Psyllid ID: psy8319


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MGRLKKQGKTLKSFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVINGSYTKLGFYDTQADNLTWFDRERWIGGKVPQDRTQIRKVLRTISVPLVICMWTVATVGILFAVGLIIFNICYRHRRVIASSHPVCNTIMLVGIAFCMSLNFNLPFACEPAAKLALEDVNNATDLLPGFKLQLHWNDSECEPGLGASVMYNLLYNNPQKLMLLAGCSTVCTTVAEAAKMWNLVVKKVEPWKLYTMVTGLLSIDLVILLCWQFYDPLQRITENFPLETPPKSSADDIKISPELEHCESRNNNIWYGFFNRHLQVLGVKIPEI
cHHHHHccccccccccccHHHHHHHHHHHHccEEEEEEEEEEEcccccEEEEEEEEEEEcccEEEEEEEEcccccEEEcccEEEEcccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHEEEcccEEEEEcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEEccccccccHHHHHHHHHHccccEEEEEccccccEEHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHEEEEEEccccEEEEccccccccccccccEEEEcEEEEEcccccHHHHHHHHHHHHEEEEEcccc
ccHHHHccccccccccccHHHHHHHHHHHHcccEEEccEEEEEccccccEEEEEEEEEccccEEEEEEEEcccccEEEccccEEcccccccccEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccHHEEEEHHHHHHHHHcccccccccHEEEccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEEEccccccEccHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHccccccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHEcccccc
mgrlkkqgktlksFTYTNKEIADDIYAAINstqftgvsgdvafssqgdrIALTQIEQVINGSytklgfydtqadnltwfdrerwiggkvpqdrTQIRKVLRTISVPLVICMWTVATVGILFAVGLIIFNICYRhrrviasshpvcNTIMLVGIAFCMSlnfnlpfacePAAKLALEDVnnatdllpgfklqlhwndsecepglgaSVMYNLLYNNPQKLMLLAGCSTVCTTVAEAAKMWNLVVKKVEPWKLYTMVTGLLSIDLVILLCWQFydplqritenfpletppkssaddikispelehcesrnnniWYGFFNRHLQVLGVKIPEI
mgrlkkqgktlkSFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVINGSYTKLGFYDTQADNLTWFDRERWiggkvpqdrtqirKVLRTISVPLVICMWTVATVGILFAVGLIIFNICYRHRRVIASSHPVCNTIMLVGIAFCMSLNFNLPFACEPAAKLALEDVNNATDLLPGFKLQLHWNDSECEPGLGASVMYNLLYNNPQKLMLLAGCSTVCTTVAEAAKMWNLVVKKVEPWKLYTMVTGLLSIDLVILLCWQFYDPLQRITEnfpletppkssADDIKISPELEHCESRNNNIWYGFFNRHLQVLGVKIPEI
MGRLKKQGKTLKSFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVINGSYTKLGFYDTQADNLTWFDRERWIGGKVPQDRTQIRKVLRTISVPLVICMWTVATVGILFAVGLIIFNICYRHRRVIASSHPVCNTIMLVGIAFCMSLNFNLPFACEPAAKLALEDVNNATDLLPGFKLQLHWNDSECEPGLGASVMYNLLYNNPQKLMLLAGCSTVCTTVAEAAKMWNLVVKKVEPWKLYTMVTGLLSIDLVILLCWQFYDPLQRITENFPLETPPKSSADDIKISPELEHCESRNNNIWYGFFNRHLQVLGVKIPEI
************SFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVINGSYTKLGFYDTQADNLTWFDRERWIGGKVPQDRTQIRKVLRTISVPLVICMWTVATVGILFAVGLIIFNICYRHRRVIASSHPVCNTIMLVGIAFCMSLNFNLPFACEPAAKLALEDVNNATDLLPGFKLQLHWNDSECEPGLGASVMYNLLYNNPQKLMLLAGCSTVCTTVAEAAKMWNLVVKKVEPWKLYTMVTGLLSIDLVILLCWQFYDPLQRITENF*********************CESRNNNIWYGFFNRHLQVLGVKI***
*******GKTLKSFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVINGSYTKLGFYDTQADNLTWFDRERWIGGKVPQDRTQIRKVLRTISVPLVICMWTVATVGILFAVGLIIFNICYRHRRVIASSHPVCNTIMLVGIAFCMSLNFNLPFACEPAAKLALEDVNNATDLLPGFKLQLHWNDSECEPGLGASVMYNLLYNNPQKLMLLAGCSTVCTTVAEAAKMWNLVVKKVEPWKLYTMVTGLLSIDLVILLCWQFYDPLQRITENFPLETPPKSSADDIKISPELEHCESRNNNIWYGFFNRHLQVLGVKIP**
********KTLKSFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVINGSYTKLGFYDTQADNLTWFDRERWIGGKVPQDRTQIRKVLRTISVPLVICMWTVATVGILFAVGLIIFNICYRHRRVIASSHPVCNTIMLVGIAFCMSLNFNLPFACEPAAKLALEDVNNATDLLPGFKLQLHWNDSECEPGLGASVMYNLLYNNPQKLMLLAGCSTVCTTVAEAAKMWNLVVKKVEPWKLYTMVTGLLSIDLVILLCWQFYDPLQRITENFPLETPPKSSADDIKISPELEHCESRNNNIWYGFFNRHLQVLGVKIPEI
*G****QGKTLKSFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVINGSYTKLGFYDTQADNLTWFDRERWIGGKVPQDRTQIRKVLRTISVPLVICMWTVATVGILFAVGLIIFNICYRHRRVIASSHPVCNTIMLVGIAFCMSLNFNLPFACEPAAKLALEDVNNATDLLPGFKLQLHWNDSECEPGLGASVMYNLLYNNPQKLMLLAGCSTVCTTVAEAAKMWNLVVKKVEPWKLYTMVTGLLSIDLVILLCWQFYDPLQRITENFPLETPPKSSADDIKISPELEHCESRNNNIWYGFFNRHLQVLGVKIP**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRLKKQGKTLKSFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVINGSYTKLGFYDTQADNLTWFDRERWIGGKVPQDRTQIRKVLRTISVPLVICMWTVATVGILFAVGLIIFNICYRHRRVIASSHPVCNTIMLVGIAFCMSLNFNLPFACEPAAKLALEDVNNATDLLPGFKLQLHWNDSECEPGLGASVMYNLLYNNPQKLMLLAGCSTVCTTVAEAAKMWNLVVKKVEPWKLYTMVTGLLSIDLVILLCWQFYDPLQRITENFPLETPPKSSADDIKISPELEHCESRNNNIWYGFFNRHLQVLGVKIPEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query330
FB|FBgn0260446 840 GABA-B-R1 "metabotropic GABA-B 0.475 0.186 0.681 6.6e-82
UNIPROTKB|B0UXY8 899 GABBR1 "Gamma-aminobutyric aci 0.478 0.175 0.411 4.7e-45
UNIPROTKB|F1P6E5 929 GABBR1 "Uncharacterized protei 0.478 0.170 0.411 5.3e-45
UNIPROTKB|Q9UBS5 961 GABBR1 "Gamma-aminobutyric aci 0.478 0.164 0.411 6e-45
UNIPROTKB|K7GNS7 898 LOC100738146 "Uncharacterized 0.478 0.175 0.411 9.6e-45
MGI|MGI:1860139 960 Gabbr1 "gamma-aminobutyric aci 0.478 0.164 0.411 9.7e-45
UNIPROTKB|K7GP86 960 LOC100738146 "Uncharacterized 0.478 0.164 0.411 1.2e-44
UNIPROTKB|F1MF15 961 GABBR1 "Uncharacterized protei 0.478 0.164 0.411 1.2e-44
RGD|621537 991 Gabbr1 "gamma-aminobutyric aci 0.478 0.159 0.411 7.5e-44
UNIPROTKB|Q9Z0U4 991 Gabbr1 "Gamma-aminobutyric aci 0.478 0.159 0.411 7.5e-44
FB|FBgn0260446 GABA-B-R1 "metabotropic GABA-B receptor subtype 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 565 (203.9 bits), Expect = 6.6e-82, Sum P(2) = 6.6e-82
 Identities = 107/157 (68%), Positives = 128/157 (81%)

Query:     1 MGRLKKQGKTLKSFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVIN 60
             M RL    K+L+ FTYT+KEIAD+IYAA+NSTQF GVSG VAFSSQGDRIALTQIEQ+I+
Sbjct:   362 MERLTTGKKSLRDFTYTDKEIADEIYAAMNSTQFLGVSGVVAFSSQGDRIALTQIEQMID 421

Query:    61 GSYTKLGFYDTQADNLTWFDRERWIGGKVPQDRTQIRKVLRTISVPLVICMWTVATVGIL 120
             G Y KLG+YDTQ DNL+W + E+WIGGKVPQDRT +  VLRT+S+PL +CM T+++ GI 
Sbjct:   422 GKYEKLGYYDTQLDNLSWLNTEQWIGGKVPQDRTIVTHVLRTVSLPLFVCMCTISSCGIF 481

Query:   121 FAVGLIIFNICYRHRRVIASSHPVCNTIMLVGIAFCM 157
              A  LIIFNI  +HRRVI SSHPVCNTIML G+  C+
Sbjct:   482 VAFALIIFNIWNKHRRVIQSSHPVCNTIMLFGVIICL 518


GO:0004965 "G-protein coupled GABA receptor activity" evidence=ISS
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
UNIPROTKB|B0UXY8 GABBR1 "Gamma-aminobutyric acid type B receptor subunit 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6E5 GABBR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBS5 GABBR1 "Gamma-aminobutyric acid type B receptor subunit 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7GNS7 LOC100738146 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1860139 Gabbr1 "gamma-aminobutyric acid (GABA) B receptor, 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|K7GP86 LOC100738146 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MF15 GABBR1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|621537 Gabbr1 "gamma-aminobutyric acid (GABA) B receptor 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Z0U4 Gabbr1 "Gamma-aminobutyric acid type B receptor subunit 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
cd06366 350 cd06366, PBP1_GABAb_receptor, Ligand-binding domai 5e-25
pfam01094 343 pfam01094, ANF_receptor, Receptor family ligand bi 3e-10
cd06352 389 cd06352, PBP1_NPR_GC_like, Ligand-binding domain o 4e-09
cd06350 348 cd06350, PBP1_GPCR_family_C_like, Ligand-binding d 2e-08
cd06366350 cd06366, PBP1_GABAb_receptor, Ligand-binding domai 7e-07
cd06373 396 cd06373, PBP1_NPR_like, Ligand binding domain of n 6e-06
cd06269 298 cd06269, PBP1_glutamate_receptors_like, Family C G 1e-05
cd06370 404 cd06370, PBP1_Speract_GC_like, Ligand-binding doma 2e-05
cd04509 299 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family 1e-04
cd06268 298 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplas 8e-04
cd06386 387 cd06386, PBP1_NPR_C_like, Ligand-binding domain of 0.004
>gnl|CDD|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
 Score =  102 bits (257), Expect = 5e-25
 Identities = 35/78 (44%), Positives = 47/78 (60%)

Query: 166 ACEPAAKLALEDVNNATDLLPGFKLQLHWNDSECEPGLGASVMYNLLYNNPQKLMLLAGC 225
           A  PA ++ALEDVN    +LPG++L LH  DS+C+P   AS   +LL N P   ++   C
Sbjct: 16  AALPAIEMALEDVNADNSILPGYRLVLHVRDSKCDPVQAASAALDLLENKPVVAIIGPQC 75

Query: 226 STVCTTVAEAAKMWNLVV 243
           S+V   VAE A  WN+ V
Sbjct: 76  SSVAEFVAEVANEWNVPV 93


Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA). GABA is the major inhibitory neurotransmitter in the mammalian CNS and, like glutamate and other transmitters, acts via both ligand gated ion channels (GABAa receptors) and G-protein coupled receptors (GABAb). GABAa receptors are members of the ionotropic receptor superfamily which includes alpha-adrenergic and glycine receptors. The GABAb receptor is a member of a receptor superfamily which includes the mGlu receptors. The GABAb receptor is coupled to G alpha_i proteins, and activation causes a decrease in calcium, an increase in potassium membrane conductance, and inhibition of cAMP formation. The response is thus inhibitory and leads to hyperpolarization and decreased neurotransmitter release, for example. Length = 350

>gnl|CDD|216296 pfam01094, ANF_receptor, Receptor family ligand binding region Back     alignment and domain information
>gnl|CDD|107347 cd06352, PBP1_NPR_GC_like, Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>gnl|CDD|153138 cd06350, PBP1_GPCR_family_C_like, Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>gnl|CDD|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>gnl|CDD|107368 cd06373, PBP1_NPR_like, Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>gnl|CDD|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|107365 cd06370, PBP1_Speract_GC_like, Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>gnl|CDD|107261 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>gnl|CDD|107263 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>gnl|CDD|107381 cd06386, PBP1_NPR_C_like, Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 330
KOG1055|consensus 865 100.0
KOG1056|consensus 878 99.95
KOG1055|consensus 865 99.65
PF00003238 7tm_3: 7 transmembrane sweet-taste receptor of 3 G 99.55
cd06372 391 PBP1_GC_G_like Ligand-binding domain of membrane g 98.87
cd06379377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 98.87
cd06365469 PBP1_Pheromone_receptor Ligand-binding domain of t 98.84
cd06385 405 PBP1_NPR_A Ligand-binding domain of type A natriur 98.83
cd06364510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 98.76
cd06386 387 PBP1_NPR_C_like Ligand-binding domain of type C na 98.76
cd06373 396 PBP1_NPR_like Ligand binding domain of natriuretic 98.73
cd06365 469 PBP1_Pheromone_receptor Ligand-binding domain of t 98.7
cd06374 472 PBP1_mGluR_groupI Ligand binding domain of the gro 98.7
cd06362 452 PBP1_mGluR Ligand binding domain of the metabotrop 98.67
cd06375 458 PBP1_mGluR_groupII Ligand binding domain of the gr 98.62
cd06367362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 98.62
cd06376463 PBP1_mGluR_groupIII Ligand-binding domain of the g 98.61
cd06371 382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 98.58
PF01094 348 ANF_receptor: Receptor family ligand binding regio 98.56
cd06376 463 PBP1_mGluR_groupIII Ligand-binding domain of the g 98.54
cd06370 404 PBP1_Speract_GC_like Ligand-binding domain of memb 98.52
cd06366 350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 98.5
cd06350 348 PBP1_GPCR_family_C_like Ligand-binding domain of m 98.49
cd06361 403 PBP1_GPC6A_like Ligand-binding domain of the promi 98.49
cd06385405 PBP1_NPR_A Ligand-binding domain of type A natriur 98.49
cd06374472 PBP1_mGluR_groupI Ligand binding domain of the gro 98.47
cd06363410 PBP1_Taste_receptor Ligand-binding domain of the T 98.43
cd06372391 PBP1_GC_G_like Ligand-binding domain of membrane g 98.41
cd06352 389 PBP1_NPR_GC_like Ligand-binding domain of membrane 98.39
cd06384 399 PBP1_NPR_B Ligand-binding domain of type B natriur 98.36
cd06362452 PBP1_mGluR Ligand binding domain of the metabotrop 98.36
cd06361403 PBP1_GPC6A_like Ligand-binding domain of the promi 98.35
cd06364 510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 98.2
cd06375458 PBP1_mGluR_groupII Ligand binding domain of the gr 98.2
cd06384399 PBP1_NPR_B Ligand-binding domain of type B natriur 98.17
cd06380382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 98.15
cd06390364 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin 98.09
cd06389370 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin 98.06
cd06382 327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 98.02
cd06369380 PBP1_GC_C_enterotoxin_receptor Ligand-binding doma 97.99
cd06386387 PBP1_NPR_C_like Ligand-binding domain of type C na 97.99
cd06373396 PBP1_NPR_like Ligand binding domain of natriuretic 97.93
cd06363 410 PBP1_Taste_receptor Ligand-binding domain of the T 97.93
cd06388371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 97.9
cd06391 400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 97.89
cd06391400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 97.84
cd06346 312 PBP1_ABC_ligand_binding_like_11 Type I periplasmic 97.84
cd06387372 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin 97.76
cd06380 382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 97.76
cd06269298 PBP1_glutamate_receptors_like Family C G-protein c 97.74
cd06392400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 97.73
cd06370404 PBP1_Speract_GC_like Ligand-binding domain of memb 97.71
cd06393 384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 97.66
cd06368 324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 97.58
cd06394 333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 97.57
cd06378362 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ 97.52
cd06338 345 PBP1_ABC_ligand_binding_like_5 Type I periplasmic 97.51
cd06393384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 97.44
cd06352389 PBP1_NPR_GC_like Ligand-binding domain of membrane 97.35
cd06342 334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 97.34
cd06392 400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 97.32
cd06367 362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 97.3
cd04509 299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 97.3
cd06345 344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 97.29
KOG4440|consensus 993 97.13
cd06383 368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 97.06
cd06377382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 96.98
cd06381363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 96.95
cd06371382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 96.93
cd06348 344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 96.92
cd06347 334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 96.92
cd06340 347 PBP1_ABC_ligand_binding_like_6 Type I periplasmic 96.83
cd06327 334 PBP1_SBP_like_1 Periplasmic solute-binding domain 96.75
cd06366350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 96.74
cd06344 332 PBP1_ABC_ligand_binding_like_9 Type I periplasmic 96.73
cd06330 346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 96.71
KOG1056|consensus 878 96.65
cd06349 340 PBP1_ABC_ligand_binding_like_14 Type I periplasmic 96.64
cd06336 347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 96.53
cd06351 328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 96.39
cd06329 342 PBP1_SBP_like_3 Periplasmic solute-binding domain 96.36
cd06382327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 96.11
cd06369 380 PBP1_GC_C_enterotoxin_receptor Ligand-binding doma 95.88
cd06333 312 PBP1_ABC-type_HAAT_like Type I periplasmic binding 95.7
cd06359 333 PBP1_Nba_like Type I periplasmic binding component 95.49
cd06326 336 PBP1_STKc_like Type I periplasmic binding domain o 95.08
cd06331 333 PBP1_AmiC_like Type I periplasmic components of am 94.98
cd06355 348 PBP1_FmdD_like Periplasmic component (FmdD) of an 94.93
cd06328 333 PBP1_SBP_like_2 Periplasmic solute-binding domain 94.9
PF01094348 ANF_receptor: Receptor family ligand binding regio 94.85
cd06394333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 94.69
cd06335 347 PBP1_ABC_ligand_binding_like_2 Type I periplasmic 94.66
cd06343 362 PBP1_ABC_ligand_binding_like_8 Type I periplasmic 94.65
cd06358 333 PBP1_NHase Type I periplasmic-binding protein of t 94.54
cd06334 351 PBP1_ABC_ligand_binding_like_1 Type I periplasmic 94.54
cd06379 377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 94.5
cd06268 298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 94.5
PRK15404 369 leucine ABC transporter subunit substrate-binding 94.21
KOG1054|consensus 897 94.12
COG0683 366 LivK ABC-type branched-chain amino acid transport 93.91
TIGR03669 374 urea_ABC_arch urea ABC transporter, substrate-bind 93.22
cd06360 336 PBP1_alkylbenzenes_like Type I periplasmic binding 93.09
cd06332 333 PBP1_aromatic_compounds_like Type I periplasmic bi 92.84
cd06350348 PBP1_GPCR_family_C_like Ligand-binding domain of m 92.61
cd06339 336 PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin 92.56
TIGR03407 359 urea_ABC_UrtA urea ABC transporter, urea binding p 92.48
cd06356 334 PBP1_Amide_Urea_BP_like Periplasmic component (Fmd 92.3
PRK15404369 leucine ABC transporter subunit substrate-binding 92.02
cd06383368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 91.86
cd06357 360 PBP1_AmiC Periplasmic binding domain of amidase (A 88.15
cd06381 363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 87.92
cd06368324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 87.87
TIGR03863 347 PQQ_ABC_bind ABC transporter, substrate binding pr 84.19
cd06337 357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 83.16
TIGR03407359 urea_ABC_UrtA urea ABC transporter, urea binding p 83.09
cd06355348 PBP1_FmdD_like Periplasmic component (FmdD) of an 83.06
PF13458 343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 82.96
cd06351328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 81.72
PF13458343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 81.13
>KOG1055|consensus Back     alignment and domain information
Probab=100.00  E-value=4.2e-43  Score=351.32  Aligned_cols=284  Identities=41%  Similarity=0.733  Sum_probs=259.6

Q ss_pred             CccccccCCCCCceecCChHHHHHHHHHHhcceEEeeeeeEEEccCCCcceeEEEEEeeCCcEEEEEEEECCCCceeecC
Q psy8319           1 MGRLKKQGKTLKSFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVINGSYTKLGFYDTQADNLTWFD   80 (330)
Q Consensus         1 ~~~l~~~~~~l~~f~y~~~~~~~~l~~~l~~vsF~GisG~V~Fd~nGdr~~~y~I~q~q~~~~v~VG~y~~~~~~l~~~~   80 (330)
                      |++|....++|+||+|+|++++++++++|+++||.|+||.|.|++ |||.+...|.|||+|+++++|.||+..+.+.|.+
T Consensus       360 ~e~l~~~~~~l~~f~y~~k~i~d~i~eamn~tsF~GvsG~V~F~~-geR~a~t~ieQ~qdg~y~k~g~Yds~~D~ls~~n  438 (865)
T KOG1055|consen  360 MEGLGRSHVRLEDFNYNNKTIADQIYEAMNSTSFEGVSGHVVFSN-GERMALTLIEQFQDGKYKKIGYYDSTKDDLSWIN  438 (865)
T ss_pred             HhcCCccceeccccchhhhHHHHHHHHHhhcccccccccceEecc-hhhHHHHHHHHHhCCceEeecccccccchhhccc
Confidence            456777889999999999999999999999999999999999998 9999999999999999999999999888999988


Q ss_pred             ccccCCCCCCCCccceeEEeeeechhHHHHHHHHHHHHHHHHHHhhheeeeecceeeEecCCccchhhhhhhhhhhcccc
Q psy8319          81 RERWIGGKVPQDRTQIRKVLRTISVPLVICMWTVATVGILFAVGLIIFNICYRHRRVIASSHPVCNTIMLVGIAFCMSLN  160 (330)
Q Consensus        81 ~i~W~~~~~P~s~~~~~~~~~~~~~~~~i~~~~~a~~gi~~~~~~~~~~i~~r~~~~Ik~Ss~~l~~~iliG~ll~~~~~  160 (330)
                      +.+|.+|.||.|.+.+++....++...++...+++.+|+.++..++.+++++|+.+.||+|+|++++++..|+.+++.++
T Consensus       439 ~~~w~~g~ppkd~Tv~~~~~~~~S~~~~~~~~~~s~Lg~~~~~~~l~f~~~~~~q~~i~~s~P~~nni~~~G~~~~~~sv  518 (865)
T KOG1055|consen  439 TEKWIGGSPPKDSTLIIKTFRFVSQKLYISVSSLSSLGIILAVVFLSFNIKNRNQRYIKMSSPNLNNLIIVGCSLTLASV  518 (865)
T ss_pred             cceEeccCCCcccceeehcccccCcchhhhhhHHHHHHHHHHHHhchhhhhhhhhhhhccCCCCCCcceeeccceeeeee
Confidence            88999889999999998999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             ccc------------ccchHHHHHHHHHhhhcCCCCCCCceEEEEeecCCcCCchhHHHHHHhhhccccEEEEeecccce
Q psy8319         161 FNL------------PFACEPAAKLALEDVNNATDLLPGFKLQLHWNDSECEPGLGASVMYNLLYNNPQKLMLLAGCSTV  228 (330)
Q Consensus       161 ~~~------------~~~c~~~~~~A~~~iN~~~~ll~gf~l~l~~~ds~c~~~~~~t~~~~~l~~k~~ri~~i~~cs~~  228 (330)
                      +..            +..|..+.          |.+.+||                 ++.+++++.|+|++-.++.    
T Consensus       519 ~~lgLd~~~Isv~~f~~lc~~r~----------w~l~~gf-----------------t~~~Gamf~K~w~Vh~if~----  567 (865)
T KOG1055|consen  519 FLLGLDGYSISVNAFPFLCTART----------WILGLGF-----------------TLAFGAMFAKTWRVHSIFT----  567 (865)
T ss_pred             eeccCCcceecHHHHHHHHHHHH----------HHHhhee-----------------ecccchhhhhhheeeEeec----
Confidence            873            58899988          9999999                 9999999999999665541    


Q ss_pred             eeehhhhhhcccceeecccCceEEeeehhHHHHHHHHHhcceEeecceecccccccCCCCCCCCCCeEEeeccccccccC
Q psy8319         229 CTTVAEAAKMWNLVVKKVEPWKLYTMVTGLLSIDLVILLCWQFYDPLQRITENFPLETPPKSSADDIKISPELEHCESRN  308 (330)
Q Consensus       229 ~~~va~~~~~w~~~~~~~~~~~l~~~v~~~~~v~li~~~~W~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~  308 (330)
                         .   -+.|   ++..+|..++.+|+++..+|+++++.|..+||+++++++|..+.+.  +++|+.+.|++++|.|++
T Consensus       568 ---~---~~~~---kK~~e~~Kl~~ivg~Ll~iD~~il~~WqivdPl~rt~ekl~~ep~~--~~~Dv~I~PelE~Ces~~  636 (865)
T KOG1055|consen  568 ---N---QKMW---KKVIEDSKLYVIVGLLLAIDVLILAIWQIVDPLHRTEEKLSKEPPK--NDRDVSIIPELEHCESEH  636 (865)
T ss_pred             ---c---cccc---ccccccceeEeehhHHHHhHHHHhhhhhccChhhhhhhhcCCCCCC--cccccccchhhhhhcccc
Confidence               1   1222   2457788899999999999999999999999999999999988765  477888999999999999


Q ss_pred             cchHHHHHHHH---Hhhhcccc
Q psy8319         309 NNIWYGFFNRH---LQVLGVKI  327 (330)
Q Consensus       309 ~~i~~~~~y~~---l~~~~~~~  327 (330)
                      +.+|++++|+|   |++||+++
T Consensus       637 ~~iwlgivya~KglllvfG~FL  658 (865)
T KOG1055|consen  637 MTIWLGIVYAYKGLLLLFGCFL  658 (865)
T ss_pred             cchhhhhhhhhhhHHHHHhHHh
Confidence            99999999998   78899875



>KOG1056|consensus Back     alignment and domain information
>KOG1055|consensus Back     alignment and domain information
>PF00003 7tm_3: 7 transmembrane sweet-taste receptor of 3 GCPR; InterPro: IPR017978 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>KOG1056|consensus Back     alignment and domain information
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C Back     alignment and domain information
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway Back     alignment and domain information
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides Back     alignment and domain information
>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional Back     alignment and domain information
>KOG1054|consensus Back     alignment and domain information
>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>TIGR03863 PQQ_ABC_bind ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query330
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 4e-20
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 2e-17
1dp4_A 435 Atrial natriuretic peptide receptor A; periplasmic 6e-17
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 3e-10
1jdp_A 441 NPR-C, atrial natriuretic peptide clearance recept 4e-16
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 2e-12
3h6g_A 395 Glutamate receptor, ionotropic kainate 2; membrane 3e-10
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 4e-05
3om0_A 393 Glutamate receptor, ionotropic kainate 5; membrane 2e-09
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 1e-06
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 2e-05
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 8e-05
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 2e-04
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 Back     alignment and structure
 Score = 89.6 bits (222), Expect = 4e-20
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 8   GKTLKSFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVINGSYTKLG 67
            + ++ F YT+  +   I  A+N T F GV+G V F + G+R+   +  Q  +    K+G
Sbjct: 341 HQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRN-GERMGTIKFTQFQDSREVKVG 399

Query: 68  FYDTQADNLTWFDRE-RWIGGKVPQDRT 94
            Y+  AD L   +   R+ G + P+D  
Sbjct: 400 EYNAVADTLEIINDTIRFQGSEPPKDDY 427


>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 99.39
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 98.98
4gpa_A389 Glutamate receptor 4; PBP fold, ligand-gated ION c 98.83
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 98.83
3ks9_A496 Mglur1, metabotropic glutamate receptor 1; glutama 98.65
1jdp_A 441 NPR-C, atrial natriuretic peptide clearance recept 98.65
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 98.61
1dp4_A 435 Atrial natriuretic peptide receptor A; periplasmic 98.6
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 98.58
2e4u_A 555 Metabotropic glutamate receptor 3; G-protein-coupl 98.54
3mq4_A481 Mglur7, metabotropic glutamate receptor 7; glutama 98.54
2e4u_A555 Metabotropic glutamate receptor 3; G-protein-coupl 98.52
3mq4_A 481 Mglur7, metabotropic glutamate receptor 7; glutama 98.52
3sm9_A479 Mglur3, metabotropic glutamate receptor 3; structu 98.51
3sm9_A 479 Mglur3, metabotropic glutamate receptor 3; structu 98.49
3o21_A 389 Glutamate receptor 3; periplasmatic binding protei 98.34
3ks9_A 496 Mglur1, metabotropic glutamate receptor 1; glutama 98.32
3om0_A 393 Glutamate receptor, ionotropic kainate 5; membrane 98.28
4gpa_A 389 Glutamate receptor 4; PBP fold, ligand-gated ION c 98.26
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 98.15
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 98.11
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 98.1
3qek_A 384 NMDA glutamate receptor subunit; amino terminal do 98.1
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 97.96
3h6g_A 395 Glutamate receptor, ionotropic kainate 2; membrane 97.86
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 97.83
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 97.81
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 97.75
3hsy_A 376 Glutamate receptor 2; ligand-gated ION channel, sy 97.68
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 97.58
3h5l_A 419 Putative branched-chain amino acid ABC transporter 97.55
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 97.47
3td9_A366 Branched chain amino acid ABC transporter, peripl 97.43
4gnr_A 353 ABC transporter substrate-binding protein-branche 97.41
4evq_A375 Putative ABC transporter subunit, substrate-bindi 97.29
3i45_A 387 Twin-arginine translocation pathway signal protei; 97.25
3n0x_A 374 Possible substrate binding protein of ABC transpo 97.05
3hut_A358 Putative branched-chain amino acid ABC transporter 97.03
3h5l_A419 Putative branched-chain amino acid ABC transporter 96.94
4f06_A 371 Extracellular ligand-binding receptor; PSI-biology 96.89
1usg_A346 Leucine-specific binding protein; leucine-binding 96.88
4gnr_A353 ABC transporter substrate-binding protein-branche 96.75
3td9_A 366 Branched chain amino acid ABC transporter, peripl 96.71
3ipc_A356 ABC transporter, substrate binding protein (amino; 96.6
3lop_A 364 Substrate binding periplasmic protein; protein str 96.51
3hut_A 358 Putative branched-chain amino acid ABC transporter 96.49
3eaf_A 391 ABC transporter, substrate binding protein; PSI2, 96.48
3ipc_A 356 ABC transporter, substrate binding protein (amino; 96.46
4eyg_A 368 Twin-arginine translocation pathway signal; PSI-bi 96.44
4eyg_A368 Twin-arginine translocation pathway signal; PSI-bi 96.44
3i09_A 375 Periplasmic branched-chain amino acid-binding Pro; 96.14
3n0w_A 379 ABC branched chain amino acid family transporter, 96.14
3lkb_A 392 Probable branched-chain amino acid ABC transporter 95.85
3ckm_A327 YRAM (HI1655), LPOA; periplasmic-binding protein, 95.69
1usg_A 346 Leucine-specific binding protein; leucine-binding 95.63
4evq_A 375 Putative ABC transporter subunit, substrate-bindi 95.42
1pea_A385 Amidase operon; gene regulator, receptor, binding 95.27
3lkb_A392 Probable branched-chain amino acid ABC transporter 95.15
3snr_A362 Extracellular ligand-binding receptor; structural 95.06
3sg0_A386 Extracellular ligand-binding receptor; structural 94.36
3eaf_A391 ABC transporter, substrate binding protein; PSI2, 94.35
3i45_A387 Twin-arginine translocation pathway signal protei; 94.25
1pea_A 385 Amidase operon; gene regulator, receptor, binding 94.02
3i09_A375 Periplasmic branched-chain amino acid-binding Pro; 93.75
3snr_A 362 Extracellular ligand-binding receptor; structural 93.47
4f06_A371 Extracellular ligand-binding receptor; PSI-biology 93.19
3sg0_A 386 Extracellular ligand-binding receptor; structural 92.73
2h4a_A325 YRAM (HI1655); perplasmic binding protein, lipopro 91.96
3n0x_A374 Possible substrate binding protein of ABC transpo 90.9
3n0w_A379 ABC branched chain amino acid family transporter, 89.98
3qel_B 364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 88.76
3lop_A364 Substrate binding periplasmic protein; protein str 81.86
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
Probab=99.39  E-value=8.6e-13  Score=127.84  Aligned_cols=86  Identities=31%  Similarity=0.581  Sum_probs=79.1

Q ss_pred             CCCCceecCChHHHHHHHHHHhcceEEeeeeeEEEccCCCcceeEEEEEeeCCcEEEEEEEECCCCceeec-CccccCCC
Q psy8319           9 KTLKSFTYTNKEIADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVINGSYTKLGFYDTQADNLTWF-DRERWIGG   87 (330)
Q Consensus         9 ~~l~~f~y~~~~~~~~l~~~l~~vsF~GisG~V~Fd~nGdr~~~y~I~q~q~~~~v~VG~y~~~~~~l~~~-~~i~W~~~   87 (330)
                      ..+++|+|++.+.+++|.++|++++|.|++|+|+| ++|||...|+|.|+|+|++++||.|+...+.|+++ +.|.|+++
T Consensus       342 ~~l~~~~~~~~~~~~~l~~~l~~~~f~G~tG~v~f-~~Gd~~~~~~I~~~~~g~~~~VG~~~~~~~~l~~~~~~i~W~~~  420 (433)
T 4f11_A          342 QRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVF-RNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGS  420 (433)
T ss_dssp             CCGGGCSSCCHHHHHHHHHHHHTCEEEETTEEEEE-ETTEEECEEEEEEEETTEEEEEEEEETTTTEEEECTTTCCCSSS
T ss_pred             CcccccccccHHHHHHHHHHHHhcEEEccceEEEE-ecCceeeeEEEEEEECCceEEEEEEECCCCeEEEeCCceECCCC
Confidence            35889999999999999999999999999999999 89999999999999999999999999877789887 67999999


Q ss_pred             CCCCCccc
Q psy8319          88 KVPQDRTQ   95 (330)
Q Consensus        88 ~~P~s~~~   95 (330)
                      .||.|++.
T Consensus       421 ~~P~D~~~  428 (433)
T 4f11_A          421 EPPKDDYK  428 (433)
T ss_dssp             SCCCSSGG
T ss_pred             CCCCCccc
Confidence            99999863



>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3ckm_A YRAM (HI1655), LPOA; periplasmic-binding protein, lipoprotein, unliganded, biosynthetic protein; 1.35A {Haemophilus influenzae} SCOP: c.93.1.1 Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 330
d1dp4a_ 425 c.93.1.1 (A:) Hormone binding domain of the atrial 3e-13
d1dp4a_425 c.93.1.1 (A:) Hormone binding domain of the atrial 3e-12
d1jdpa_ 401 c.93.1.1 (A:) Hormone binding domain of the atrial 7e-12
d1jdpa_401 c.93.1.1 (A:) Hormone binding domain of the atrial 1e-07
d1ewka_ 477 c.93.1.1 (A:) Metabotropic glutamate receptor subt 2e-04
d1usga_ 346 c.93.1.1 (A:) Leucine-binding protein {Escherichia 4e-04
d1qo0a_ 373 c.93.1.1 (A:) Amide receptor/negative regulator of 5e-04
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 425 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Hormone binding domain of the atrial natriuretic peptide receptor
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 67.9 bits (164), Expect = 3e-13
 Identities = 23/102 (22%), Positives = 40/102 (39%), Gaps = 9/102 (8%)

Query: 151 VGIAFCMSLNFNLPFA---CEPAAKLALEDVNNATDLLPGFKLQLHWNDSE-----CEPG 202
           V +   ++ N + P++     PA +LAL  V    DLLPG+ +++    SE     C   
Sbjct: 5   VAVVLPLT-NTSYPWSWARVGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDT 63

Query: 203 LGASVMYNLLYNNPQKLMLLAGCSTVCTTVAEAAKMWNLVVK 244
                  +L + +   + L  GC      V      W + + 
Sbjct: 64  AAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLL 105


>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 425 Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 401 Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 401 Back     information, alignment and structure
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 477 Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Length = 373 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query330
d1dp4a_425 Hormone binding domain of the atrial natriuretic p 99.24
d1ewka_ 477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 99.03
d1dp4a_ 425 Hormone binding domain of the atrial natriuretic p 98.79
d1ewka_477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 98.68
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 98.53
d1jdpa_ 401 Hormone binding domain of the atrial natriuretic p 98.47
d1qo0a_ 373 Amide receptor/negative regulator of the amidase o 97.11
d1usga_ 346 Leucine-binding protein {Escherichia coli [TaxId: 97.09
d1usga_346 Leucine-binding protein {Escherichia coli [TaxId: 96.98
d3ckma1317 YraM C-terminal domain {Haemophilus influenzae [Ta 95.93
d1qo0a_373 Amide receptor/negative regulator of the amidase o 90.26
d3ckma1 317 YraM C-terminal domain {Haemophilus influenzae [Ta 89.0
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Hormone binding domain of the atrial natriuretic peptide receptor
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.24  E-value=6.1e-12  Score=117.68  Aligned_cols=73  Identities=21%  Similarity=0.318  Sum_probs=63.9

Q ss_pred             HHHHHHHHhcceEEeeeeeEEEccCCCcceeEEEEEee--CCcEEEEEEEECCCCceee-c-CccccCCCCCCCCcc
Q psy8319          22 ADDIYAAINSTQFTGVSGDVAFSSQGDRIALTQIEQVI--NGSYTKLGFYDTQADNLTW-F-DRERWIGGKVPQDRT   94 (330)
Q Consensus        22 ~~~l~~~l~~vsF~GisG~V~Fd~nGdr~~~y~I~q~q--~~~~v~VG~y~~~~~~l~~-~-~~i~W~~~~~P~s~~   94 (330)
                      ++++.++|++++|+|++|+|+||+||||.+.|+|.++|  +|+++.||.|+..++.+.. + ++|.|++|.+|.|.+
T Consensus       345 ~~~l~~~l~~~~f~G~tG~v~fd~nGdr~~~y~i~~~~~~~~~~~~vg~~~~~~~~~~~~~~~~i~W~~~~~P~d~p  421 (425)
T d1dp4a_         345 GENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVP  421 (425)
T ss_dssp             HHHHHHTTTTEEEEETTEEEEECTTSBBCCCEEEEEECTTTCCEEEEEEECTTTCCEEESTTCCCCCTTSSCCCSSC
T ss_pred             HHHHHHHHhCCeEecCCeeEEECCCCCcccceEEEEEECCCCeEEEEEEEECCCCeEEecCCceeECCCCCCCCCCC
Confidence            35788999999999999999999999999999999997  5689999999977665654 3 689999999999865



>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure