f_A		66	UNC-13 homolog A, MUNC13-1; cysteine-rich domain,	2e-13
2enz_A		65	NPKC-theta, protein kinase C theta type; zinc bind	1e-16
2enz_A		65	NPKC-theta, protein kinase C theta type; zinc bind	1e-16
2enz_A		65	NPKC-theta, protein kinase C theta type; zinc bind	2e-15
1ptq_A		50	Protein kinase C delta type; phosphotransferase; 1	6e-16
1ptq_A		50	Protein kinase C delta type; phosphotransferase; 1	2e-13
1ptq_A		50	Protein kinase C delta type; phosphotransferase; 1	4e-12
1faq_A		52	RAF-1; transferase, serine/threonine-protein kinas	1e-15
1faq_A		52	RAF-1; transferase, serine/threonine-protein kinas	2e-08
1faq_A		52	RAF-1; transferase, serine/threonine-protein kinas	3e-07
3cxl_A		463	N-chimerin; SH2, RHO-GAP, structural genomics cons	1e-15
3cxl_A		463	N-chimerin; SH2, RHO-GAP, structural genomics cons	4e-07
3cxl_A		463	N-chimerin; SH2, RHO-GAP, structural genomics cons	1e-05
2row_A		84	RHO-associated protein kinase 2; ATP-binding, coil	1e-15
2row_A		84	RHO-associated protein kinase 2; ATP-binding, coil	4e-08
2row_A		84	RHO-associated protein kinase 2; ATP-binding, coil	6e-07
1rfh_A		59	RAS association (ralgds/AF-6) domain family 5; zin	1e-12
1rfh_A		59	RAS association (ralgds/AF-6) domain family 5; zin	2e-06
1rfh_A		59	RAS association (ralgds/AF-6) domain family 5; zin	3e-05
2fnf_X		72	Putative RAS effector NORE1; zinc, signal transduc	2e-12
2fnf_X		72	Putative RAS effector NORE1; zinc, signal transduc	2e-06
2fnf_X		72	Putative RAS effector NORE1; zinc, signal transduc	2e-05
2vrw_B		406	P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP	2e-08
2vrw_B		406	P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP	7e-05
3ky9_A		587	Proto-oncogene VAV; calponin homology domain, DBL	7e-07
3ky9_A		587	Proto-oncogene VAV; calponin homology domain, DBL	2e-04
1r79_A		84	Diacylglycerol kinase, delta; C1 domain, cystein-r	2e-06

>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674	Back alignment and structure

 Score =  178 bits (452), Expect = 6e-52
 Identities = 62/142 (43%), Positives = 83/142 (58%), Gaps = 7/142 (4%)

Query: 30  DSDLPLVDEENVFGRAITRRRGAIKHQKVHQVKGHYFVAKFFRQPTFCAFCKDFLWGFGK 89
           D        E         R+GA++ + VH+VK H F A+FF+QPTFC+ C DF+WGFGK
Sbjct: 4   DPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGK 63

Query: 90  QGYQCQTCQTAVHKKCHDKLLTKCSGSGRESESTIYLRERFKIDVPHRFKPYNFMSPTFC 149
           QG+QCQ C   VHK+CH+ +   C G+ +                 H+FK + + SPTFC
Sbjct: 64  QGFQCQVCSFVVHKRCHEFVTFSCPGADKGP-------ASDDPRSKHKFKIHTYSSPTFC 116

Query: 150 DHCGSLLYGLFRQGLKCEELQV 171
           DHCGSLLYGL  QG+KC+   +
Sbjct: 117 DHCGSLLYGLIHQGMKCDTCMM 138

PyMOL of 3pfq

>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674	Back alignment and structure

>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674	Back alignment and structure

>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Length = 77	Back alignment and structure

>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Length = 77	Back alignment and structure

>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Length = 77	Back alignment and structure

>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83	Back alignment and structure

>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83	Back alignment and structure

>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83	Back alignment and structure

>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85	Back alignment and structure

>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Length = 66	Back alignment and structure

>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Length = 66	Back alignment and structure

>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Length = 66	Back alignment and structure

>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Length = 65	Back alignment and structure

>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Length = 65	Back alignment and structure

>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Length = 65	Back alignment and structure

>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Length = 50	Back alignment and structure

>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Length = 50	Back alignment and structure

>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Length = 50	Back alignment and structure

>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Length = 52	Back alignment and structure

>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Length = 52	Back alignment and structure

>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Length = 52	Back alignment and structure

>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463	Back alignment and structure

>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463	Back alignment and structure

>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463	Back alignment and structure

>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 84	Back alignment and structure

>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 84	Back alignment and structure

>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Length = 84	Back alignment and structure

>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Length = 59	Back alignment and structure

>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Length = 59	Back alignment and structure

>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Length = 59	Back alignment and structure

>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Length = 72	Back alignment and structure

>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Length = 72	Back alignment and structure

>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Length = 72	Back alignment and structure

>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406	Back alignment and structure

>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406	Back alignment and structure

>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587	Back alignment and structure

>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587	Back alignment and structure

>1r79_A Diacylglycerol kinase, delta; C1 domain, cystein-rich zinc binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: g.49.1.1 Length = 84	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		254
3pfq_A		674	PKC-B, PKC-beta, protein kinase C beta type; phosp	99.91
2enn_A		77	NPKC-theta, protein kinase C theta type; zinc bind	99.83
2yuu_A		83	NPKC-delta, protein kinase C delta type; metal bin	99.77
3uej_A		65	NPKC-delta, protein kinase C delta type; proteine	99.65
2enz_A		65	NPKC-theta, protein kinase C theta type; zinc bind	99.64
2db6_A		74	SH3 and cysteine rich domain 3; STAC3, C1 domain,	99.63
1y8f_A		66	UNC-13 homolog A, MUNC13-1; cysteine-rich domain,	99.61
1ptq_A		50	Protein kinase C delta type; phosphotransferase; 1	99.6
2eli_A		85	Protein kinase C alpha type; PKC-alpha, PKC-A, str	99.59
2row_A		84	RHO-associated protein kinase 2; ATP-binding, coil	99.56
1faq_A		52	RAF-1; transferase, serine/threonine-protein kinas	99.48
2enz_A		65	NPKC-theta, protein kinase C theta type; zinc bind	99.47
1rfh_A		59	RAS association (ralgds/AF-6) domain family 5; zin	99.38
1ptq_A		50	Protein kinase C delta type; phosphotransferase; 1	99.38
4b6d_A		61	RAC GTPase-activating protein 1; signaling protein	99.37
2fnf_X		72	Putative RAS effector NORE1; zinc, signal transduc	99.37
1y8f_A		66	UNC-13 homolog A, MUNC13-1; cysteine-rich domain,	99.36
2eli_A		85	Protein kinase C alpha type; PKC-alpha, PKC-A, str	99.35
2db6_A		74	SH3 and cysteine rich domain 3; STAC3, C1 domain,	99.34
2enn_A		77	NPKC-theta, protein kinase C theta type; zinc bind	99.33
3uej_A		65	NPKC-delta, protein kinase C delta type; proteine	99.32
3pfq_A		674	PKC-B, PKC-beta, protein kinase C beta type; phosp	99.31
2yuu_A		83	NPKC-delta, protein kinase C delta type; metal bin	99.3
1r79_A		84	Diacylglycerol kinase, delta; C1 domain, cystein-r	99.24
2row_A		84	RHO-associated protein kinase 2; ATP-binding, coil	99.22
1rfh_A		59	RAS association (ralgds/AF-6) domain family 5; zin	99.18
1faq_A		52	RAF-1; transferase, serine/threonine-protein kinas	99.17
2fnf_X		72	Putative RAS effector NORE1; zinc, signal transduc	99.17
3cxl_A		463	N-chimerin; SH2, RHO-GAP, structural genomics cons	99.15
1kbe_A		49	Kinase suppressor of RAS; KSR, cysteine-rich domai	99.07
4b6d_A		61	RAC GTPase-activating protein 1; signaling protein	99.05
1kbe_A		49	Kinase suppressor of RAS; KSR, cysteine-rich domai	99.04
3ky9_A		587	Proto-oncogene VAV; calponin homology domain, DBL	98.93
2vrw_B		406	P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP	98.85
3cxl_A		463	N-chimerin; SH2, RHO-GAP, structural genomics cons	98.44
1r79_A		84	Diacylglycerol kinase, delta; C1 domain, cystein-r	98.42
3ky9_A		587	Proto-oncogene VAV; calponin homology domain, DBL	98.32
2vrw_B		406	P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP	98.26
1v5n_A		89	PDI-like hypothetical protein AT1G60420; DC1 domai	92.77
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	82.45

>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A	Back alignment and structure

Probab=99.91  E-value=1.7e-25  Score=218.01  Aligned_cols=146  Identities=45%  Similarity=0.912  Sum_probs=49.6

Q ss_pred             CCCCcccccccccccccccCcccccceeecCCCeEEEEeecCCccCcccccccCcccccceeccccceEEcccccccccc
Q psy8311          32 DLPLVDEENVFGRAITRRRGAIKHQKVHQVKGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHKKCHDKLLT  111 (254)
Q Consensus        32 ~~~~~~~~k~~~~~~~~r~~~~~~~~~~~~~~H~f~~~~~~~p~~C~~C~~~i~g~~~qg~~C~~C~~~~Hk~C~~~~~~  111 (254)
                      +.++..++...   ...|++|++.++++.+++|.|..++|.+|+||++|+++|||+++|||+|..|++++|++|...+..
T Consensus         9 ~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~H~f~~~~~~~p~~C~~C~~~i~g~~~qg~~C~~C~~~~H~~C~~~v~~   85 (674)
T 3pfq_A            9 PPPSEGEESTV---RFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCSFVVHKRCHEFVTF   85 (674)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCCCCcccchh---hhhccCcccccCCcccCCceEEeeeCCCCCccccccccccccCCceeECCCCCCCcChhhcCcCcc
Confidence            44444444422   235788999888999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCcchhhhhhccccccccccccccCCCCccccccccccccccccceecccceeeeeeeeeeeEEeeccccccc
Q psy8311         112 KCSGSGRESESTIYLRERFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEELQVVDLLYEIYEVIVFGFQYLRE  191 (254)
Q Consensus       112 ~C~~~~~~~~~~~~~~~~~~~~~~H~~~~~~~~~pt~C~~C~~~i~gl~kqgl~C~~C~~~~h~~~~~~~~~~~~~~~~~  191 (254)
                      .|+........                                                                     
T Consensus        86 ~c~~~~~~~~~---------------------------------------------------------------------   96 (674)
T 3pfq_A           86 SCPGADKGPAS---------------------------------------------------------------------   96 (674)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cCCCccccccc---------------------------------------------------------------------
Confidence            99755321000                                                                     


Q ss_pred             cccCCCcceeeeccCCCCCccccccccccccccceEeccccCccccCCCccCCCccccc
Q psy8311         192 RFKIDVPHRFKPYNFMSPTFCDHCGSLLYGLFRQGLKCEVCFSFCNTFSPPRLSDEKAL  250 (254)
Q Consensus       192 ~~~~~~~H~f~~~~~~~pt~C~~C~~~~~g~~~qg~~C~~C~~~~H~~C~~~~~~~~~~  250 (254)
                       ....++|+|..+++..+++|++|+++++|+.+||++|.||++++|.+|...++..+..
T Consensus        97 -~~~~~~h~~~~~~~~~~~~C~~C~~~l~g~~~qg~~C~~C~~~~H~~C~~~v~~~C~~  154 (674)
T 3pfq_A           97 -DDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGT  154 (674)
T ss_dssp             ------CCCCCEECCSSCCCCSSSCSCCBBSSSCEECCSSSCCCBCSSTTSSSCCCSSS
T ss_pred             -ccccCCcceeecCCCCCCCCCccccccchhhcCccccccCCcchhhhhhhccCccccc
Confidence             0012579999999999999999999999999999999999999999999998877643

PyMOL of 3pfq

>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A*	Back alignment and structure

>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus}	Back alignment and structure

>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A*	Back alignment and structure

>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus}	Back alignment and structure

>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A	Back alignment and structure

>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus}	Back alignment and structure

>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A*	Back alignment and structure

>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens}	Back alignment and structure

>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus}	Back alignment and structure

>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus}	Back alignment and structure

>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A*	Back alignment and structure

>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A	Back alignment and structure

>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1r79_A Diacylglycerol kinase, delta; C1 domain, cystein-rich zinc binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: g.49.1.1	Back alignment and structure

>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus}	Back alignment and structure

>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus}	Back alignment and structure

>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A	Back alignment and structure

>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus}	Back alignment and structure

>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A	Back alignment and structure

>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A	Back alignment and structure

>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens}	Back alignment and structure

>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A	Back alignment and structure

>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A	Back alignment and structure

>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A	Back alignment and structure

>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A	Back alignment and structure

>1r79_A Diacylglycerol kinase, delta; C1 domain, cystein-rich zinc binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: g.49.1.1	Back alignment and structure

>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A	Back alignment and structure

>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A	Back alignment and structure

>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		254
d1xa6a3		62	g.49.1.1 (A:209-270) Beta-chimaerin, middle domain	4e-16
d1xa6a3		62	g.49.1.1 (A:209-270) Beta-chimaerin, middle domain	2e-10
d1xa6a3		62	g.49.1.1 (A:209-270) Beta-chimaerin, middle domain	4e-09
d1tbna_		66	g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus	2e-14
d1tbna_		66	g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus	5e-09
d1tbna_		66	g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus	1e-07
d1ptqa_		50	g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {M	3e-14
d1ptqa_		50	g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {M	6e-10
d1ptqa_		50	g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {M	1e-08
d1r79a_		84	g.49.1.1 (A:) Diacylglycerol kinase delta {Human (	4e-14
d1r79a_		84	g.49.1.1 (A:) Diacylglycerol kinase delta {Human (	5e-12
d1r79a_		84	g.49.1.1 (A:) Diacylglycerol kinase delta {Human (	7e-11
d1faqa_		52	g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId:	1e-11
d1faqa_		52	g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId:	7e-06
d1faqa_		52	g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId:	1e-04
d1kbea_		49	g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse	1e-08
d1kbea_		49	g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse	1e-06
d1kbea_		49	g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse	2e-05

>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62	Back information, alignment and structure


class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain)
domain: Beta-chimaerin, middle domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 68.5 bits (167), Expect = 4e-16
 Identities = 20/57 (35%), Positives = 28/57 (49%)

Query: 62  KGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHKKCHDKLLTKCSGSGR 118
           K H F    FR P +C +C +F+WG   QG +C  C   VHK+C   +   C    +
Sbjct: 3   KTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLK 59

PyMOL of d1xa6a3

>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62	Back information, alignment and structure

>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62	Back information, alignment and structure

>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Length = 66	Back information, alignment and structure

>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Length = 66	Back information, alignment and structure

>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Length = 66	Back information, alignment and structure

>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Length = 50	Back information, alignment and structure

>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Length = 50	Back information, alignment and structure

>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Length = 50	Back information, alignment and structure

>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Length = 84	Back information, alignment and structure

>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Length = 49	Back information, alignment and structure

>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Length = 49	Back information, alignment and structure

>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Length = 49	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		254
d1xa6a3		62	Beta-chimaerin, middle domain {Human (Homo sapiens	99.56
d1tbna_		66	Protein kinase c-gamma {Rat (Rattus rattus) [TaxId	99.55
d1ptqa_		50	Protein kinase C-delta (PKCdelta) {Mouse (Mus musc	99.54
d1tbna_		66	Protein kinase c-gamma {Rat (Rattus rattus) [TaxId	99.37
d1faqa_		52	RAF-1 {Human (Homo sapiens) [TaxId: 9606]}	99.34
d1ptqa_		50	Protein kinase C-delta (PKCdelta) {Mouse (Mus musc	99.33
d1r79a_		84	Diacylglycerol kinase delta {Human (Homo sapiens)	99.29
d1xa6a3		62	Beta-chimaerin, middle domain {Human (Homo sapiens	99.29
d1kbea_		49	Kinase suppressor of Ras, Ksr {Mouse (Mus musculus	99.23
d1r79a_		84	Diacylglycerol kinase delta {Human (Homo sapiens)	99.14
d1faqa_		52	RAF-1 {Human (Homo sapiens) [TaxId: 9606]}	99.1
d1kbea_		49	Kinase suppressor of Ras, Ksr {Mouse (Mus musculus	99.03
d1v5na_		89	Pdi-like hypothetical protein At1g60420 {Thale cre	93.02

>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain)
domain: Beta-chimaerin, middle domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.56  E-value=6.5e-16  Score=103.52  Aligned_cols=57  Identities=35%  Similarity=0.884  Sum_probs=53.9

Q ss_pred             cCCCeEEEEeecCCccCcccccccCcccccceeccccceEEccccccccccccCCCC
Q psy8311          61 VKGHYFVAKFFRQPTFCAFCKDFLWGFGKQGYQCQTCQTAVHKKCHDKLLTKCSGSG  117 (254)
Q Consensus        61 ~~~H~f~~~~~~~p~~C~~C~~~i~g~~~qg~~C~~C~~~~Hk~C~~~~~~~C~~~~  117 (254)
                      .++|.|+..+|..|++|++|+++|||+.+|||+|++|++.+|++|...++..|....
T Consensus         2 ~k~H~F~~~~~~~pt~C~~C~~~i~g~~~~g~~C~~C~~~~H~~C~~~v~~~C~~~~   58 (62)
T d1xa6a3           2 EKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDL   58 (62)
T ss_dssp             CCCCCCCEECCSSCCBCTTTCCBCCTTTTCEECCSSSCCCBCTGGGTTSCSCCCTTT
T ss_pred             CCCCEEEEeeCCCCCCCcccCccccccccCeEEcCCCCchhhHHHHhhCCCcCCCCh
Confidence            479999999999999999999999999999999999999999999999999998654

PyMOL of d1xa6a3

>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure