Psyllid ID: psy832

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80

MYRYKPSPFLLLDEIDAALDNINIWKTIQYIRTVPKMNVIAVSLKPQFYFHSDILFGITLKMLGSLTIKGRVHKASLNSV

cccccccccEEEEccccccccHHHHHHHHHHHHccccEEEEEEEcccHHHcccEEEEEEEccccEEEEEEEEEccccccc

ccccccccEEEHHHHHHHHHcHcHHHHHHHHHHccccEEEEEEccHHHHHHHcHEEEEEEcccccEEEccEEEEEEcccc

myrykpspflLLDEIDAALDNINIWKTIQYIRTVPKMNVIAVslkpqfyfhsdiLFGITLKMLGSLTIKGRVHKASLNSV

myrykpspFLLLDEIDAALDNINIWKTIQYIRTVPKMNVIAVSLKPQFYFHSDILFGITLKMLGSltikgrvhkaslnsv

MYRYKPSPFLLLDEIDAALDNINIWKTIQYIRTVPKMNVIAVSLKPQFYFHSDILFGITLKMLGSLTIKGRVHKASLNSV

*******PFLLLDEIDAALDNINIWKTIQYIRTVPKMNVIAVSLKPQFYFHSDILFGITLKMLGSLTIKGRV********

*YRYKPSPFLLLDEIDAALDNINIWKTIQYIRTVPKMNVIAVSLKPQFYFHSDILFGITLKMLG*****G**********

MYRYKPSPFLLLDEIDAALDNINIWKTIQYIRTVPKMNVIAVSLKPQFYFHSDILFGITLKMLGSLTIKGRVHKASLNSV

*YRYKPSPFLLLDEIDAALDNINIWKTIQYIRTVPKMNVIAVSLKPQFYFHSDILFGITLKMLGSLTIKGRVHKASLNS*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooo

oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MYRYKPSPFLLLDEIDAALDNINIWKTIQYIRTVPKMNVIAVSLKPQFYFHSDILFGITLKMLGSLTIKGRVHKASLNSV

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		80
FB\|FBgn0040283		1238	SMC1 "SMC1" [Drosophila melano	0.725	0.046	0.525	8.5e-10
ZFIN\|ZDB-GENE-090506-9		1232	smc1a "structural maintenance	0.725	0.047	0.5	2.3e-09
ZFIN\|ZDB-GENE-040426-57		1233	smc1al "structural maintenance	0.725	0.047	0.5	2.3e-09
UNIPROTKB\|O93308		1232	smc1a "Structural maintenance	0.725	0.047	0.483	6e-09
UNIPROTKB\|Q8NDV3		1235	SMC1B "Structural maintenance	0.725	0.046	0.466	9.9e-09
UNIPROTKB\|G3X7C0		1232	SMC1A "Structural maintenance	0.725	0.047	0.483	1.6e-08
UNIPROTKB\|O97593		1233	SMC1A "Structural maintenance	0.725	0.047	0.483	1.6e-08
UNIPROTKB\|E2QV07		1233	SMC1A "Structural maintenance	0.725	0.047	0.483	1.6e-08
UNIPROTKB\|Q14683		1233	SMC1A "Structural maintenance	0.725	0.047	0.483	1.6e-08
UNIPROTKB\|F1SM58		1233	F1SM58 "Structural maintenance	0.725	0.047	0.466	1.6e-08

FB\|FBgn0040283 SMC1 "SMC1" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 155 (59.6 bits), Expect = 8.5e-10, P = 8.5e-10
 Identities = 31/59 (52%), Positives = 39/59 (66%)

Query:     2 YRYKPSPFLLLDEIDAALDNINIWKTIQYIRT-VPKMNVIAVSLKPQFYFHSDILFGIT 59
             + + P+PF +LDEIDAALDN NI K   YIR     +  I +SLK +FY H+D L GIT
Sbjct:  1158 HSFHPAPFFVLDEIDAALDNTNIGKVASYIRDHTTNLQTIVISLKEEFYGHADALVGIT 1216

GO:0003677 "DNA binding" evidence=ISS

GO:0008278 "cohesin complex" evidence=ISS;IDA;NAS

GO:0007062 "sister chromatid cohesion" evidence=ISS;NAS

GO:0030261 "chromosome condensation" evidence=IEA

GO:0006281 "DNA repair" evidence=IEA

GO:0006310 "DNA recombination" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0010629 "negative regulation of gene expression" evidence=IGI

GO:0005694 "chromosome" evidence=IDA

GO:0048813 "dendrite morphogenesis" evidence=IMP

GO:0016319 "mushroom body development" evidence=IMP

GO:0016322 "neuron remodeling" evidence=IMP

GO:0035327 "transcriptionally active chromatin" evidence=IDA

GO:0005634 "nucleus" evidence=IDA

GO:0005700 "polytene chromosome" evidence=IDA

ZFIN\|ZDB-GENE-090506-9 smc1a "structural maintenance of chromosomes 1A" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-57 smc1al "structural maintenance of chromosomes 1A, like" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|O93308 smc1a "Structural maintenance of chromosomes protein 1A" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8NDV3 SMC1B "Structural maintenance of chromosomes protein 1B" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|G3X7C0 SMC1A "Structural maintenance of chromosomes protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|O97593 SMC1A "Structural maintenance of chromosomes protein 1A" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QV07 SMC1A "Structural maintenance of chromosomes protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q14683 SMC1A "Structural maintenance of chromosomes protein 1A" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SM58 F1SM58 "Structural maintenance of chromosomes protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		80
cd03275		247	cd03275, ABC_SMC1_euk, ATP-binding cassette domain	9e-20
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	1e-12
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	3e-10
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-10
cd03278		197	cd03278, ABC_SMC_barmotin, ATP-binding cassette do	2e-08
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	1e-07
cd03239		178	cd03239, ABC_SMC_head, The SMC head domain belongs	3e-07
cd03273		251	cd03273, ABC_SMC2_euk, ATP-binding cassette domain	4e-07
cd03274		212	cd03274, ABC_SMC4_euk, ATP-binding cassette domain	7e-07
cd03272		243	cd03272, ABC_SMC3_euk, ATP-binding cassette domain	0.002

>gnl\|CDD\|213242 cd03275, ABC_SMC1_euk, ATP-binding cassette domain of eukaryotic SMC1 proteins	Back alignment and domain information

 Score = 79.2 bits (196), Expect = 9e-20
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 2/60 (3%)

Query: 1   MYRYKPSPFLLLDEIDAALDNINIWKTIQYIR--TVPKMNVIAVSLKPQFYFHSDILFGI 58
           ++ Y+P+PF +LDE+DAALDN N+ K   YIR    P    I +SLK +F+  +D L G+
Sbjct: 172 IHSYQPAPFFVLDEVDAALDNTNVGKVASYIREQAGPNFQFIVISLKEEFFSKADALVGV 231

The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18). Length = 247

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily	Back alignment and domain information

>gnl\|CDD\|213240 cd03273, ABC_SMC2_euk, ATP-binding cassette domain of eukaryotic SMC2 proteins	Back alignment and domain information

>gnl\|CDD\|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins	Back alignment and domain information

>gnl\|CDD\|213239 cd03272, ABC_SMC3_euk, ATP-binding cassette domain of eukaryotic SMC3 proteins	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		80
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	99.76
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	99.72
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	99.68
COG0444		316	DppD ABC-type dipeptide/oligopeptide/nickel transp	99.68
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	99.66
COG1122		235	CbiO ABC-type cobalt transport system, ATPase comp	99.66
cd03275		247	ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein	99.65
COG1123		539	ATPase components of various ABC-type transport sy	99.65
PRK14245		250	phosphate ABC transporter ATP-binding protein; Pro	99.63
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	99.63
PRK09536		402	btuD corrinoid ABC transporter ATPase; Reviewed	99.63
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	99.63
COG2274		709	SunT ABC-type bacteriocin/lantibiotic exporters, c	99.62
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	99.62
cd03246		173	ABCC_Protease_Secretion This family represents the	99.62
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	99.62
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	99.62
PRK13644		274	cbiO cobalt transporter ATP-binding subunit; Provi	99.62
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	99.62
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	99.62
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	99.62
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	99.62
cd03252		237	ABCC_Hemolysin The ABC-transporter hemolysin B is	99.61
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	99.61
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	99.61
PRK11614		237	livF leucine/isoleucine/valine transporter ATP-bin	99.61
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	99.61
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	99.61
PRK13537		306	nodulation ABC transporter NodI; Provisional	99.61
TIGR03411		242	urea_trans_UrtD urea ABC transporter, ATP-binding	99.61
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	99.61
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	99.61
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	99.61
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	99.61
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	99.61
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	99.61
PRK11022		326	dppD dipeptide transporter ATP-binding subunit; Pr	99.61
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	99.61
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	99.6
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	99.6
cd03251		234	ABCC_MsbA MsbA is an essential ABC transporter, cl	99.6
COG1131		293	CcmA ABC-type multidrug transport system, ATPase c	99.6
TIGR01188		302	drrA daunorubicin resistance ABC transporter ATP-b	99.6
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	99.6
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	99.6
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	99.6
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	99.6
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	99.6
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	99.6
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	99.6
PRK14239		252	phosphate transporter ATP-binding protein; Provisi	99.6
cd03289		275	ABCC_CFTR2 The CFTR subfamily domain 2. The cystic	99.6
COG1135		339	AbcC ABC-type metal ion transport system, ATPase c	99.6
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	99.6
PRK15093		330	antimicrobial peptide ABC transporter ATP-binding	99.6
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	99.59
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	99.59
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	99.59
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	99.59
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	99.59
TIGR02203		571	MsbA_lipidA lipid A export permease/ATP-binding pr	99.59
cd03216		163	ABC_Carb_Monos_I This family represents the domain	99.59
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	99.59
TIGR01288		303	nodI ATP-binding ABC transporter family nodulation	99.59
PRK13536		340	nodulation factor exporter subunit NodI; Provision	99.59
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	99.59
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	99.59
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	99.59
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	99.59
PRK11308		327	dppF dipeptide transporter ATP-binding subunit; Pr	99.59
PRK09473		330	oppD oligopeptide transporter ATP-binding componen	99.59
PRK14270		251	phosphate ABC transporter ATP-binding protein; Pro	99.59
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	99.59
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	99.59
TIGR00972		247	3a0107s01c2 phosphate ABC transporter, ATP-binding	99.59
PRK09493		240	glnQ glutamine ABC transporter ATP-binding protein	99.59
TIGR03375		694	type_I_sec_LssB type I secretion system ATPase, Ls	99.59
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	99.59
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	99.59
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	99.59
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	99.59
COG4988		559	CydD ABC-type transport system involved in cytochr	99.59
TIGR02314		343	ABC_MetN D-methionine ABC transporter, ATP-binding	99.59
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	99.59
PRK15079		331	oligopeptide ABC transporter ATP-binding protein O	99.59
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	99.59
COG4987		573	CydC ABC-type transport system involved in cytochr	99.59
PRK14244		251	phosphate ABC transporter ATP-binding protein; Pro	99.59
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	99.59
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	99.58
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	99.58
cd03253		236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	99.58
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	99.58
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	99.58
PRK13634		290	cbiO cobalt transporter ATP-binding subunit; Provi	99.58
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	99.58
PRK13636		283	cbiO cobalt transporter ATP-binding subunit; Provi	99.58
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	99.58
PRK14257		329	phosphate ABC transporter ATP-binding protein; Pro	99.58
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	99.58
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	99.58
PRK14255		252	phosphate ABC transporter ATP-binding protein; Pro	99.58
PRK10908		222	cell division protein FtsE; Provisional	99.58
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	99.58
PRK09580		248	sufC cysteine desulfurase ATPase component; Review	99.58
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	99.58
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	99.58
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	99.58
PRK11231		255	fecE iron-dicitrate transporter ATP-binding subuni	99.58
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	99.58
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	99.58
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	99.58
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	99.58
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	99.58
PRK14256		252	phosphate ABC transporter ATP-binding protein; Pro	99.58
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	99.58
PRK14249		251	phosphate ABC transporter ATP-binding protein; Pro	99.58
cd03298		211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	99.58
PRK11300		255	livG leucine/isoleucine/valine transporter ATP-bin	99.58
PRK14253		249	phosphate ABC transporter ATP-binding protein; Pro	99.58
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	99.58
TIGR03740		223	galliderm_ABC gallidermin-class lantibiotic protec	99.57
COG3638		258	ABC-type phosphate/phosphonate transport system, A	99.57
TIGR03410		230	urea_trans_UrtE urea ABC transporter, ATP-binding	99.57
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	99.57
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	99.57
PRK13639		275	cbiO cobalt transporter ATP-binding subunit; Provi	99.57
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	99.57
PRK14251		251	phosphate ABC transporter ATP-binding protein; Pro	99.57
PRK10938		490	putative molybdenum transport ATP-binding protein	99.57
PRK14240		250	phosphate transporter ATP-binding protein; Provisi	99.57
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	99.57
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	99.57
PRK13642		277	cbiO cobalt transporter ATP-binding subunit; Provi	99.57
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	99.57
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	99.57
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	99.57
cd03269		210	ABC_putative_ATPase This subfamily is involved in	99.57
cd03273		251	ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein	99.57
CHL00131		252	ycf16 sulfate ABC transporter protein; Validated	99.57
PRK14267		253	phosphate ABC transporter ATP-binding protein; Pro	99.57
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	99.57
PRK10771		232	thiQ thiamine transporter ATP-binding subunit; Pro	99.57
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	99.57
PRK14272		252	phosphate ABC transporter ATP-binding protein; Pro	99.57
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	99.57
cd03215		182	ABC_Carb_Monos_II This family represents domain II	99.57
TIGR03873		256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	99.56
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	99.56
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	99.56
cd03288		257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	99.56
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	99.56
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	99.56
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	99.56
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	99.56
TIGR03005		252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	99.56
PRK13652		277	cbiO cobalt transporter ATP-binding subunit; Provi	99.56
TIGR03522		301	GldA_ABC_ATP gliding motility-associated ABC trans	99.56
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	99.56
cd03278		197	ABC_SMC_barmotin Barmotin is a tight junction-asso	99.56
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	99.56
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	99.56
PRK11160		574	cysteine/glutathione ABC transporter membrane/ATP-	99.56
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	99.56
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	99.56
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	99.56
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	99.56
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	99.56
TIGR01192		585	chvA glucan exporter ATP-binding protein. This mod	99.56
PRK14265		274	phosphate ABC transporter ATP-binding protein; Pro	99.56
TIGR01846		694	type_I_sec_HlyB type I secretion system ABC transp	99.56
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	99.56
PRK14275		286	phosphate ABC transporter ATP-binding protein; Pro	99.55
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	99.55
TIGR01193		708	bacteriocin_ABC ABC-type bacteriocin transporter.	99.55
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	99.55
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	99.55
COG1127		263	Ttg2A ABC-type transport system involved in resist	99.55
COG4152		300	ABC-type uncharacterized transport system, ATPase	99.55
TIGR03796		710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	99.55
PRK10419		268	nikE nickel transporter ATP-binding protein NikE;	99.55
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	99.55
TIGR03797		686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	99.55
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	99.55
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	99.55
PRK14246		257	phosphate ABC transporter ATP-binding protein; Pro	99.55
PRK03695		248	vitamin B12-transporter ATPase; Provisional	99.55
PRK10418		254	nikD nickel transporter ATP-binding protein NikD;	99.55
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	99.55
PRK10789		569	putative multidrug transporter membrane\ATP-bindin	99.55
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	99.55
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	99.55
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	99.55
cd03234		226	ABCG_White The White subfamily represents ABC tran	99.55
PRK14259		269	phosphate ABC transporter ATP-binding protein; Pro	99.54
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	99.54
PRK14258		261	phosphate ABC transporter ATP-binding protein; Pro	99.54
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	99.54
TIGR02204		576	MsbA_rel ABC transporter, permease/ATP-binding pro	99.54
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	99.54
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	99.54
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	99.54
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	99.54
PRK13547		272	hmuV hemin importer ATP-binding subunit; Provision	99.54
COG4555		245	NatA ABC-type Na+ transport system, ATPase compone	99.54
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	99.54
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	99.54
TIGR01842		544	type_I_sec_PrtD type I secretion system ABC transp	99.54
PRK13548		258	hmuV hemin importer ATP-binding subunit; Provision	99.54
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	99.54
TIGR02982		220	heterocyst_DevA ABC exporter ATP-binding subunit,	99.54
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	99.54
TIGR02142		354	modC_ABC molybdenum ABC transporter, ATP-binding p	99.54
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	99.54
PRK14263		261	phosphate ABC transporter ATP-binding protein; Pro	99.54
PRK14243		264	phosphate transporter ATP-binding protein; Provisi	99.54
cd03270		226	ABC_UvrA_I The excision repair protein UvrA domain	99.54
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	99.54
PRK10261		623	glutathione transporter ATP-binding protein; Provi	99.53
PRK11144		352	modC molybdate transporter ATP-binding protein; Pr	99.53
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	99.53
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	99.53
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	99.53
TIGR01277		213	thiQ thiamine ABC transporter, ATP-binding protein	99.53
PRK09984		262	phosphonate/organophosphate ester transporter subu	99.53
PRK14271		276	phosphate ABC transporter ATP-binding protein; Pro	99.53
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	99.53
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	99.53
COG4559		259	ABC-type hemin transport system, ATPase component	99.53
TIGR01187		325	potA spermidine/putrescine ABC transporter ATP-bin	99.53
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	99.53
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	99.53
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	99.53
PRK10851		353	sulfate/thiosulfate transporter subunit; Provision	99.53
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	99.53
PRK11000		369	maltose/maltodextrin transporter ATP-binding prote	99.52
PRK11650		356	ugpC glycerol-3-phosphate transporter ATP-binding	99.52
PRK10261		623	glutathione transporter ATP-binding protein; Provi	99.52
PRK14252		265	phosphate ABC transporter ATP-binding protein; Pro	99.52
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	99.52
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	99.52
cd03300		232	ABC_PotA_N PotA is an ABC-type transporter and the	99.51
cd03274		212	ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein	99.51
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	99.51
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	99.51
PRK14260		259	phosphate ABC transporter ATP-binding protein; Pro	99.51
PRK14266		250	phosphate ABC transporter ATP-binding protein; Pro	99.51
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	99.51
TIGR03258		362	PhnT 2-aminoethylphosphonate ABC transport system,	99.51
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	99.51
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	99.51
COG1123		539	ATPase components of various ABC-type transport sy	99.51
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	99.51
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	99.51
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	99.5
cd03290		218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	99.5
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	99.5
TIGR00958		711	3a01208 Conjugate Transporter-2 (CT2) Family prote	99.5
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	99.5
KOG0055\|consensus		1228		99.5
PRK14254		285	phosphate ABC transporter ATP-binding protein; Pro	99.5
PLN03232		1495	ABC transporter C family member; Provisional	99.5
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	99.5
TIGR03265		353	PhnT2 putative 2-aminoethylphosphonate ABC transpo	99.49
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	99.49
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	99.49
cd03271		261	ABC_UvrA_II The excision repair protein UvrA domai	99.49
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	99.49
PRK13546		264	teichoic acids export protein ATP-binding subunit;	99.49
PRK11432		351	fbpC ferric transporter ATP-binding subunit; Provi	99.49
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	99.49
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	99.48
PRK15064		530	ABC transporter ATP-binding protein; Provisional	99.48
PRK10522		547	multidrug transporter membrane component/ATP-bindi	99.48
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	99.48
PRK09452		375	potA putrescine/spermidine ABC transporter ATPase	99.48
COG1137		243	YhbG ABC-type (unclassified) transport system, ATP	99.48
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	99.48
PLN03130		1622	ABC transporter C family member; Provisional	99.48
TIGR02857		529	CydD thiol reductant ABC exporter, CydD subunit. U	99.48
cd03291		282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	99.47
PRK14264		305	phosphate ABC transporter ATP-binding protein; Pro	99.47
cd03240		204	ABC_Rad50 The catalytic domains of Rad50 are simil	99.47
cd03272		243	ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein	99.47
cd03239		178	ABC_SMC_head The structural maintenance of chromos	99.47
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	99.46
PRK11607		377	potG putrescine transporter ATP-binding subunit; P	99.46
KOG0057\|consensus		591		99.46
cd03299		235	ABC_ModC_like Archeal protein closely related to M	99.46
PRK13545		549	tagH teichoic acids export protein ATP-binding sub	99.46
PLN03211		659	ABC transporter G-25; Provisional	99.46
PRK10535		648	macrolide transporter ATP-binding /permease protei	99.46
TIGR01194		555	cyc_pep_trnsptr cyclic peptide transporter. This m	99.45
PF02463		220	SMC_N: RecF/RecN/SMC N terminal domain; InterPro:	99.45
COG0411		250	LivG ABC-type branched-chain amino acid transport	99.45
COG1129		500	MglA ABC-type sugar transport system, ATPase compo	99.45
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	99.44
COG4172		534	ABC-type uncharacterized transport system, duplica	99.44
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	99.44
COG4172		534	ABC-type uncharacterized transport system, duplica	99.43
PTZ00243		1560	ABC transporter; Provisional	99.43
cd03241		276	ABC_RecN RecN ATPase involved in DNA repair; ABC (	99.43
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	99.42
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.42
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	99.42
PRK10938		490	putative molybdenum transport ATP-binding protein	99.42
COG4598		256	HisP ABC-type histidine transport system, ATPase c	99.42
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	99.42
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	99.41
cd03279		213	ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex	99.41
PRK15064		530	ABC transporter ATP-binding protein; Provisional	99.41
PRK13538		204	cytochrome c biogenesis protein CcmA; Provisional	99.41
COG0488		530	Uup ATPase components of ABC transporters with dup	99.4
PRK13409		590	putative ATPase RIL; Provisional	99.4
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.4
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	99.4
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	99.4
KOG0058\|consensus		716		99.4
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	99.4
KOG0055\|consensus		1228		99.4
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	99.4
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	99.39
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	99.39
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	99.39
COG4161		242	ArtP ABC-type arginine transport system, ATPase co	99.38
TIGR00955		617	3a01204 The Eye Pigment Precursor Transporter (EPP	99.38
PRK10869		553	recombination and repair protein; Provisional	99.38
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.38
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	99.38
COG2884		223	FtsE Predicted ATPase involved in cell division [C	99.38
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	99.38
COG3845		501	ABC-type uncharacterized transport systems, ATPase	99.37
PRK13409		590	putative ATPase RIL; Provisional	99.37
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	99.37
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.37
PRK11147		635	ABC transporter ATPase component; Reviewed	99.37
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	99.36
COG4604		252	CeuD ABC-type enterochelin transport system, ATPas	99.36
TIGR00954		659	3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA	99.36
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	99.36
cd03227		162	ABC_Class2 ABC-type Class 2 contains systems invol	99.36
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	99.35
TIGR00630		924	uvra excinuclease ABC, A subunit. This family is b	99.34
PRK00349		943	uvrA excinuclease ABC subunit A; Reviewed	99.34
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	99.33
COG1118		345	CysA ABC-type sulfate/molybdate transport systems,	99.33
PLN03140		1470	ABC transporter G family member; Provisional	99.33
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	99.33
COG4181		228	Predicted ABC-type transport system involved in ly	99.33
PRK11147		635	ABC transporter ATPase component; Reviewed	99.32
PRK03918		880	chromosome segregation protein; Provisional	99.32
PLN03073		718	ABC transporter F family; Provisional	99.32
PLN03232		1495	ABC transporter C family member; Provisional	99.31
COG4586		325	ABC-type uncharacterized transport system, ATPase	99.31
KOG0996\|consensus		1293		99.31
PLN03073		718	ABC transporter F family; Provisional	99.31
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	99.3
TIGR00630		924	uvra excinuclease ABC, A subunit. This family is b	99.3
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	99.28
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	99.28
COG4618		580	ArpD ABC-type protease/lipase transport system, AT	99.28
COG4619		223	ABC-type uncharacterized transport system, ATPase	99.28
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	99.28
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	99.28
PLN03130		1622	ABC transporter C family member; Provisional	99.27
COG1129		500	MglA ABC-type sugar transport system, ATPase compo	99.27
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	99.27
PRK00635		1809	excinuclease ABC subunit A; Provisional	99.27
PRK00349		943	uvrA excinuclease ABC subunit A; Reviewed	99.26
COG1119		257	ModF ABC-type molybdenum transport system, ATPase	99.26
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	99.25
PRK01156		895	chromosome segregation protein; Provisional	99.24
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	99.24
COG5265		497	ATM1 ABC-type transport system involved in Fe-S cl	99.23
PHA02562		562	46 endonuclease subunit; Provisional	99.23
PLN03140		1470	ABC transporter G family member; Provisional	99.23
COG4148		352	ModC ABC-type molybdate transport system, ATPase c	99.22
PTZ00243		1560	ABC transporter; Provisional	99.22
cd03276		198	ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein	99.22
KOG0054\|consensus		1381		99.21
COG0488		530	Uup ATPase components of ABC transporters with dup	99.21
cd03277		213	ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein	99.21
PRK00635		1809	excinuclease ABC subunit A; Provisional	99.19
COG0410		237	LivF ABC-type branched-chain amino acid transport	99.19
KOG0061\|consensus		613		99.19
COG4674		249	Uncharacterized ABC-type transport system, ATPase	99.17
COG4107		258	PhnK ABC-type phosphonate transport system, ATPase	99.16
cd03280		200	ABC_MutS2 MutS2 homologs in bacteria and eukaryote	99.14
COG4170		330	SapD ABC-type antimicrobial peptide transport syst	99.12
KOG0059\|consensus		885		99.11
TIGR00618		1042	sbcc exonuclease SbcC. This family is based on the	99.09
COG4525		259	TauB ABC-type taurine transport system, ATPase com	99.07
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	99.07
PRK02224		880	chromosome segregation protein; Provisional	99.07
COG1134		249	TagH ABC-type polysaccharide/polyol phosphate tran	99.06
cd03243		202	ABC_MutS_homologs The MutS protein initiates DNA m	99.06
KOG0018\|consensus		1141		99.04
KOG0065\|consensus		1391		99.03
KOG0062\|consensus		582		99.02
COG1101		263	PhnK ABC-type uncharacterized transport system, AT	99.02
KOG0056\|consensus		790		98.99
COG4138		248	BtuD ABC-type cobalamin transport system, ATPase c	98.99
COG4778		235	PhnL ABC-type phosphonate transport system, ATPase	98.98
KOG0062\|consensus		582		98.96
PRK10246		1047	exonuclease subunit SbcC; Provisional	98.96
KOG0964\|consensus		1200		98.96
KOG0927\|consensus		614		98.95
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	98.94
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	98.91
cd03285		222	ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS	98.89
KOG0054\|consensus		1381		98.88
COG0178		935	UvrA Excinuclease ATPase subunit [DNA replication,	98.88
KOG0927\|consensus		614		98.85
smart00534		185	MUTSac ATPase domain of DNA mismatch repair MUTS f	98.85
COG3910		233	Predicted ATPase [General function prediction only	98.81
PF13304		303	AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T	98.79
cd03284		216	ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr	98.74
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	98.74
COG0497		557	RecN ATPase involved in DNA repair [DNA replicatio	98.73
cd03242		270	ABC_RecF RecF is a recombinational DNA repair ATPa	98.73
COG4178		604	ABC-type uncharacterized transport system, permeas	98.72
COG4133		209	CcmA ABC-type transport system involved in cytochr	98.69
COG0178		935	UvrA Excinuclease ATPase subunit [DNA replication,	98.67
KOG0066\|consensus		807		98.65
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	98.64
KOG0933\|consensus		1174		98.59
PRK00064		361	recF recombination protein F; Reviewed	98.57
cd03282		204	ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS	98.53
COG4136		213	ABC-type uncharacterized transport system, ATPase	98.47
TIGR00611		365	recf recF protein. All proteins in this family for	98.42
COG3845		501	ABC-type uncharacterized transport systems, ATPase	98.42
COG4167		267	SapF ABC-type antimicrobial peptide transport syst	98.36
PF13175		415	AAA_15: AAA ATPase domain	98.35
cd03281		213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	98.35
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	98.3
cd03286		218	ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS	98.26
PRK13830		818	conjugal transfer protein TrbE; Provisional	98.24
PRK00409		782	recombination and DNA strand exchange inhibitor pr	98.19
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	98.16
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	98.16
cd03287		222	ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS	98.12
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	98.06
COG4615		546	PvdE ABC-type siderophore export system, fused ATP	98.04
COG4637		373	Predicted ATPase [General function prediction only	97.99
PF13558		90	SbcCD_C: Putative exonuclease SbcCD, C subunit; PD	97.99
KOG0066\|consensus		807		97.98
PRK14079		349	recF recombination protein F; Provisional	97.94
KOG0962\|consensus		1294		97.94
KOG0060\|consensus		659		97.93
PRK13695		174	putative NTPase; Provisional	97.88
KOG0063\|consensus		592		97.8
PRK13891		852	conjugal transfer protein TrbE; Provisional	97.76
KOG2355\|consensus		291		97.7
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	97.7
PRK08533		230	flagellar accessory protein FlaH; Reviewed	97.58
KOG0065\|consensus		1391		97.57
PRK13873		811	conjugal transfer ATPase TrbE; Provisional	97.55
COG2401		593	ABC-type ATPase fused to a predicted acetyltransfe	97.53
PRK08699		325	DNA polymerase III subunit delta'; Validated	97.5
COG3593		581	Predicted ATP-dependent endonuclease of the OLD fa	97.4
KOG0063\|consensus		592		97.36
PRK06067		234	flagellar accessory protein FlaH; Validated	97.34
PF13166		712	AAA_13: AAA domain	97.3
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	97.2
PRK13898		800	type IV secretion system ATPase VirB4; Provisional	97.19
PRK05399		854	DNA mismatch repair protein MutS; Provisional	97.17
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	96.92
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	96.89
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	96.8
PF13514		1111	AAA_27: AAA domain	96.79
KOG0064\|consensus		728		96.37
COG1195		363	RecF Recombinational DNA repair ATPase (RecF pathw	96.35
COG4938		374	Uncharacterized conserved protein [Function unknow	96.29
TIGR01070		840	mutS1 DNA mismatch repair protein MutS.	96.19
PRK07414		178	cob(I)yrinic acid a,c-diamide adenosyltransferase;	96.07
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	96.01
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	95.69
COG4694		758	Uncharacterized protein conserved in bacteria [Fun	95.67
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	95.62
PF02572		172	CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase	95.59
PF00488		235	MutS_V: MutS domain V C-terminus.; InterPro: IPR00	95.55
PRK14088		440	dnaA chromosomal replication initiation protein; P	95.52
PRK04296		190	thymidine kinase; Provisional	95.41
PRK07471		365	DNA polymerase III subunit delta'; Validated	95.31
PRK06893		229	DNA replication initiation factor; Validated	95.08
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	94.64
cd01128		249	rho_factor Transcription termination factor rho is	94.39
PRK07413		382	hypothetical protein; Validated	94.21
COG3950		440	Predicted ATP-binding protein involved in virulenc	94.12
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	93.74
KOG0328\|consensus		400		93.66
PF09818		448	ABC_ATPase: Predicted ATPase of the ABC class; Int	93.38
COG1106		371	Predicted ATPases [General function prediction onl	93.25
PRK07413		382	hypothetical protein; Validated	93.21
PF11398		373	DUF2813: Protein of unknown function (DUF2813); In	93.2
PRK14087		450	dnaA chromosomal replication initiation protein; P	92.96
smart00382		148	AAA ATPases associated with a variety of cellular	92.9
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	92.87
PRK06526		254	transposase; Provisional	92.7
PRK08181		269	transposase; Validated	92.65

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

Probab=99.76  E-value=5.6e-19  Score=117.33  Aligned_cols=76  Identities=20%  Similarity=0.220  Sum_probs=69.5

Q ss_pred             cCCCCEEEEeCCCCCCCHHHHHHHHHHHHcC---CCceEEEEEeChhhH-hcCceEEEEeeec-cCCcceeeeecCCcCC
Q psy832            4 YKPSPFLLLDEIDAALDNINIWKTIQYIRTV---PKMNVIAVSLKPQFY-FHSDILFGITLKM-LGSLTIKGRVHKASLN   78 (80)
Q Consensus         4 ~~~~~illlDEp~~~LD~~~~~~i~~~l~~~---~~~~ii~ish~~~~~-~~~d~~~~i~~~~-~~~~~~~~~~~~~~l~   78 (80)
                      +++|++++|||||++||..++-++++.++++   +++|+|++.||++.+ ++||+++.+++|+ +..|.+.++++++.|.
T Consensus       154 aQ~~~iLLLDEPTs~LDi~~Q~evl~ll~~l~~~~~~tvv~vlHDlN~A~ryad~~i~lk~G~i~a~G~p~evlT~e~l~  233 (258)
T COG1120         154 AQETPILLLDEPTSHLDIAHQIEVLELLRDLNREKGLTVVMVLHDLNLAARYADHLILLKDGKIVAQGTPEEVLTEENLR  233 (258)
T ss_pred             hcCCCEEEeCCCccccCHHHHHHHHHHHHHHHHhcCCEEEEEecCHHHHHHhCCEEEEEECCeEEeecCcchhcCHHHHH
Confidence            5899999999999999999999999999998   589999999999875 5799999999998 8889999999988775


Q ss_pred             C
Q psy832           79 S   79 (80)
Q Consensus        79 ~   79 (80)
                      +
T Consensus       234 ~  234 (258)
T COG1120         234 E  234 (258)
T ss_pred             H
Confidence            4

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>PRK13537 nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>PRK14239 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2	Back alignment and domain information

>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>PRK13536 nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional	Back alignment and domain information

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>PRK14240 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>CHL00131 ycf16 sulfate ABC transporter protein; Validated	Back alignment and domain information

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03288 ABCC_SUR2 The SUR domain 2	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01192 chvA glucan exporter ATP-binding protein	Back alignment and domain information

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein	Back alignment and domain information

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK03695 vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family	Back alignment and domain information

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14243 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional	Back alignment and domain information

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10851 sulfate/thiosulfate transporter subunit; Provisional	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D	Back alignment and domain information

>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>cd03290 ABCC_SUR1_N The SUR domain 1	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0055\|consensus	Back alignment and domain information

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed	Back alignment and domain information

>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1	Back alignment and domain information

>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains	Back alignment and domain information

>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>KOG0057\|consensus	Back alignment and domain information

>cd03299 ABC_ModC_like Archeal protein closely related to ModC	Back alignment and domain information

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PLN03211 ABC transporter G-25; Provisional	Back alignment and domain information

>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional	Back alignment and domain information

>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter	Back alignment and domain information

>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []	Back alignment and domain information

>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>PTZ00243 ABC transporter; Provisional	Back alignment and domain information

>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0058\|consensus	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>KOG0055\|consensus	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>TIGR00630 uvra excinuclease ABC, A subunit	Back alignment and domain information

>PRK00349 uvrA excinuclease ABC subunit A; Reviewed	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>KOG0996\|consensus	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>TIGR00630 uvra excinuclease ABC, A subunit	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK00635 excinuclease ABC subunit A; Provisional	Back alignment and domain information

>PRK00349 uvrA excinuclease ABC subunit A; Reviewed	Back alignment and domain information

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PTZ00243 ABC transporter; Provisional	Back alignment and domain information

>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>KOG0054\|consensus	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PRK00635 excinuclease ABC subunit A; Provisional	Back alignment and domain information

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0061\|consensus	Back alignment and domain information

>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes	Back alignment and domain information

>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>KOG0059\|consensus	Back alignment and domain information

>TIGR00618 sbcc exonuclease SbcC	Back alignment and domain information

>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch	Back alignment and domain information

>KOG0018\|consensus	Back alignment and domain information

>KOG0065\|consensus	Back alignment and domain information

>KOG0062\|consensus	Back alignment and domain information

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>KOG0056\|consensus	Back alignment and domain information

>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0062\|consensus	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>KOG0964\|consensus	Back alignment and domain information

>KOG0927\|consensus	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes	Back alignment and domain information

>KOG0054\|consensus	Back alignment and domain information

>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0927\|consensus	Back alignment and domain information

>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family	Back alignment and domain information

>COG3910 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A	Back alignment and domain information

>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage	Back alignment and domain information

>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]	Back alignment and domain information

>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0066\|consensus	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>KOG0933\|consensus	Back alignment and domain information

>PRK00064 recF recombination protein F; Reviewed	Back alignment and domain information

>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes	Back alignment and domain information

>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR00611 recf recF protein	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PF13175 AAA_15: AAA ATPase domain	Back alignment and domain information

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes	Back alignment and domain information

>PRK13830 conjugal transfer protein TrbE; Provisional	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4637 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A	Back alignment and domain information

>KOG0066\|consensus	Back alignment and domain information

>PRK14079 recF recombination protein F; Provisional	Back alignment and domain information

>KOG0962\|consensus	Back alignment and domain information

>KOG0060\|consensus	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>KOG0063\|consensus	Back alignment and domain information

>PRK13891 conjugal transfer protein TrbE; Provisional	Back alignment and domain information

>KOG2355\|consensus	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>KOG0065\|consensus	Back alignment and domain information

>PRK13873 conjugal transfer ATPase TrbE; Provisional	Back alignment and domain information

>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG3593 Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0063\|consensus	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PRK13898 type IV secretion system ATPase VirB4; Provisional	Back alignment and domain information

>PRK05399 DNA mismatch repair protein MutS; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>KOG0064\|consensus	Back alignment and domain information

>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair]	Back alignment and domain information

>COG4938 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01070 mutS1 DNA mismatch repair protein MutS	Back alignment and domain information

>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>COG4694 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2	Back alignment and domain information

>PF00488 MutS_V: MutS domain V C-terminus	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>PRK07413 hypothetical protein; Validated	Back alignment and domain information

>COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0328\|consensus	Back alignment and domain information

>PF09818 ABC_ATPase: Predicted ATPase of the ABC class; InterPro: IPR019195 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>COG1106 Predicted ATPases [General function prediction only]	Back alignment and domain information

>PRK07413 hypothetical protein; Validated	Back alignment and domain information

>PF11398 DUF2813: Protein of unknown function (DUF2813); InterPro: IPR022602 This entry contains YbjD from Escherichia coli (strain K12), which is a conserved protein with a nucleotide triphosphate binding domain	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		80
1w1w_A		430	Structural maintenance of chromosome 1; cohesin, c	8e-16
1e69_A		322	Chromosome segregation SMC protein; structural mai	7e-10
3kta_B		173	Chromosome segregation protein SMC; structural mai	1e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-04

>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430	Back alignment and structure

 Score = 69.3 bits (170), Expect = 8e-16
 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 1   MYRYKPSPFLLLDEIDAALDNINIWKTIQYIRTVPKMNV--IAVSLKPQFYFHSDILFGI 58
           +  Y+PSPF +LDE+DAALD  N+ +   YIR     ++  I +SLK   +  SD L G+
Sbjct: 350 INSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGV 409

PyMOL of 1w1w

>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Length = 322	Back alignment and structure

>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Length = 173	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		80
3tif_A		235	Uncharacterized ABC transporter ATP-binding prote;	99.71
2pcj_A		224	ABC transporter, lipoprotein-releasing system ATP-	99.69
2ff7_A		247	Alpha-hemolysin translocation ATP-binding protein	99.69
3tui_C		366	Methionine import ATP-binding protein METN; ABC-tr	99.68
3nh6_A		306	ATP-binding cassette SUB-family B member 6, mitoc;	99.68
1f2t_B		148	RAD50 ABC-ATPase; DNA double-strand break repair,	99.68
2ixe_A		271	Antigen peptide transporter 1; ABC ATPase, hydrola	99.67
4g1u_C		266	Hemin import ATP-binding protein HMUV; membrane tr	99.67
3gfo_A		275	Cobalt import ATP-binding protein CBIO 1; structur	99.67
2olj_A		263	Amino acid ABC transporter; ABC domain, ATPase, hy	99.67
1b0u_A		262	Histidine permease; ABC transporter, transport pro	99.67
1ji0_A		240	ABC transporter; ATP binding protein, structural g	99.66
3kta_B		173	Chromosome segregation protein SMC; structural mai	99.66
1g6h_A		257	High-affinity branched-chain amino acid transport	99.66
2zu0_C		267	Probable ATP-dependent transporter SUFC; iron-sulf	99.66
2ghi_A		260	Transport protein; multidrug resistance protein, M	99.66
1vpl_A		256	ABC transporter, ATP-binding protein; TM0544, stru	99.65
2yz2_A		266	Putative ABC transporter ATP-binding protein TM_0;	99.65
2onk_A		240	Molybdate/tungstate ABC transporter, ATP-binding p	99.64
1mv5_A		243	LMRA, multidrug resistance ABC transporter ATP-bin	99.64
2cbz_A		237	Multidrug resistance-associated protein 1; ABC pro	99.63
2pze_A		229	Cystic fibrosis transmembrane conductance regulat;	99.63
2d2e_A		250	SUFC protein; ABC-ATPase, SUF protein, 310-helix,	99.63
3qf4_A		587	ABC transporter, ATP-binding protein; multidrug tr	99.63
3b5x_A		582	Lipid A export ATP-binding/permease protein MSBA;	99.63
2nq2_C		253	Hypothetical ABC transporter ATP-binding protein H	99.62
3qf4_B		598	Uncharacterized ABC transporter ATP-binding prote	99.62
4a82_A		578	Cystic fibrosis transmembrane conductance regulat;	99.61
2yl4_A		595	ATP-binding cassette SUB-family B member 10, mitoc	99.61
2ihy_A		279	ABC transporter, ATP-binding protein; ATPase, ABC	99.61
3b60_A		582	Lipid A export ATP-binding/permease protein MSBA;	99.6
3fvq_A		359	Fe(3+) IONS import ATP-binding protein FBPC; nucle	99.6
2qi9_C		249	Vitamin B12 import ATP-binding protein BTUD; inner	99.6
2pjz_A		263	Hypothetical protein ST1066; ATP binding protein,	99.59
3qf7_A		365	RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.	99.59
3d31_A		348	Sulfate/molybdate ABC transporter, ATP-binding pro	99.59
2bbs_A		290	Cystic fibrosis transmembrane conductance regulato	99.58
2yyz_A		359	Sugar ABC transporter, ATP-binding protein; sugar	99.58
1z47_A		355	CYSA, putative ABC-transporter ATP-binding protein	99.58
3gd7_A		390	Fusion complex of cystic fibrosis transmembrane co	99.58
4f4c_A		1321	Multidrug resistance protein PGP-1; ABC transporte	99.57
3rlf_A		381	Maltose/maltodextrin import ATP-binding protein M;	99.57
1oxx_K		353	GLCV, glucose, ABC transporter, ATP binding protei	99.57
1g29_1		372	MALK, maltose transport protein MALK; ATPase, acti	99.57
3qkt_A		339	DNA double-strand break repair RAD50 ATPase; RECA-	99.57
2it1_A		362	362AA long hypothetical maltose/maltodextrin trans	99.57
1v43_A		372	Sugar-binding transport ATP-binding protein; ATPas	99.56
3ux8_A		670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	99.55
4aby_A		415	DNA repair protein RECN; hydrolase, double strand	99.54
3ux8_A		670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	99.53
1w1w_A		430	Structural maintenance of chromosome 1; cohesin, c	99.52
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	99.52
1e69_A		322	Chromosome segregation SMC protein; structural mai	99.51
3g5u_A		1284	MCG1178, multidrug resistance protein 1A; P-glycop	99.51
3pih_A		916	Uvrabc system protein A; hydrolase, ABC ATPase, DN	99.5
3ozx_A		538	RNAse L inhibitor; ATP binding cassette protein, h	99.5
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	99.5
4f4c_A		1321	Multidrug resistance protein PGP-1; ABC transporte	99.49
3g5u_A		1284	MCG1178, multidrug resistance protein 1A; P-glycop	99.48
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	99.48
3ozx_A		538	RNAse L inhibitor; ATP binding cassette protein, h	99.48
3auy_A		371	DNA double-strand break repair RAD50 ATPase; DNA r	99.48
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	99.47
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	99.47
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	99.46
1sgw_A		214	Putative ABC transporter; structural genomics, P p	99.46
4ad8_A		517	DNA repair protein RECN; DNA binding protein, ATPa	99.44
2vf7_A		842	UVRA2, excinuclease ABC, subunit A.; DNA-binding p	99.44
3pih_A		916	Uvrabc system protein A; hydrolase, ABC ATPase, DN	99.43
2r6f_A		972	Excinuclease ABC subunit A; UVRA, nucleotide excis	99.42
2ygr_A		993	Uvrabc system protein A; hydrolase, nucleotide exc	99.4
2ygr_A		993	Uvrabc system protein A; hydrolase, nucleotide exc	99.38
2r6f_A		972	Excinuclease ABC subunit A; UVRA, nucleotide excis	99.37
2iw3_A		986	Elongation factor 3A; acetylation, ATP-binding, pr	99.36
2iw3_A		986	Elongation factor 3A; acetylation, ATP-binding, pr	99.33
2vf7_A		842	UVRA2, excinuclease ABC, subunit A.; DNA-binding p	99.33
4gp7_A		171	Metallophosphoesterase; polynucleotide kinase phos	99.17
2o5v_A		359	DNA replication and repair protein RECF; ABC ATPas	99.13
3thx_A		934	DNA mismatch repair protein MSH2; ABC family ATPas	98.94
2ehv_A		251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	98.93
3b85_A		208	Phosphate starvation-inducible protein; PHOH2, ATP	98.89
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	98.82
3thx_B		918	DNA mismatch repair protein MSH3; ABC family ATPas	98.79
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	98.77
1ye8_A		178	Protein THEP1, hypothetical UPF0334 kinase-like pr	98.76
1znw_A		207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	98.65
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	98.61
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	98.61
1wb9_A		800	DNA mismatch repair protein MUTS; DNA-binding, ATP	98.6
2o8b_B		1022	DNA mismatch repair protein MSH6; DNA damage respo	98.58
4a74_A		231	DNA repair and recombination protein RADA; hydrola	98.56
2npi_A		460	Protein CLP1; CLP1-PCF11 complex, ATP binding, ter	98.56
2cvh_A		220	DNA repair and recombination protein RADB; filamen	98.42
1ewq_A		765	DNA mismatch repair protein MUTS; multiple domains	98.31
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	98.29
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	98.22
2pt7_A		330	CAG-ALFA; ATPase, protein-protein complex, type IV	98.2
1nlf_A		279	Regulatory protein REPA; replicative DNA helicase	98.16
2eyu_A		261	Twitching motility protein PILT; pilus retraction	98.15
3jvv_A		356	Twitching mobility protein; hexameric P-loop ATPas	98.08
1n0w_A		243	DNA repair protein RAD51 homolog 1; DNA repair, ho	97.97
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	97.93
1pzn_A		349	RAD51, DNA repair and recombination protein RAD51,	97.86
3szr_A		608	Interferon-induced GTP-binding protein MX1; interf	97.83
1tq4_A		413	IIGP1, interferon-inducible GTPase; interferon gam	97.65
2i3b_A		189	HCR-ntpase, human cancer-related ntpase; AAA, ross	97.57
3lda_A		400	DNA repair protein RAD51; DNA binding protein, ATP	97.53
3b9q_A		302	Chloroplast SRP receptor homolog, alpha subunit CP	97.45
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	97.41
2og2_A		359	Putative signal recognition particle receptor; nuc	97.19
2ewv_A		372	Twitching motility protein PILT; pilus retraction	96.87
2bbw_A		246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	96.68
2dpy_A		438	FLII, flagellum-specific ATP synthase; beta barrel	96.48
1s96_A		219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	96.38
2obl_A		347	ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O	96.37
2qnr_A		301	Septin-2, protein NEDD5; structural genomics conso	96.31
1lw7_A		365	Transcriptional regulator NADR; NMN, NMN adenylyl	96.25
3asz_A		211	Uridine kinase; cytidine phosphorylation, transfer	96.09
2r6a_A		454	DNAB helicase, replicative helicase; replication,	95.99
1g5t_A		196	COB(I)alamin adenosyltransferase; P-loop protein,	95.94
3sop_A		270	Neuronal-specific septin-3; hydrolase; HET: GDP; 2	95.92
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	95.91
2v9p_A		305	Replication protein E1; AAA+ molecular motor, DNA	95.88
1z6g_A		218	Guanylate kinase; structural genomics, SGC, struct	95.85
2qag_C		418	Septin-7; cell cycle, cell division, GTP-binding,	95.84
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	95.55
1pui_A		210	ENGB, probable GTP-binding protein ENGB; structura	95.23
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	95.18
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	95.08
3euj_A		483	Chromosome partition protein MUKB, linker; MUKB, M	94.78
2jeo_A		245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	94.37
1ls1_A		295	Signal recognition particle protein; FFH, SRP54, S	93.86
3aez_A		312	Pantothenate kinase; transferase, homodimer, COA b	92.18
2ce7_A		476	Cell division protein FTSH; metalloprotease; HET:	92.12
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	92.01
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	91.95
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	91.63
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	91.55
4ag6_A		392	VIRB4 ATPase, type IV secretory pathway VIRB4 comp	90.25
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	90.15
2ius_A		512	DNA translocase FTSK; nucleotide-binding, chromoso	90.12
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	89.61
2chg_A		226	Replication factor C small subunit; DNA-binding pr	89.33
1lvg_A		198	Guanylate kinase, GMP kinase; transferase; HET: AD	88.96
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	88.65
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	88.5
1odf_A		290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	88.0
2qag_B		427	Septin-6, protein NEDD5; cell cycle, cell division	87.83
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	87.65
2e87_A		357	Hypothetical protein PH1320; GTP-binding, GTPase,	87.26
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	86.98
3bos_A		242	Putative DNA replication factor; P-loop containing	85.78
2bdt_A		189	BH3686; alpha-beta protein, structural genomics, P	85.38
1rj9_A		304	FTSY, signal recognition protein; SRP-GTPase domai	84.92
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	84.85
1vec_A		206	ATP-dependent RNA helicase P54; DEAD-box protein,	84.05
2orv_A		234	Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2	84.02
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	83.92
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	83.85
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	83.47
3co5_A		143	Putative two-component system transcriptional RES	83.25
2gno_A		305	DNA polymerase III, gamma subunit-related protein;	83.18
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	82.47
1jr3_D		343	DNA polymerase III, delta subunit; processivity, p	82.37
1t6n_A		220	Probable ATP-dependent RNA helicase; RECA-like fol	81.92
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	81.7
1oix_A		191	RAS-related protein RAB-11A; small G protein, intr	81.01
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	80.71
3pxi_A		758	Negative regulator of genetic competence CLPC/MEC;	80.66
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	80.55

>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A*	Back alignment and structure

Probab=99.71  E-value=9e-18  Score=108.81  Aligned_cols=59  Identities=17%  Similarity=0.148  Sum_probs=54.9

Q ss_pred             cCCCCEEEEeCCCCCCCHHHHHHHHHHHHcC--C-CceEEEEEeChhhHhcCceEEEEeeec
Q psy832            4 YKPSPFLLLDEIDAALDNINIWKTIQYIRTV--P-KMNVIAVSLKPQFYFHSDILFGITLKM   62 (80)
Q Consensus         4 ~~~~~illlDEp~~~LD~~~~~~i~~~l~~~--~-~~~ii~ish~~~~~~~~d~~~~i~~~~   62 (80)
                      +.+|+++||||||++||+.++.++++.++++  + +.|+|++||+++....||+++.+.+|+
T Consensus       161 ~~~p~llllDEPts~LD~~~~~~i~~~l~~l~~~~g~tvi~vtHd~~~~~~~d~i~~l~~G~  222 (235)
T 3tif_A          161 ANNPPIILADQPTWALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKDGE  222 (235)
T ss_dssp             TTCCSEEEEESTTTTSCHHHHHHHHHHHHHHHHHHCCEEEEECSCHHHHTTSSEEEEEETTE
T ss_pred             HcCCCEEEEeCCcccCCHHHHHHHHHHHHHHHHHcCCEEEEEcCCHHHHHhCCEEEEEECCE
Confidence            5789999999999999999999999999988  3 899999999998777899999999886

PyMOL of 3tif

>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A	Back alignment and structure

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*	Back alignment and structure

>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C	Back alignment and structure

>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*	Back alignment and structure

>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B*	Back alignment and structure

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*	Back alignment and structure

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}	Back alignment and structure

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}	Back alignment and structure

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*	Back alignment and structure

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12	Back alignment and structure

>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B*	Back alignment and structure

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*	Back alignment and structure

>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A	Back alignment and structure

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}	Back alignment and structure

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}	Back alignment and structure

>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12	Back alignment and structure

>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12	Back alignment and structure

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}	Back alignment and structure

>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A	Back alignment and structure

>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A*	Back alignment and structure

>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae}	Back alignment and structure

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}	Back alignment and structure

>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A	Back alignment and structure

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}	Back alignment and structure

>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A	Back alignment and structure

>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae}	Back alignment and structure

>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C	Back alignment and structure

>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A*	Back alignment and structure

>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12	Back alignment and structure

>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*	Back alignment and structure

>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima}	Back alignment and structure

>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius}	Back alignment and structure

>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens}	Back alignment and structure

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}	Back alignment and structure

>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A	Back alignment and structure

>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A*	Back alignment and structure

>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A	Back alignment and structure

>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B	Back alignment and structure

>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii}	Back alignment and structure

>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A*	Back alignment and structure

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}	Back alignment and structure

>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans}	Back alignment and structure

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}	Back alignment and structure

>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A*	Back alignment and structure

>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima}	Back alignment and structure

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}	Back alignment and structure

>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A*	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}	Back alignment and structure

>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B*	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12	Back alignment and structure

>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans}	Back alignment and structure

>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A*	Back alignment and structure

>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima}	Back alignment and structure

>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A	Back alignment and structure

>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A	Back alignment and structure

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A	Back alignment and structure

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A	Back alignment and structure

>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A*	Back alignment and structure

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*	Back alignment and structure

>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans}	Back alignment and structure

>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A*	Back alignment and structure

>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B*	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11	Back alignment and structure

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A*	Back alignment and structure

>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B*	Back alignment and structure

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*	Back alignment and structure

>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae}	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A*	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A	Back alignment and structure

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A	Back alignment and structure

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}	Back alignment and structure

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*	Back alignment and structure

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11	Back alignment and structure

>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B	Back alignment and structure

>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A*	Back alignment and structure

>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*	Back alignment and structure

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*	Back alignment and structure

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A	Back alignment and structure

>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium}	Back alignment and structure

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*	Back alignment and structure

>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A*	Back alignment and structure

>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A*	Back alignment and structure

>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1	Back alignment and structure

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*	Back alignment and structure

>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens}	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*	Back alignment and structure

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}	Back alignment and structure

>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A*	Back alignment and structure

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*	Back alignment and structure

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*	Back alignment and structure

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*	Back alignment and structure

>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E*	Back alignment and structure

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A	Back alignment and structure

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}	Back alignment and structure

>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A*	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6	Back alignment and structure

>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii}	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25	Back alignment and structure

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A*	Back alignment and structure

>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B*	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis}	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		80
d1w1wa_		427	c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac	3e-12
d1e69a_		308	c.37.1.12 (A:) Smc head domain {Thermotoga maritim	8e-06
g1ii8.1		369	c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio	2e-04

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 58.2 bits (139), Expect = 3e-12
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 1   MYRYKPSPFLLLDEIDAALDNINIWKTIQYIRTVPKMN--VIAVSLKPQFYFHSDILFGI 58
           +  Y+PSPF +LDE+DAALD  N+ +   YIR     +   I +SLK   +  SD L G+
Sbjct: 349 INSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGV 408

Query: 59  T 59
            
Sbjct: 409 Y 409

PyMOL of d1w1wa_

>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Length = 308	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		80
d2pmka1		241	Haemolysin B ATP-binding protein {Escherichia coli	99.78
d3b60a1		253	Multidrug resistance ABC transporter MsbA, C-termi	99.77
d1l2ta_		230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	99.77
d1jj7a_		251	Peptide transporter Tap1, C-terminal ABC domain {H	99.76
d1ji0a_		240	Branched chain aminoacid ABC transporter {Thermoto	99.76
d1mv5a_		242	Multidrug resistance ABC transporter LmrA, C-termi	99.75
d2hyda1		255	Putative multidrug export ATP-binding/permease pro	99.75
d1v43a3		239	Hypothetical protein PH0022, N-terminal domain {Py	99.74
d2awna2		232	Maltose transport protein MalK, N-terminal domain	99.74
d3d31a2		229	Sulfate/molybdate ABC transporter, ATP-binding pro	99.74
d1b0ua_		258	ATP-binding subunit of the histidine permease {Sal	99.74
d3dhwc1		240	Methionine import ATP-binding protein MetN {Escher	99.72
d1vpla_		238	Putative ABC transporter TM0544 {Thermotoga mariti	99.72
d1g2912		240	Maltose transport protein MalK, N-terminal domain	99.72
d1l7vc_		231	ABC transporter involved in vitamin B12 uptake, Bt	99.71
d2onka1		240	Molybdate/tungstate import ATP-binding protein Wtp	99.71
d1g6ha_		254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	99.71
d1oxxk2		242	Glucose transport protein GlcV, N-terminal domain	99.7
d1r0wa_		281	Cystic fibrosis transmembrane conductance regulato	99.68
g1f2t.1		292	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	99.64
d1w1wa_		427	Smc head domain {Baker's yeast (Saccharomyces cere	99.57
g1ii8.1		369	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	99.49
d1e69a_		308	Smc head domain {Thermotoga maritima [TaxId: 2336]	99.34
d1sgwa_		200	Putative ABC transporter PF0895 {Pyrococcus furios	99.32
g1xew.1		329	Smc head domain {Pyrococcus furiosus [TaxId: 2261]	98.8
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	97.1
d1ewqa2		224	DNA repair protein MutS, the C-terminal domain {Th	96.12
d1wb9a2		234	DNA repair protein MutS, the C-terminal domain {Es	95.15
d1g5ta_		157	ATP:corrinoid adenosyltransferase CobA {Salmonella	94.93
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	93.59
d1veca_		206	DEAD box RNA helicase rck/p54 {Human (Homo sapiens	91.21
d1s2ma1		206	Putative ATP-dependent RNA helicase DHH1 {Baker's	91.02
d2j0sa1		222	Probable ATP-dependent RNA helicase DDX48 {Human (	90.8
d1qdea_		212	Initiation factor 4a {Baker's yeast (Saccharomyces	89.1
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	88.84
d2g9na1		218	Initiation factor 4a {Human (Homo sapiens) [TaxId:	87.76
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	86.63
d1hv8a1		208	Putative DEAD box RNA helicase {Archaeon Methanoco	84.69
d1t6na_		207	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	84.65
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	82.56
d1x8ha_		228	Zn metallo-beta-lactamase {Aeromonas hydrophila, C	81.25
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	81.05
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	80.38

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Haemolysin B ATP-binding protein
species: Escherichia coli [TaxId: 562]

Probab=99.78  E-value=8.5e-20  Score=117.79  Aligned_cols=71  Identities=14%  Similarity=0.136  Sum_probs=64.5

Q ss_pred             cCCCCEEEEeCCCCCCCHHHHHHHHHHHHcC-CCceEEEEEeChhhHhcCceEEEEeeec-cCCcceeeeecC
Q psy832            4 YKPSPFLLLDEIDAALDNINIWKTIQYIRTV-PKMNVIAVSLKPQFYFHSDILFGITLKM-LGSLTIKGRVHK   74 (80)
Q Consensus         4 ~~~~~illlDEp~~~LD~~~~~~i~~~l~~~-~~~~ii~ish~~~~~~~~d~~~~i~~~~-~~~~~~~~~~~~   74 (80)
                      +++|+++|||||||+||+.++..+++.|+++ +++|+|+|||+++.+..||+++.+++|+ +..|+..+++..
T Consensus       155 ~~~p~ililDEpts~LD~~~~~~i~~~l~~l~~~~Tvi~itH~l~~~~~~D~i~vl~~G~Iv~~G~~~ell~~  227 (241)
T d2pmka1         155 VNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSE  227 (241)
T ss_dssp             TTCCSEEEECCCCSCCCHHHHHHHHHHHHHHHTTSEEEEECSSGGGGTTSSEEEEEETTEEEEEECHHHHHHS
T ss_pred             hcccchhhhhCCccccCHHHHHHHHHHHHHHhCCCEEEEEECCHHHHHhCCEEEEEECCEEEEECCHHHHHhC
Confidence            5799999999999999999999999999998 8999999999999888899999999998 677777766643

PyMOL of d2pmka1

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}	Back information, alignment and structure

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}	Back information, alignment and structure

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}	Back information, alignment and structure

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure