Psyllid ID: psy833

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640--

MDMNQVPRCLHCPAGTFAGINQKTCTPCPRGFYQNNDRQGVCLKCPMGTYTREEGSKAVQECVPVCGYGTYSPTGLVPCLECPRNSYTGEPPVGGHKDCEACPANMFTYQPAAPARNFCRVPTPGAEYGNFLDTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANGIWDFGDLRCEGPVCSDPGRPVDGYQVATSYEQVRYDDEQYGNFLDTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANGIWDFGDLRCEGPVCSDPGRPVDGYQVATSYEQVRYDDEQGSEVQFGCNKPGYILINPRPITCVREPECKIIKPLGLASGRIPDSSINATSESPYLVRVNACSVPLIPGPRVQELLAEKNVRLFNVLRTLANMEVYVYRLAILVKGVVTNDIVGRPTEIRFFYKQAESENFVVYFPNFNLTMRDPGNYGELAMITLPKFVQARFVILGIVSYMDNACLKFELMGCEEPKVEPLLGYDYGYSPCVDNEPPVFQNCPQQPIIVRKGPNGIEPVNITEPVAVDNSGSIARLEIKPQSFKTPMITFHDMAVKYIAYDFDGNVAICEINITVVDETPPLLSCPQSYIIELVDKQDSYVMNFNETRRRVNVSDASGEVTVTFSPDRATILLGDFENVTVTAAD

ccccccccEEcccccEEEcccccEEEEccccccccccccccEEEccccccccccccEEEEEccccccccEEccccEEEEEEccccEEEcccccccEEEEEccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEcccccccEEEccccccccccccEEccccccccccccccEEEccccccccccccccccccccccccEEEEEcccccEEEEcccccccEEEccccccEEccccEEEcccccccccccccEEEcccccccccccccccEEEEEcccccEEEEccccEEEcccccEEcccccEEEcccccccccccccccccEEEEccccccccccccEEEEEccccEEEccEEEEEcccccEEEEEEEEEEEEEEccccccccEEEEEEEcccccccEEEEccEEEEcccccccccEEEEEcccccccEEEEcEEEEEEccccEEEEEccccccccccccccccccccccccccccccccccccEEEccccccEEEEEEEccEEEEcccccEEEEEcccccccccEEEEEEEEEEEEEEccccEEEEEEEEEEEcccccccccccccEEEccccccEEEEEEcccccEEEEEcccccEEEEEcccccccccccEEEEEEEEEc

cccccccccEEcccccEcccccEEEEEcccccccccccccEEEcccccccccccccccccccccccccccccccccEEEEEcccccEccccccccEEEEEccccccccccccccEEccccccccccccccccccEcccEEEEEEcccEEEEcccccccEEEEEcccccccccccccEcccccccccccccEEEccccccccccccccccccccccccEEEEEEcccEEEEEcccccccEEEEccccccccccccEEccccccccccccccEEcccccEcccccccccEEEEEEccccEEEEcccEEEEccccccccccccccccccccccccccccccccccEEEEccccccccccccccEccEEEEcccccEEccccccEEEEEccccccEEcccEEEcccEEEEEEEccccccEEEEccccccccccccccccEEEEEccccEEEEEEEEEEEEccccccEEEEEccccccccccccccccccccccccccccccccccccEEEEEcccccccEEEEcEEEEcccccEEEEEEEccccccccEEEccEEEEEEEEEccccEEEEEEEEEEccccccccccccccEEEEEccccEEEEEEcccEEEEEEEcccccEEEEEccccEEEEcccEEEEEEEEcc

mdmnqvprclhcpagtfaginqktctpcprgfyqnndrqgvclkcpmgtytreegskavqecvpvcgygtysptglvpclecprnsytgeppvgghkdceacpanmftyqpaaparnfcrvptpgaeygnfldtryqssfffgcqdtfklagqtdkndnvvrcqangiwdfgdlrcegpvcsdpgrpvdgyqvaTSYEQVryddeqygnfldtryqssfffgcqdtfklagqtdkndnvvrcqangiwdfgdlrcegpvcsdpgrpvdgyqvaTSYEQvryddeqgsevqfgcnkpgyilinprpitcvrepeckiikplglasgripdssinatsespylVRVNacsvplipgprvQELLAEKNVRLFNVLRTLANMEVYVYRLAILVKGVvtndivgrptEIRFFYKQaesenfvvyfpnfnltmrdpgnygelamitlpkFVQARFVILGIVSYMDNACLKFelmgceepkvepllgydygyspcvdneppvfqncpqqpiivrkgpngiepvnitepvavdnsgsiarleikpqsfktpmitFHDMAVKYIAydfdgnvaiceinitvvdetppllscpqsYIIELVDKQDSYVMNFNEtrrrvnvsdasgevtvtfspdratillgdfenvtvtaad

MDMNQVPRCLHCPAGTFAGINQKTCTPCPRgfyqnndrqgvCLKCPMGTYTREEGSKAVQECVPVCGYGTYSPTGLVPCLECPRNSYTGEPPVGGHKDCEACPANMFTYQPAAPARNFCRVPTPGAEYGNFLDTRYQSSFFFGCQDTFKlagqtdkndnVVRCQANGIWDFGDLRCEGPVCSDPGRPVDGYQVATSYEQVRYDDEQYGNFLDTRYQSSFFFGCQDTFKlagqtdkndnVVRCQANGIWDFGDLRCEGPVCSDPGRPVDGYQVATSYEQVRYDDEQGSEVQFGCNKPGYILINPRPITCVREPECKIIKPlglasgripdSSINATSESPYLVRVNACSVPLIPGPRVQELLAEKNVRLFNVLRTLANMEVYVYRLAILVKGVVTNDIVGRPTEIRFFYKQAESENFVVYFPNFNLTMRDPGNYGELAMITLPKFVQARFVILGIVSYMDNACLKFELMGCEEPKVEPLLGYDYGYSPCVDNEPPVFQNCPQQPIIVRKGPNGIEPVNITEPVAVDNSGSIARLEIKPQSFKTPMITFHDMAVKYIAYDFDGNVAICEINITVVDETPPLLSCPQSYIIELVDKQDSYVMNFNETrrrvnvsdasgevtvtfspdratillgdfenvtvtaad

*******RCLHCPAGTFAGINQKTCTPCPRGFYQNNDRQGVCLKCPMGTYTREEGSKAVQECVPVCGYGTYSPTGLVPCLECPRNSYTGEPPVGGHKDCEACPANMFTYQPAAPARNFCRVPTPGAEYGNFLDTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANGIWDFGDLRCEGPVCSDPGRPVDGYQVATSYEQVRYDDEQYGNFLDTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANGIWDFGDLRCEGPVCSDPGRPVDGYQVATSYEQVRYDDEQGSEVQFGCNKPGYILINPRPITCVREPECKIIKPLGLASGRIP***I****ESPYLVRVNACSVPLIPGPRVQELLAEKNVRLFNVLRTLANMEVYVYRLAILVKGVVTNDIVGRPTEIRFFYKQAESENFVVYFPNFNLTMRDPGNYGELAMITLPKFVQARFVILGIVSYMDNACLKFELMGCEEPKVEPLLGYDYGYSPCVDNEPPVFQNCPQQPIIVRKGPNGIEPVNITEPVAVDNSGSIARLEIKPQSFKTPMITFHDMAVKYIAYDFDGNVAICEINITVVDETPPLLSCPQSYIIELVDKQDSYVMNFNETRRRVNVSDASGEVTVTFSPDRATILLGDFENVTV****

****QVPRCLHCPAGTFAGINQKTCTPCPRGFYQNNDRQGVCLKCPMGTYTREEGSKAVQECVPVCGYGTYSPTGLVPCLECPRNSYTGEPPVGGHKDCEACPANMFTYQPAAPARNFCRVPTPGAEYGNFLDTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANGIWDFGDLRCEGPVCSDPGRPVDGYQVATSYEQVRYDDEQYGNFLDTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANGIWDFGDLRCEGPVCSDPGRPVDGYQVATSYEQVRYDDEQGSEVQFGCNKPGYILINPRPITCVREPECKIIKPLGLASGRIPDSSINATSESPYLVRVNACSVPLIPGPRVQELLAEKNVRLFNVLRTLANMEVYVYRLAILVKGVVTNDIVGRPTEIRFFYKQAESENFVVYFPNFNLTMRDPGNYGELAMITLPKFVQARFVILGIVSYMDNACLKFELMGCEEPKVEPLLGYDYGYSPCVDNEPPVFQNCPQQPIIVRKGPNGIEPVNITEPVAVDNSGSIARLEIKPQSFKTPMITFHDMAVKYIAYDFDGNVAICEINITVVDETPPLLSCPQSYIIELVDKQDSYVMNFNETRRRVNVSDASGEVTVTFSPDRATILLGDFENVTVTAA*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		642	2.2.26 [Sep-21-2011]
Q4LDE5		3571	Sushi, von Willebrand fac	yes	N/A	0.182	0.032	0.358	9e-13
A2AVA0		3567	Sushi, von Willebrand fac	yes	N/A	0.182	0.032	0.366	3e-12
P0C6B8		3564	Sushi, von Willebrand fac	yes	N/A	0.182	0.032	0.358	6e-12
Q96PZ7		3565	CUB and sushi domain-cont	no	N/A	0.224	0.040	0.283	1e-08
Q923L3		3564	CUB and sushi domain-cont	no	N/A	0.224	0.040	0.272	7e-08
Q7Z407		3707	CUB and sushi domain-cont	no	N/A	0.205	0.035	0.306	4e-07
Q80T79		3707	CUB and sushi domain-cont	no	N/A	0.205	0.035	0.300	7e-07
Q6NZL8		1018	Signal peptide, CUB and E	no	N/A	0.188	0.118	0.299	1e-06
Q66PY1		993	Signal peptide, CUB and E	no	N/A	0.160	0.103	0.320	3e-06
Q8IX30		993	Signal peptide, CUB and E	no	N/A	0.160	0.103	0.320	3e-06

>sp\|Q4LDE5\|SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens GN=SVEP1 PE=1 SV=3	Back alignment and function desciption

 Score = 75.9 bits (185), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 60/120 (50%), Gaps = 3/120 (2%)

Query: 9    CLHCPAGTFAGINQKTCTPCPRGFYQNNDRQGVCLKCPMGTYTREEGSKAVQECVPVCGY 68
            C++CP GT+  +   TC  C  G YQ+ + Q  C  CP G YT    S+ + +C   C  
Sbjct: 999  CVNCPLGTYYNLEHFTCESCRIGSYQDEEGQLECKLCPSGMYTEYIHSRNISDCKAQCKQ 1058

Query: 69   GTYSPTGLVPCLECPRNSYTGEPPVGGHKDCEACPANMFTYQPAAPARNFCRVPTPGAEY 128
            GTYS +GL  C  CP  +Y    P  G + C +CP N  T +  A   + C VP P  ++
Sbjct: 1059 GTYSYSGLETCESCPLGTYQ---PKFGSRSCLSCPENTSTVKRGAVNISACGVPCPEGKF 1115

May play a role in the cell attachment process.
Homo sapiens (taxid: 9606)

>sp\|A2AVA0\|SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus GN=Svep1 PE=1 SV=1	Back alignment and function description

>sp\|P0C6B8\|SVEP1_RAT Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Rattus norvegicus GN=Svep1 PE=1 SV=1	Back alignment and function description

>sp\|Q96PZ7\|CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens GN=CSMD1 PE=1 SV=2	Back alignment and function description

>sp\|Q923L3\|CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus GN=Csmd1 PE=2 SV=2	Back alignment and function description

>sp\|Q7Z407\|CSMD3_HUMAN CUB and sushi domain-containing protein 3 OS=Homo sapiens GN=CSMD3 PE=2 SV=3	Back alignment and function description

>sp\|Q80T79\|CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus GN=Csmd3 PE=2 SV=3	Back alignment and function description

>sp\|Q6NZL8\|SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus GN=Scube1 PE=2 SV=2	Back alignment and function description

>sp\|Q66PY1\|SCUB3_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Mus musculus GN=Scube3 PE=1 SV=1	Back alignment and function description

>sp\|Q8IX30\|SCUB3_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Homo sapiens GN=SCUBE3 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		642
328723934		3561	PREDICTED: hypothetical protein LOC10016	0.638	0.115	0.789	0.0
242011892		3516	conserved hypothetical protein [Pediculu	0.638	0.116	0.749	0.0
345481600		3813	PREDICTED: hypothetical protein LOC10012	0.638	0.107	0.732	0.0
332016443		3485	Fibropellin-1 [Acromyrmex echinatior]	0.638	0.117	0.725	0.0
270002799		3631	hypothetical protein TcasGA2_TC000871 [T	0.638	0.112	0.718	0.0
189234400		3570	PREDICTED: similar to SP1070 CG9138-PA [	0.638	0.114	0.718	0.0
195471601		3586	GE18383 [Drosophila yakuba] gi\|194174192	0.638	0.114	0.723	0.0
340717389		3564	PREDICTED: hypothetical protein LOC10064	0.638	0.115	0.725	0.0
350413330		3564	PREDICTED: hypothetical protein LOC10074	0.638	0.115	0.725	0.0
195577197		2395	GD22519 [Drosophila simulans] gi\|1941904	0.638	0.171	0.718	0.0

>gi\|328723934\|ref\|XP_001949468.2\| PREDICTED: hypothetical protein LOC100162025 [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/447 (78%), Positives = 380/447 (85%), Gaps = 37/447 (8%)

Query: 206  QYGNFLDTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANGIWDFGDLRCEGPVCSDPGR 265
            +YGNF DTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANG+WDFGDLRCEGPVC DPGR
Sbjct: 1196 EYGNFKDTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANGVWDFGDLRCEGPVCQDPGR 1255

Query: 266  PVDGYQVATSYEQVRYDDEQGSEVQFGCNKPGYILINPRPITCVREPECKIIKPLGLASG 325
            P DGYQVATSYEQ       GSEVQFGCNKPGYILINPRPITC+REPECK+IKPLGL SG
Sbjct: 1256 PTDGYQVATSYEQ-------GSEVQFGCNKPGYILINPRPITCIREPECKVIKPLGLTSG 1308

Query: 326  RIPDSSINATSESPYLVRVNACSVPLIPGPRVQELLAEKNVRLFNVLRTLANMEVY---- 381
            RIPDS+INATSE P                        +N+RL +V       E +    
Sbjct: 1309 RIPDSAINATSERPNY--------------------EARNIRLNSVTGWCGKQEAFTYVS 1348

Query: 382  -----VYRL-AILVKGVVTNDIVGRPTEIRFFYKQAESENFVVYFPNFNLTMRDPGNYGE 435
                 VYR+ AILVKGVVTNDIVGRPTEIRFFYKQ E ENFVVYFPNFNLTMRDPGN+GE
Sbjct: 1349 VDLGQVYRVKAILVKGVVTNDIVGRPTEIRFFYKQEEKENFVVYFPNFNLTMRDPGNFGE 1408

Query: 436  LAMITLPKFVQARFVILGIVSYMDNACLKFELMGCEEPKVEPLLGYDYGYSPCVDNEPPV 495
            LAMITLPKFVQARFVILGIVSYMDNACLKFELMGCEEPKVEPLLG+DYG+SPCVDNEPPV
Sbjct: 1409 LAMITLPKFVQARFVILGIVSYMDNACLKFELMGCEEPKVEPLLGFDYGHSPCVDNEPPV 1468

Query: 496  FQNCPQQPIIVRKGPNGIEPVNITEPVAVDNSGSIARLEIKPQSFKTPMITFHDMAVKYI 555
            FQNCP QPIIVR+GPNGIEPVN+TEPV VDNSGSIARLE+KPQSFK P  TF D AVKY+
Sbjct: 1469 FQNCPTQPIIVRRGPNGIEPVNMTEPVPVDNSGSIARLEVKPQSFKLPFYTFQDTAVKYV 1528

Query: 556  AYDFDGNVAICEINITVVDETPPLLSCPQSYIIELVDKQDSYVMNFNETRRRVNVSDASG 615
            A+DFDGNVAICEINITV DETPP LSCPQSY+IELV+KQD+YV+NFNETRRR+NVSDASG
Sbjct: 1529 AFDFDGNVAICEINITVTDETPPQLSCPQSYVIELVNKQDNYVVNFNETRRRINVSDASG 1588

Query: 616  EVTVTFSPDRATILLGDFENVTVTAAD 642
            EVT+TF+PDRA+I +GDFENVTVTAAD
Sbjct: 1589 EVTLTFNPDRASIAIGDFENVTVTAAD 1615

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|242011892\|ref\|XP_002426677.1\| conserved hypothetical protein [Pediculus humanus corporis] gi\|212510848\|gb\|EEB13939.1\| conserved hypothetical protein [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|345481600\|ref\|XP_001606223.2\| PREDICTED: hypothetical protein LOC100122612 [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|332016443\|gb\|EGI57356.1\| Fibropellin-1 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|270002799\|gb\|EEZ99246.1\| hypothetical protein TcasGA2_TC000871 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|189234400\|ref\|XP_974965.2\| PREDICTED: similar to SP1070 CG9138-PA [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|195471601\|ref\|XP_002088091.1\| GE18383 [Drosophila yakuba] gi\|194174192\|gb\|EDW87803.1\| GE18383 [Drosophila yakuba]	Back alignment and taxonomy information

>gi\|340717389\|ref\|XP_003397166.1\| PREDICTED: hypothetical protein LOC100648516 [Bombus terrestris]	Back alignment and taxonomy information

>gi\|350413330\|ref\|XP_003489961.1\| PREDICTED: hypothetical protein LOC100747564 [Bombus impatiens]	Back alignment and taxonomy information

>gi\|195577197\|ref\|XP_002078459.1\| GD22519 [Drosophila simulans] gi\|194190468\|gb\|EDX04044.1\| GD22519 [Drosophila simulans]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		642
FB\|FBgn0031879		3589	uif "uninflatable" [Drosophila	0.552	0.098	0.724	1.3e-175
WB\|WBGene00018546		3170	F47C12.1 [Caenorhabditis elega	0.395	0.080	0.358	5.9e-54
UNIPROTKB\|F1NE59		3406	SVEP1 "Uncharacterized protein	0.182	0.034	0.358	2.9e-21
UNIPROTKB\|F1SND0		3573	SVEP1 "Uncharacterized protein	0.182	0.032	0.383	6.6e-21
UNIPROTKB\|F1MNH3		3573	SVEP1 "Uncharacterized protein	0.182	0.032	0.383	8.8e-20
UNIPROTKB\|F1Q0A7		3253	SVEP1 "Uncharacterized protein	0.182	0.035	0.375	8.9e-20
UNIPROTKB\|J9NWK3		3569	SVEP1 "Uncharacterized protein	0.182	0.032	0.375	1.5e-19
UNIPROTKB\|Q4LDE5		3571	SVEP1 "Sushi, von Willebrand f	0.182	0.032	0.358	1.9e-18
RGD\|1588987		3564	Svep1 "sushi, von Willebrand f	0.182	0.032	0.358	6.3e-18
UNIPROTKB\|P0C6B8		3564	Svep1 "Sushi, von Willebrand f	0.182	0.032	0.358	6.3e-18

FB\|FBgn0031879 uif "uninflatable" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1371 (487.7 bits), Expect = 1.3e-175, Sum P(3) = 1.3e-175
 Identities = 265/366 (72%), Positives = 295/366 (80%)

Query:   278 QVRYDDEQGSEVQFGCNKPGYILINPRPITCVREPECKIIKPLGLASGRIPDSSINATSE 337
             Q+    EQ SEV FGCN+PGYILINPRPITC+REPECK+IKPLGL+SGRIPDS+INATSE
Sbjct:  1262 QIARSYEQSSEVYFGCNRPGYILINPRPITCIREPECKVIKPLGLSSGRIPDSAINATSE 1321

Query:   338 SPYLVRVNACSVPLIPGPRVQELLAEKNVRLFNVLRTLANMEVYVYRLAILVKGVVTNDI 397
              P     N            QE     +V L  + R  A          ILVKGVVTNDI
Sbjct:  1322 RPNYEAKNIRLNSATGWCGKQEAFTYVSVDLGQIYRVKA----------ILVKGVVTNDI 1371

Query:   398 VGRPTEIRFFYKQAESENFVVYFPNFNLTMRDPGNYGELAMITLPKFVQARFVILGIVSY 457
             VGRPTEIRFFYKQAESEN+VVYFPNFNLTMRDPGNYGELAMITLPKFVQARFVILGIVSY
Sbjct:  1372 VGRPTEIRFFYKQAESENYVVYFPNFNLTMRDPGNYGELAMITLPKFVQARFVILGIVSY 1431

Query:   458 MDNACLKFELMGCEEPKVEPLLGYDYGYSPCVDNEPPVFQNCPQQPIIVRKGPNG-IEPV 516
             MDNACLKFELMGCEEPK EPLLGYDYGYSPCVDNEPP+FQNCPQQPI+VR+  NG + PV
Sbjct:  1432 MDNACLKFELMGCEEPKQEPLLGYDYGYSPCVDNEPPIFQNCPQQPIVVRRDENGGVLPV 1491

Query:   517 NITEPVAVDNSGSIARLEIKPQSFKTPMITFHDMAVKYIAYDFDGNVAICEINITVVDET 576
             N TEP AVDNSGSIARLEIKPQ+F+TP   F D  VKY+A+D+DGNVAICEINITV D T
Sbjct:  1492 NFTEPTAVDNSGSIARLEIKPQNFRTPSYIFKDTVVKYVAFDYDGNVAICEINITVPDVT 1551

Query:   577 PPLLSCPQSYIIELVDKQDSYVMNFNETRRRVNVSDASGEVTVTFSPDRATILLGDFENV 636
             PPLL CPQSY+IELVD+QDSY +NFN+TR+R+  SD +G+V + FSP+ A I +G+FENV
Sbjct:  1552 PPLLQCPQSYVIELVDRQDSYTVNFNDTRKRIKTSDDTGDVRLQFSPESANIKIGNFENV 1611

Query:   637 TVTAAD 642
             TVTA D
Sbjct:  1612 TVTATD 1617

GO:0005112 "Notch binding" evidence=ISS

GO:0007155 "cell adhesion" evidence=IEA

GO:0005509 "calcium ion binding" evidence=IEA

GO:0030246 "carbohydrate binding" evidence=IEA

GO:0016324 "apical plasma membrane" evidence=IDA

GO:0035152 "regulation of tube architecture, open tracheal system" evidence=IMP

GO:0046716 "muscle cell homeostasis" evidence=IMP

GO:0045746 "negative regulation of Notch signaling pathway" evidence=IGI

WB\|WBGene00018546 F47C12.1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NE59 SVEP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SND0 SVEP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MNH3 SVEP1 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1Q0A7 SVEP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|J9NWK3 SVEP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4LDE5 SVEP1 "Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|1588987 Svep1 "sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|P0C6B8 Svep1 "Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		642
pfam07699		48	pfam07699, GCC2_GCC3, GCC2 and GCC3	2e-14
pfam07699		48	pfam07699, GCC2_GCC3, GCC2 and GCC3	5e-09
pfam02494		81	pfam02494, HYR, HYR domain	7e-07
cd00057		143	cd00057, FA58C, Coagulation factor 5/8 C-terminal	0.001

>gnl\|CDD\|219525 pfam07699, GCC2_GCC3, GCC2 and GCC3	Back alignment and domain information

 Score = 67.4 bits (165), Expect = 2e-14
 Identities = 21/48 (43%), Positives = 27/48 (56%)

Query: 15 GTFAGINQKTCTPCPRGFYQNNDRQGVCLKCPMGTYTREEGSKAVQEC 62
          GT++    K C PCPRG YQ  + Q  C+ CP GT T   GS +  +C
Sbjct: 1  GTYSNSGLKPCEPCPRGTYQPEEGQDSCIPCPPGTTTLSPGSTSESDC 48

Length = 48

>gnl\|CDD\|219525 pfam07699, GCC2_GCC3, GCC2 and GCC3	Back alignment and domain information

>gnl\|CDD\|111397 pfam02494, HYR, HYR domain	Back alignment and domain information

>gnl\|CDD\|238014 cd00057, FA58C, Coagulation factor 5/8 C-terminal domain, discoidin domain; Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		642
PHA02927		263	secreted complement-binding protein; Provisional	99.97
PHA02927		263	secreted complement-binding protein; Provisional	99.94
PHA02639		295	EEV host range protein; Provisional	99.93
PHA02954		317	EEV membrane glycoprotein; Provisional	99.91
PHA02639		295	EEV host range protein; Provisional	99.91
PHA02831		268	EEV host range protein; Provisional	99.86
PHA02954		317	EEV membrane glycoprotein; Provisional	99.85
PHA02831		268	EEV host range protein; Provisional	99.78
PHA02817		225	EEV Host range protein; Provisional	99.74
PHA02817		225	EEV Host range protein; Provisional	99.72
PF02494		81	HYR: HYR domain; InterPro: IPR003410 This domain i	99.52
PF02494		81	HYR: HYR domain; InterPro: IPR003410 This domain i	99.25
PF07699		48	GCC2_GCC3: GCC2 and GCC3; InterPro: IPR011641 Prot	98.83
cd00033		57	CCP Complement control protein (CCP) modules (aka	98.73
PF00084		56	Sushi: Sushi domain (SCR repeat); InterPro: IPR000	98.7
smart00032		57	CCP Domain abundant in complement control proteins	98.68
cd00033		57	CCP Complement control protein (CCP) modules (aka	98.29
smart00032		57	CCP Domain abundant in complement control proteins	98.26
PF00084		56	Sushi: Sushi domain (SCR repeat); InterPro: IPR000	98.2
PF07699		48	GCC2_GCC3: GCC2 and GCC3; InterPro: IPR011641 Prot	98.09
KOG0196\|consensus		996		97.85
cd00185		98	TNFR Tumor necrosis factor receptor (TNFR) domain;	97.66
cd00185		98	TNFR Tumor necrosis factor receptor (TNFR) domain;	97.39
PTZ00214		800	high cysteine membrane protein Group 4; Provisiona	97.13
PF03302		397	VSP: Giardia variant-specific surface protein; Int	96.72
KOG0196\|consensus		996		96.7
PF07562		54	NCD3G: Nine Cysteines Domain of family 3 GPCR; Int	96.49
KOG4260\|consensus		350		96.32
PHA02637		127	TNF-alpha-receptor-like protein; Provisional	96.32
PTZ00214		800	high cysteine membrane protein Group 4; Provisiona	94.74
PHA02637		127	TNF-alpha-receptor-like protein; Provisional	94.1
PF07562		54	NCD3G: Nine Cysteines Domain of family 3 GPCR; Int	93.34
PF13750		158	Big_3_3: Bacterial Ig-like domain (group 3)	93.3
KOG0994\|consensus		1758		92.58
KOG4260\|consensus		350		91.57
PF03302		397	VSP: Giardia variant-specific surface protein; Int	91.4
KOG4289\|consensus		2531		90.71
KOG0994\|consensus		1758		89.99
PF12245		60	Big_3_2: Bacterial Ig-like domain (group 3); Inter	87.56
PF13754		54	Big_3_4: Bacterial Ig-like domain (group 3)	87.44
KOG4289\|consensus		2531		87.03
PF13753		317	SWM_repeat: Putative flagellar system-associated r	85.01
PTZ00382		96	Variant-specific surface protein (VSP); Provisiona	81.58

>PHA02927 secreted complement-binding protein; Provisional	Back alignment and domain information

Probab=99.97  E-value=6.9e-30  Score=259.48  Aligned_cols=158  Identities=22%  Similarity=0.496  Sum_probs=129.5

Q ss_pred             CCCCCCCCCCCCccceecC-----CCCee----eEEeCCCCeecc--CCcCCCCceEecccCCeeecCCCCccCCcCCCC
Q psy833          116 RNFCRVPTPGAEYGNFLDT-----RYQSS----FFFGCQDTFKLA--GQTDKNDNVVRCQANGIWDFGDLRCEGPVCSDP  184 (642)
Q Consensus       116 ~~~C~~~~~~p~nG~~~~~-----~~~~~----~~~~C~~Gy~l~--g~~~~~~~~~~C~~~G~Ws~~~p~C~~~~C~~p  184 (642)
                      ...|+ .+..|.||.+...     +..|.    .+|+|++||.+.  |..     .++|+.+| |+. .|.|+++.|+.|
T Consensus        18 ~~~c~-~~~~~~~~~~~~~~~~~~~~~y~~g~~v~y~C~~Gy~~~~~g~~-----~~~C~~~g-Ws~-~p~C~~~~C~~p   89 (263)
T PHA02927         18 LSCCT-IPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPI-----YAKCTGTG-WTL-FNQCIKRRCPSP   89 (263)
T ss_pred             hccCC-CCCcccceeeccccccccCceeCCCCEEEEEeCCCceecCCCcc-----EEEecCCC-CCC-CCcEEeCCCcCC
Confidence            35577 5577888887642     22232    299999999975  777     89999988 995 799999999999


Q ss_pred             CCCCCceeeecceeeeeeCCcCCCCccccccCcEEEEEcccCccccCCccCCCceEEeccCC----eecCCCCceecCcC
Q psy833          185 GRPVDGYQVATSYEQVRYDDEQYGNFLDTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANG----IWDFGDLRCEGPVC  260 (642)
Q Consensus       185 ~~~~~g~~~~~~~~~C~~~~~~~g~~~~~~~gs~~~~~C~~Gy~l~G~~~~~~~~~~C~~~G----~Ws~~~P~C~~~~C  260 (642)
                      +.+.||.+..                ..+.+|++|.|+|++||+|+|.+.     ++|+++|    +|++..|.|+.+.|
T Consensus        90 ~~i~NG~~~~----------------~~~~~G~~v~y~C~~Gy~l~G~~~-----~~C~~~~~g~~~Ws~~~P~C~~~~C  148 (263)
T PHA02927         90 RDIDNGQLDI----------------GGVDFGSSITYSCNSGYQLIGESK-----SYCELGSTGSMVWNPEAPICESVKC  148 (263)
T ss_pred             CCCCCCEEeC----------------CCccCCCEEEEECCCCCEEcCCCe-----eEEEeCCCCcceECCCCCccccccC
Confidence            9999998322                236899999999999999999864     8998753    79999999999999


Q ss_pred             CCCCCCCCcEEEccC--CccccccCCCCCEEEEEccCCCeEEeCCCceeeCC
Q psy833          261 SDPGRPVDGYQVATS--YEQVRYDDEQGSEVQFGCNKPGYILINPRPITCVR  310 (642)
Q Consensus       261 ~~p~~~~~g~~~~~~--~~~~~~~~~~gs~~~~~C~~~Gy~l~G~~~~~C~~  310 (642)
                      +.|+.+.||.+....  +.       +|++|+|+|+ +||+|+|...++|++
T Consensus       149 ~~P~~~~nG~~~~~~~~y~-------~g~~v~y~C~-~Gy~l~G~~~~~C~~  192 (263)
T PHA02927        149 QSPPSISNGRHNGYEDFYT-------DGSVVTYSCN-SGYSLIGNSGVLCSG  192 (263)
T ss_pred             CCCCCCCCcEEcCCccccc-------CCCEEEEECC-CCCEECCCCeeEECC
Confidence            999999999986531  33       8999999999 999999988887753

>PHA02927 secreted complement-binding protein; Provisional	Back alignment and domain information

>PHA02639 EEV host range protein; Provisional	Back alignment and domain information

>PHA02954 EEV membrane glycoprotein; Provisional	Back alignment and domain information

>PHA02639 EEV host range protein; Provisional	Back alignment and domain information

>PHA02831 EEV host range protein; Provisional	Back alignment and domain information

>PHA02954 EEV membrane glycoprotein; Provisional	Back alignment and domain information

>PHA02831 EEV host range protein; Provisional	Back alignment and domain information

>PHA02817 EEV Host range protein; Provisional	Back alignment and domain information

>PHA02817 EEV Host range protein; Provisional	Back alignment and domain information

>PF02494 HYR: HYR domain; InterPro: IPR003410 This domain is known as the HYR (Hyalin Repeat) domain, after the protein hyalin that is composed exclusively of this repeat	Back alignment and domain information

>PF02494 HYR: HYR domain; InterPro: IPR003410 This domain is known as the HYR (Hyalin Repeat) domain, after the protein hyalin that is composed exclusively of this repeat	Back alignment and domain information

>PF07699 GCC2_GCC3: GCC2 and GCC3; InterPro: IPR011641 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>cd00033 CCP Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system	Back alignment and domain information

>PF00084 Sushi: Sushi domain (SCR repeat); InterPro: IPR000436 Sushi domains are also known as Complement control protein (CCP) modules, or short consensus repeats (SCR), exist in a wide variety of complement and adhesion proteins	Back alignment and domain information

>smart00032 CCP Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR)	Back alignment and domain information

>cd00033 CCP Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system	Back alignment and domain information

>smart00032 CCP Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR)	Back alignment and domain information

>PF00084 Sushi: Sushi domain (SCR repeat); InterPro: IPR000436 Sushi domains are also known as Complement control protein (CCP) modules, or short consensus repeats (SCR), exist in a wide variety of complement and adhesion proteins	Back alignment and domain information

>PF07699 GCC2_GCC3: GCC2 and GCC3; InterPro: IPR011641 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>KOG0196\|consensus	Back alignment and domain information

>cd00185 TNFR Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains	Back alignment and domain information

>cd00185 TNFR Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains	Back alignment and domain information

>PTZ00214 high cysteine membrane protein Group 4; Provisional	Back alignment and domain information

>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein)	Back alignment and domain information

>KOG0196\|consensus	Back alignment and domain information

>PF07562 NCD3G: Nine Cysteines Domain of family 3 GPCR; InterPro: IPR011500 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes)	Back alignment and domain information

>KOG4260\|consensus	Back alignment and domain information

>PHA02637 TNF-alpha-receptor-like protein; Provisional	Back alignment and domain information

>PTZ00214 high cysteine membrane protein Group 4; Provisional	Back alignment and domain information

>PHA02637 TNF-alpha-receptor-like protein; Provisional	Back alignment and domain information

>PF07562 NCD3G: Nine Cysteines Domain of family 3 GPCR; InterPro: IPR011500 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes)	Back alignment and domain information

>PF13750 Big_3_3: Bacterial Ig-like domain (group 3)	Back alignment and domain information

>KOG0994\|consensus	Back alignment and domain information

>KOG4260\|consensus	Back alignment and domain information

>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein)	Back alignment and domain information

>KOG4289\|consensus	Back alignment and domain information

>KOG0994\|consensus	Back alignment and domain information

>PF12245 Big_3_2: Bacterial Ig-like domain (group 3); InterPro: IPR022038 This family of proteins is found in bacteria	Back alignment and domain information

>PF13754 Big_3_4: Bacterial Ig-like domain (group 3)	Back alignment and domain information

>KOG4289\|consensus	Back alignment and domain information

>PF13753 SWM_repeat: Putative flagellar system-associated repeat	Back alignment and domain information

>PTZ00382 Variant-specific surface protein (VSP); Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		642
2gsx_A		951	Complement Receptor Type 2 Length = 951		7e-06

>pdb|2GSX|A Chain A, Complement Receptor Type 2 Length = 951

Back alignment and structure

Iteration: 1

Score = 49.3 bits (116), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 57/220 (25%), Positives = 80/220 (36%), Gaps = 47/220 (21%) Query: 118 FCRVPTP---GAEYGNFL-DTRYQSSFFFGCQD------TFKLAGQTDKNDNVVRC---- 163 FC P P G GN L + Y S + C F L G++ +RC Sbjct: 255 FCPSPPPILNGRHIGNSLANVSYGSIVTYTCDPDPEEGVNFILIGES-----TLRCTVDS 309 Query: 164 QANGIWDFGDLRCEGPVCSDPGRPVDGYQVATSYEQVRYDDEQYGNFLDTRYQSSFFFGC 223 Q G W RCE + V + Q+ G Y + F C Sbjct: 310 QKTGTWSGPAPRCE----------LSTSAVQCPHPQILRGRMVSGQKDRYTYNDTVIFAC 359 Query: 224 QDTFKLAGQTDKNDNVVRCQANGIWDFGDLRCEGPVCSDPGRPVDGYQVATSYEQVRYDD 283 F L G +RC A G W+ CE C P ++G + VR+D Sbjct: 360 MFGFTLKGSKQ-----IRCNAQGTWEPSAPVCEKE-CQAPPNILNGQK--EDRHMVRFDP 411 Query: 284 EQGSEVQFGCNKPGYILINPRPITCVRE-------PECKI 316 G+ +++ CN PGY+L+ I C E P+CK+ Sbjct: 412 --GTSIKYSCN-PGYVLVGEESIQCTSEGVWTPPVPQCKV 448

PyMOL of 2gsx

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		642
4deq_A		218	Neuropilin-1, vascular endothelial growth factor;	3e-17
1qub_A		319	Protein (human BETA2-glycoprotein I); short consen	8e-17
1qub_A		319	Protein (human BETA2-glycoprotein I); short consen	2e-13
2wii_C		277	H factor 1, complement factor H; immune system, su	3e-16
2gsx_A		951	Complement receptor type 2; SCR domain, CCP domain	5e-16
2gsx_A		951	Complement receptor type 2; SCR domain, CCP domain	2e-12
2gsx_A		951	Complement receptor type 2; SCR domain, CCP domain	5e-12
2gsx_A		951	Complement receptor type 2; SCR domain, CCP domain	1e-08
2gsx_A		951	Complement receptor type 2; SCR domain, CCP domain	5e-08
3hrz_D		741	Complement factor B; serine protease, glycosilated	4e-15
3hrz_D		741	Complement factor B; serine protease, glycosilated	6e-05
2c8i_E		316	CD55, complement decay-accelerating factor; picorn	1e-14
3o8e_B		252	Membrane cofactor protein; short consensus repeat,	2e-14
3o8e_B		252	Membrane cofactor protein; short consensus repeat,	3e-12
1ok3_A		254	CD55, CR, DAF, complement decay-accelerating facto	6e-14
1ntl_A		551	CRRY-IG; immunology, complement, glycoprotein, SCR	1e-13
1ntl_A		551	CRRY-IG; immunology, complement, glycoprotein, SCR	2e-08
2qy0_A		159	Complement C1R subcomponent; serine protease, beta	2e-13
2qy0_A		159	Complement C1R subcomponent; serine protease, beta	8e-07
2qy0_A		159	Complement C1R subcomponent; serine protease, beta	2e-05
3iyp_F		381	Complement decay-accelerating factor; virus, recep	4e-13
1ntj_A		320	Complement receptor related protein; immunology, g	6e-13
1ntj_A		320	Complement receptor related protein; immunology, g	1e-10
3sw0_X		188	H factor 1, complement factor H; innate immune res	1e-12
3erb_A		223	Complement C2; C3/C5 convertase, short consensus r	2e-12
3erb_A		223	Complement C2; C3/C5 convertase, short consensus r	2e-10
3erb_A		223	Complement C2; C3/C5 convertase, short consensus r	8e-05
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	4e-12
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	5e-12
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	6e-12
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	1e-10
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	2e-10
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	2e-09
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	2e-09
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	3e-09
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	4e-08
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	1e-07
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	6e-07
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	3e-06
2wuh_A		178	Discoidin domain receptor 2; receptor-peptide comp	7e-12
3gov_A		155	MAsp-1; complement, serine protease, beta barrel,	2e-11
3gov_A		155	MAsp-1; complement, serine protease, beta barrel,	2e-08
2uwn_A		187	H factor 1, human complement factor H; alternative	3e-11
2uwn_A		187	H factor 1, human complement factor H; alternative	3e-05
1rid_A		244	Complement control protein; regulation, SCR, immun	3e-11
1rid_A		244	Complement control protein; regulation, SCR, immun	2e-10
1rid_A		244	Complement control protein; regulation, SCR, immun	5e-05
1haq_A		1213	Complement factor H; immunology, glycoprotein, com	3e-11
1haq_A		1213	Complement factor H; immunology, glycoprotein, com	2e-10
1haq_A		1213	Complement factor H; immunology, glycoprotein, com	2e-10
1haq_A		1213	Complement factor H; immunology, glycoprotein, com	3e-10
1haq_A		1213	Complement factor H; immunology, glycoprotein, com	4e-10
1haq_A		1213	Complement factor H; immunology, glycoprotein, com	4e-09
1haq_A		1213	Complement factor H; immunology, glycoprotein, com	1e-07
1haq_A		1213	Complement factor H; immunology, glycoprotein, com	2e-06
1haq_A		1213	Complement factor H; immunology, glycoprotein, com	8e-05
2xrb_A		290	Complement regulatory protein CRRY; immune system,	1e-10
2xrb_A		290	Complement regulatory protein CRRY; immune system,	2e-10
2xrb_A		290	Complement regulatory protein CRRY; immune system,	3e-05
2a55_A		133	C4B-binding protein; complement, SCR, CCP module,	3e-09
2a55_A		133	C4B-binding protein; complement, SCR, CCP module,	3e-06
3hny_M		159	Coagulation factor VIII; blood clotting, acute pha	6e-09
1gkn_A		128	Complement receptor type 1; module, SCR, structure	7e-09
1gkn_A		128	Complement receptor type 1; module, SCR, structure	2e-06
3bn6_A		158	Lactadherin; anticoagulation, anti-coagulation, an	1e-08
3r62_A		129	H factor 1, complement factor H; immunity, repeati	2e-08
4ag4_A		351	Epithelial discoidin domain-containing receptor 1;	4e-08
1czt_A		160	Protein (coagulation factor V); membrane-binding,	7e-08
1zjk_A		403	Mannan-binding lectin serine protease 2; beta barr	1e-07
1zjk_A		403	Mannan-binding lectin serine protease 2; beta barr	9e-05
1gkg_A		136	Complement receptor type 1; module, SCR, structure	2e-07
1h03_P		125	Complement decay-accelerating factor; immune syste	4e-07
1h03_P		125	Complement decay-accelerating factor; immune syste	1e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-07
2qqi_A		318	Neuropilin-1; VEGF receptor, semaphorin receptor,	2e-06
2qqk_A		579	Neuropilin-2; VEGF receptor, semaphorin receptor,	2e-06
3u3p_A		313	Tumor necrosis factor receptor superfamily member;	8e-06
3u3p_A		313	Tumor necrosis factor receptor superfamily member;	6e-05
3u3p_A		313	Tumor necrosis factor receptor superfamily member;	5e-04
3u3p_A		313	Tumor necrosis factor receptor superfamily member;	7e-04
3qd6_R		177	CD40L receptor, tumor necrosis factor receptor sup	9e-06
2qqj_A		325	Neuropilin-2; VEGF receptor, semaphorin receptor,	1e-05
2ehf_A		73	CUB and sushi domain-containing protein 1; CUB and	1e-05
2ehf_A		73	CUB and sushi domain-containing protein 1; CUB and	2e-05
2yby_A		124	Complement factor H; immune system, complement reg	1e-05
1ly2_A		130	CD21, complement receptor type 2; epstein BARR vir	2e-05
1ly2_A		130	CD21, complement receptor type 2; epstein BARR vir	8e-05
3alq_R		173	Tumor necrosis factor receptor superfamily member;	3e-05
1gpz_A		399	Complement C1R component; hydrolase, activation, i	3e-05
1gpz_A		399	Complement C1R component; hydrolase, activation, i	4e-04
3tvj_A		86	Mannan-binding lectin serine protease 2 A chain; i	3e-05
3tvj_A		86	Mannan-binding lectin serine protease 2 A chain; i	8e-05
1sg1_X		161	Tumor necrosis factor receptor superfamily member	5e-05
1sg1_X		161	Tumor necrosis factor receptor superfamily member	2e-04
2uwi_A		142	CRME protein; receptor, poxvirus TNF receptor, rec	1e-04
2uwi_A		142	CRME protein; receptor, poxvirus TNF receptor, rec	1e-04
3me4_A		216	Tumor necrosis factor receptor superfamily member;	2e-04
2hey_R		146	Tumor necrosis factor receptor superfamily member;	3e-04
1jma_B		167	Herpesvirus entry mediator; V-type IG molecule and	3e-04
3t5o_A		913	Complement component C6; macpf, MAC, membrane atta	3e-04
2yra_A		74	Seizure 6-like protein isoform 3; disulfide bond,	5e-04
1ext_A		162	Tumor necrosis factor receptor; binding protein, c	6e-04

>4deq_A Neuropilin-1, vascular endothelial growth factor; coagulation factor domain, heparin binding domain, angiogene protein binding-cytokine complex; 2.65A {Homo sapiens} PDB: 1kmx_A 1vgh_A 2vgh_A Length = 218	Back alignment and structure

 Score = 80.1 bits (197), Expect = 3e-17
 Identities = 34/204 (16%), Positives = 68/204 (33%), Gaps = 33/204 (16%)

Query: 311 EPECKIIKPLGLASGRIPDSSINATSE-----SPYLVRVNA-----CSVPLIPGPRVQ-E 359
             +C  ++ LG+ SG I    I A+S+     S    R+N                +Q +
Sbjct: 3   HMKC--MEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVD 60

Query: 360 LLAEKNVRLFNVLRTLANMEVYVYRLAILVKGVVTNDIVGRP--TEIRFFYKQAESENFV 417
           L   + V                   A+  +G ++ +   +      +        +   
Sbjct: 61  LGLLRFVT------------------AVGTQGAISKETKKKYYVKTYKIDVSSNGEDWIT 102

Query: 418 VYFPNFNLTMRDPGNYGELAMITLPKFVQARFVILGIVSYMDNACLKFELMGCEEPKVEP 477
           +   N  +  +   N  ++ +   PK +  RFV +   ++     ++FE+ GC+      
Sbjct: 103 IKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYVD 162

Query: 478 LLGYDYGYSPCVDNEPPVFQNCPQ 501
             G      PC +    +F   PQ
Sbjct: 163 GSGSGSPCGPCSERRKHLFVQDPQ 186

PyMOL of 4deq

>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319	Back alignment and structure

>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319	Back alignment and structure

>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277	Back alignment and structure

>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951	Back alignment and structure

>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951	Back alignment and structure

>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951	Back alignment and structure

>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951	Back alignment and structure

>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951	Back alignment and structure

>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741	Back alignment and structure

>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741	Back alignment and structure

>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252	Back alignment and structure

>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252	Back alignment and structure

>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254	Back alignment and structure

>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551	Back alignment and structure

>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551	Back alignment and structure

>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159	Back alignment and structure

>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159	Back alignment and structure

>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159	Back alignment and structure

>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381	Back alignment and structure

>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320	Back alignment and structure

>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320	Back alignment and structure

>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188	Back alignment and structure

>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223	Back alignment and structure

>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223	Back alignment and structure

>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931	Back alignment and structure

>2wuh_A Discoidin domain receptor 2; receptor-peptide complex, transferase, nucleotide-binding, tyrosine-protein kinase; 1.60A {Homo sapiens} PDB: 2z4f_A Length = 178	Back alignment and structure

>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155	Back alignment and structure

>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155	Back alignment and structure

>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187	Back alignment and structure

>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187	Back alignment and structure

>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244	Back alignment and structure

>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244	Back alignment and structure

>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244	Back alignment and structure

>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213	Back alignment and structure

>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213	Back alignment and structure

>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213	Back alignment and structure

>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213	Back alignment and structure

>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213	Back alignment and structure

>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213	Back alignment and structure

>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213	Back alignment and structure

>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213	Back alignment and structure

>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213	Back alignment and structure

>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290	Back alignment and structure

>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290	Back alignment and structure

>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290	Back alignment and structure

>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133	Back alignment and structure

>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133	Back alignment and structure

>3hny_M Coagulation factor VIII; blood clotting, acute phase, blood coagulation, calcium, DIS mutation, disulfide bond, glycoprotein, hemophilia; 1.07A {Homo sapiens} PDB: 3hnb_M 3hob_M 1d7p_M 1iqd_C 1cfg_A 1fac_A Length = 159	Back alignment and structure

>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128	Back alignment and structure

>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128	Back alignment and structure

>3bn6_A Lactadherin; anticoagulation, anti-coagulation, anticoagulant, anti- coagulant, membrane binding, phosphatidyl-serine binding; 1.67A {Bos taurus} PDB: 2pqs_A Length = 158	Back alignment and structure

>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129	Back alignment and structure

>4ag4_A Epithelial discoidin domain-containing receptor 1; immune system-transferase complex; HET: NAG; 2.80A {Homo sapiens} Length = 351	Back alignment and structure

>1czt_A Protein (coagulation factor V); membrane-binding, discoidin family, calcium- independent, blood clotting; 1.87A {Homo sapiens} SCOP: b.18.1.2 PDB: 1czs_A 1czv_A Length = 160	Back alignment and structure

>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403	Back alignment and structure

>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403	Back alignment and structure

>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136	Back alignment and structure

>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125	Back alignment and structure

>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A Length = 318	Back alignment and structure

>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579	Back alignment and structure

>3u3p_A Tumor necrosis factor receptor superfamily member; trigger apoptosis, apoptosis; 2.09A {Homo sapiens} PDB: 3u3q_A 3u3s_A 3u3t_A 3u3v_A 3qo4_A Length = 313	Back alignment and structure

>3u3p_A Tumor necrosis factor receptor superfamily member; trigger apoptosis, apoptosis; 2.09A {Homo sapiens} PDB: 3u3q_A 3u3s_A 3u3t_A 3u3v_A 3qo4_A Length = 313	Back alignment and structure

>3u3p_A Tumor necrosis factor receptor superfamily member; trigger apoptosis, apoptosis; 2.09A {Homo sapiens} PDB: 3u3q_A 3u3s_A 3u3t_A 3u3v_A 3qo4_A Length = 313	Back alignment and structure

>3u3p_A Tumor necrosis factor receptor superfamily member; trigger apoptosis, apoptosis; 2.09A {Homo sapiens} PDB: 3u3q_A 3u3s_A 3u3t_A 3u3v_A 3qo4_A Length = 313	Back alignment and structure

>3qd6_R CD40L receptor, tumor necrosis factor receptor superfamily member; immune regulator, cytokine-cytokine receptor compl; HET: NAG; 3.50A {Homo sapiens} Length = 177	Back alignment and structure

>2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} Length = 325	Back alignment and structure

>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Length = 124	Back alignment and structure

>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130	Back alignment and structure

>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130	Back alignment and structure

>3alq_R Tumor necrosis factor receptor superfamily member; ligand-receptor complex, cytokine, cytokine-cytokine recepto; 3.00A {Homo sapiens} Length = 173	Back alignment and structure

>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399	Back alignment and structure

>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399	Back alignment and structure

>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86	Back alignment and structure

>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86	Back alignment and structure

>1sg1_X Tumor necrosis factor receptor superfamily member 16; nerve growth factor, NGF, neurotrophin, common neurotrophin receptor; 2.40A {Rattus norvegicus} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 g.24.1.1 PDB: 3buk_C* 3ij2_X Length = 161	Back alignment and structure

>1sg1_X Tumor necrosis factor receptor superfamily member 16; nerve growth factor, NGF, neurotrophin, common neurotrophin receptor; 2.40A {Rattus norvegicus} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 g.24.1.1 PDB: 3buk_C* 3ij2_X Length = 161	Back alignment and structure

>2uwi_A CRME protein; receptor, poxvirus TNF receptor, receptor immunomodulator, TNF alpha receptor; 2.0A {Vaccinia virus} Length = 142	Back alignment and structure

>2uwi_A CRME protein; receptor, poxvirus TNF receptor, receptor immunomodulator, TNF alpha receptor; 2.0A {Vaccinia virus} Length = 142	Back alignment and structure

>3me4_A Tumor necrosis factor receptor superfamily member; RANK, rankl, rankl-RANK complex, tnfsf11, tnfrsf11A, TNF SUP signaling protein; 2.01A {Mus musculus} PDB: 3me2_R 3qbq_B 3nzy_B Length = 216	Back alignment and structure

>2hey_R Tumor necrosis factor receptor superfamily member; cytokine, receptor-ligan complex, CO-stimulator, TNFSF; 2.00A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 2hev_R Length = 146	Back alignment and structure

>1jma_B Herpesvirus entry mediator; V-type IG molecule and TNFR superfamily, viral protein; HET: NAG; 2.65A {Human herpesvirus 1} SCOP: g.24.1.1 g.24.1.1 PDB: 2aw2_B* Length = 167	Back alignment and structure

>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913	Back alignment and structure

>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

>1ext_A Tumor necrosis factor receptor; binding protein, cytokine, signalling protein; 1.85A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 1ft4_A* 1ncf_A 1tnr_R Length = 162	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		642
2gsx_A		951	Complement receptor type 2; SCR domain, CCP domain	100.0
1ntj_A		320	Complement receptor related protein; immunology, g	100.0
2gsx_A		951	Complement receptor type 2; SCR domain, CCP domain	100.0
1qub_A		319	Protein (human BETA2-glycoprotein I); short consen	100.0
1haq_A		1213	Complement factor H; immunology, glycoprotein, com	100.0
2c8i_E		316	CD55, complement decay-accelerating factor; picorn	100.0
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	100.0
1haq_A		1213	Complement factor H; immunology, glycoprotein, com	100.0
2q7z_A		1931	Complement receptor type 1; SCR domain, blood grou	100.0
3o8e_B		252	Membrane cofactor protein; short consensus repeat,	100.0
1ntl_A		551	CRRY-IG; immunology, complement, glycoprotein, SCR	100.0
2xrb_A		290	Complement regulatory protein CRRY; immune system,	99.97
2wii_C		277	H factor 1, complement factor H; immune system, su	99.97
1ok3_A		254	CD55, CR, DAF, complement decay-accelerating facto	99.97
3iyp_F		381	Complement decay-accelerating factor; virus, recep	99.97
1ntj_A		320	Complement receptor related protein; immunology, g	99.96
1rid_A		244	Complement control protein; regulation, SCR, immun	99.96
2c8i_E		316	CD55, complement decay-accelerating factor; picorn	99.96
1qub_A		319	Protein (human BETA2-glycoprotein I); short consen	99.96
1ntl_A		551	CRRY-IG; immunology, complement, glycoprotein, SCR	99.96
3o8e_B		252	Membrane cofactor protein; short consensus repeat,	99.95
1ok3_A		254	CD55, CR, DAF, complement decay-accelerating facto	99.94
1rid_A		244	Complement control protein; regulation, SCR, immun	99.93
2xrb_A		290	Complement regulatory protein CRRY; immune system,	99.93
3iyp_F		381	Complement decay-accelerating factor; virus, recep	99.93
3erb_A		223	Complement C2; C3/C5 convertase, short consensus r	99.93
2wii_C		277	H factor 1, complement factor H; immune system, su	99.92
3sw0_X		188	H factor 1, complement factor H; innate immune res	99.9
3erb_A		223	Complement C2; C3/C5 convertase, short consensus r	99.89
3hrz_D		741	Complement factor B; serine protease, glycosilated	99.89
2uwn_A		187	H factor 1, human complement factor H; alternative	99.87
3t5o_A		913	Complement component C6; macpf, MAC, membrane atta	99.86
3sw0_X		188	H factor 1, complement factor H; innate immune res	99.84
2qy0_A		159	Complement C1R subcomponent; serine protease, beta	99.81
3gov_A		155	MAsp-1; complement, serine protease, beta barrel,	99.81
3hrz_D		741	Complement factor B; serine protease, glycosilated	99.81
1gkg_A		136	Complement receptor type 1; module, SCR, structure	99.8
1gkn_A		128	Complement receptor type 1; module, SCR, structure	99.8
2uwn_A		187	H factor 1, human complement factor H; alternative	99.79
1ly2_A		130	CD21, complement receptor type 2; epstein BARR vir	99.77
1gkn_A		128	Complement receptor type 1; module, SCR, structure	99.76
1h03_P		125	Complement decay-accelerating factor; immune syste	99.76
1h03_P		125	Complement decay-accelerating factor; immune syste	99.75
3gov_A		155	MAsp-1; complement, serine protease, beta barrel,	99.74
1ly2_A		130	CD21, complement receptor type 2; epstein BARR vir	99.74
2a55_A		133	C4B-binding protein; complement, SCR, CCP module,	99.74
1gkg_A		136	Complement receptor type 1; module, SCR, structure	99.73
2qy0_A		159	Complement C1R subcomponent; serine protease, beta	99.73
2a55_A		133	C4B-binding protein; complement, SCR, CCP module,	99.72
2aty_A		376	Complement receptor chimeric conjugate CR2-IG; imm	99.69
3t5o_A		913	Complement component C6; macpf, MAC, membrane atta	99.66
2yby_A		124	Complement factor H; immune system, complement reg	99.63
3r62_A		129	H factor 1, complement factor H; immunity, repeati	99.6
3r62_A		129	H factor 1, complement factor H; immunity, repeati	99.59
2aty_A		376	Complement receptor chimeric conjugate CR2-IG; imm	99.59
4ayi_A		125	H factor 1, complement factor H; immune system, an	99.55
4ayi_A		125	H factor 1, complement factor H; immune system, an	99.54
2yby_A		124	Complement factor H; immune system, complement reg	99.53
1zjk_A		403	Mannan-binding lectin serine protease 2; beta barr	99.51
1zjk_A		403	Mannan-binding lectin serine protease 2; beta barr	99.49
2ehf_A		73	CUB and sushi domain-containing protein 1; CUB and	99.41
2yra_A		74	Seizure 6-like protein isoform 3; disulfide bond,	99.31
1gpz_A		399	Complement C1R component; hydrolase, activation, i	99.19
2b5i_D		217	Interleukin-2 receptor alpha chain; four-helix bun	99.15
1gpz_A		399	Complement C1R component; hydrolase, activation, i	99.13
3tvj_A		86	Mannan-binding lectin serine protease 2 A chain; i	99.12
1srz_A		68	Gamma-aminobutyric acid type B receptor, subunit 1	99.08
2ehf_A		73	CUB and sushi domain-containing protein 1; CUB and	99.08
2yra_A		74	Seizure 6-like protein isoform 3; disulfide bond,	99.04
2b5i_D		217	Interleukin-2 receptor alpha chain; four-helix bun	99.04
4aqb_A		361	Mannan-binding lectin serine protease 1; blood clo	98.63
1srz_A		68	Gamma-aminobutyric acid type B receptor, subunit 1	98.59
1jma_B		167	Herpesvirus entry mediator; V-type IG molecule and	98.48
3tvj_A		86	Mannan-binding lectin serine protease 2 A chain; i	98.43
2hey_R		146	Tumor necrosis factor receptor superfamily member;	98.4
1jma_B		167	Herpesvirus entry mediator; V-type IG molecule and	98.34
1sg1_X		161	Tumor necrosis factor receptor superfamily member	98.3
2hey_R		146	Tumor necrosis factor receptor superfamily member;	98.27
3alq_R		173	Tumor necrosis factor receptor superfamily member;	98.19
3alq_R		173	Tumor necrosis factor receptor superfamily member;	98.13
1ext_A		162	Tumor necrosis factor receptor; binding protein, c	98.1
3me4_A		216	Tumor necrosis factor receptor superfamily member;	98.1
4aqb_A		361	Mannan-binding lectin serine protease 1; blood clo	98.04
3u3p_A		313	Tumor necrosis factor receptor superfamily member;	97.99
1sg1_X		161	Tumor necrosis factor receptor superfamily member	97.94
3urf_Z		171	Tumor necrosis factor receptor superfamily member;	97.91
2uwi_A		142	CRME protein; receptor, poxvirus TNF receptor, rec	97.84
1du3_A		130	Death receptor 5; trail, DR5, complex; 2.20A {Homo	97.84
3k51_B		176	Decoy receptor 3; DCR3, TL1A, TNF, TNFR, immunity,	97.79
3qd6_R		177	CD40L receptor, tumor necrosis factor receptor sup	97.74
3me4_A		216	Tumor necrosis factor receptor superfamily member;	97.67
2psm_F		78	Interleukin-15 receptor alpha chain; cytokine, gly	97.61
1du3_A		130	Death receptor 5; trail, DR5, complex; 2.20A {Homo	97.58
3u3p_A		313	Tumor necrosis factor receptor superfamily member;	97.5
3qd6_R		177	CD40L receptor, tumor necrosis factor receptor sup	97.41
1ext_A		162	Tumor necrosis factor receptor; binding protein, c	97.12
3tje_F		156	Tumor necrosis factor receptor superfamily member;	96.98
2z3q_B		107	Interleukin-15 receptor alpha chain; protein-prote	96.95
2uwi_A		142	CRME protein; receptor, poxvirus TNF receptor, rec	96.85
1elv_A		333	Complement C1S component; trypsin-like serin prote	96.63
3tje_F		156	Tumor necrosis factor receptor superfamily member;	96.62
3k51_B		176	Decoy receptor 3; DCR3, TL1A, TNF, TNFR, immunity,	96.6
3fl7_A		536	Ephrin receptor; ATP-binding, kinase, nucleotide-b	96.59
3urf_Z		171	Tumor necrosis factor receptor superfamily member;	96.59
4fhq_A		134	Tumor necrosis factor receptor superfamily member;	96.22
4fhq_A		134	Tumor necrosis factor receptor superfamily member;	95.93
1mox_A		501	Epidermal growth factor receptor; EGFR, receptor,	95.21
2psm_F		78	Interleukin-15 receptor alpha chain; cytokine, gly	95.2
4f4o_C		347	Haptoglobin; globin fold, serine protease fold, co	95.18
1mox_A		501	Epidermal growth factor receptor; EGFR, receptor,	94.38
3pdd_A		190	Glycoside hydrolase, family 9; CBHA, beta-sandwich	93.92
2z3q_B		107	Interleukin-15 receptor alpha chain; protein-prote	93.81
1m6b_A		621	C-ER, receptor protein-tyrosine kinase ERBB-3; cel	93.29
1yy9_A		624	Epidermal growth factor receptor; cell surface rec	93.23
4f4o_C		347	Haptoglobin; globin fold, serine protease fold, co	92.99
3fl7_A		536	Ephrin receptor; ATP-binding, kinase, nucleotide-b	92.97
1elv_A		333	Complement C1S component; trypsin-like serin prote	92.04
1klo_A		162	Laminin; glycoprotein; 2.10A {Mus musculus} SCOP:	92.04
3i2t_A		551	Epidermal growth factor receptor, isoform A; EGFR,	91.59
1n8y_C		608	Protooncoprotein; tyrosin kinase receptor, cell su	91.01
1klo_A		162	Laminin; glycoprotein; 2.10A {Mus musculus} SCOP:	90.16
3hny_M		159	Coagulation factor VIII; blood clotting, acute pha	90.07
2ahx_A		617	P180ERBB4, receptor tyrosine-protein kinase ERBB-4	89.58
2kpn_A		103	Bacillolysin; solution structure, BIG_3 domain, PF	89.31
4deq_A		218	Neuropilin-1, vascular endothelial growth factor;	88.55
2hr7_A		486	Insulin receptor; hormone receptor, leucine rich r	88.29
1md8_A		329	C1R complement serine protease; innate immunity, a	88.18
1m6b_A		621	C-ER, receptor protein-tyrosine kinase ERBB-3; cel	86.66
2kpn_A		103	Bacillolysin; solution structure, BIG_3 domain, PF	86.54
3bn6_A		158	Lactadherin; anticoagulation, anti-coagulation, an	85.24
2ahx_A		617	P180ERBB4, receptor tyrosine-protein kinase ERBB-4	85.01
2e4u_A		555	Metabotropic glutamate receptor 3; G-protein-coupl	83.66
2gy5_A		423	Angiopoietin-1 receptor; ligand-binding domain, tr	83.16
2e4u_A		555	Metabotropic glutamate receptor 3; G-protein-coupl	80.94
1yy9_A		624	Epidermal growth factor receptor; cell surface rec	80.23

>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens}	Back alignment and structure

Probab=100.00  E-value=1.4e-34  Score=344.66  Aligned_cols=416  Identities=18%  Similarity=0.324  Sum_probs=281.4

Q ss_pred             CCCCCCCCCCCCccceecCC-CCee----eEEeCCCC------eeccCCcCCCCceEeccc----CCeeecCCCCc----
Q psy833          116 RNFCRVPTPGAEYGNFLDTR-YQSS----FFFGCQDT------FKLAGQTDKNDNVVRCQA----NGIWDFGDLRC----  176 (642)
Q Consensus       116 ~~~C~~~~~~p~nG~~~~~~-~~~~----~~~~C~~G------y~l~g~~~~~~~~~~C~~----~G~Ws~~~p~C----  176 (642)
                      ...|+ +++.+.||.+.... ..+.    ..|+|+.|      |.|.|..     +++|+.    +|.|+.+.|.|    
T Consensus       253 ~i~C~-~p~~i~nG~~~~~~~~~~~~g~~v~y~C~~g~~~~~~y~l~G~~-----~~~C~~~~~~~g~Ws~~~P~C~~~~  326 (951)
T 2gsx_A          253 EIFCP-SPPPILNGRHIGNSLANVSYGSIVTYTCDPDPEEGVNFILIGES-----TLRCTVDSQKTGTWSGPAPRCELST  326 (951)
T ss_pred             cCcCC-CCCCcCCCceeccccCcccCCCEEEEEcCCCCCCcceEEecCCc-----eEEeccCCCCCCcCCCCCCcccccc
Confidence            35687 56789999988753 2232    39999999      9999999     999999    89999999999    


Q ss_pred             cCCcCCCCCCCCCceeeecceeeeeeCCcCCCCccccccCcEEEEEcccCccccCCccCCCceEEeccCCeecCCCCcee
Q psy833          177 EGPVCSDPGRPVDGYQVATSYEQVRYDDEQYGNFLDTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANGIWDFGDLRCE  256 (642)
Q Consensus       177 ~~~~C~~p~~~~~g~~~~~~~~~C~~~~~~~g~~~~~~~gs~~~~~C~~Gy~l~G~~~~~~~~~~C~~~G~Ws~~~P~C~  256 (642)
                      +.+.|+.|..+.++.+..              ....|.+|++|+|+|++||.|.|+..     ++|+++|+|++..|.|+
T Consensus       327 ~~~~C~~P~~~~~~~~~~--------------~~~~y~~g~~v~f~C~~Gy~l~G~~~-----~~C~~~G~Ws~~~P~C~  387 (951)
T 2gsx_A          327 SAVQCPHPQILRGRMVSG--------------QKDRYTYNDTVIFACMFGFTLKGSKQ-----IRCNAQGTWEPSAPVCE  387 (951)
T ss_pred             cceecCCCCCCCCcEeec--------------CCCccccCCEEEEEcCCCCEEcCCCc-----eEECCCCcCCCCCcccc
Confidence            778999998888876221              11458999999999999999999864     89999999999999999


Q ss_pred             cCcCCCCCCCCCcEEEccCCccccccCCCCCEEEEEccCCCeEEeCCCceeeCC-------CCceEEecCCCCCCccCCC
Q psy833          257 GPVCSDPGRPVDGYQVATSYEQVRYDDEQGSEVQFGCNKPGYILINPRPITCVR-------EPECKIIKPLGLASGRIPD  329 (642)
Q Consensus       257 ~~~C~~p~~~~~g~~~~~~~~~~~~~~~~gs~~~~~C~~~Gy~l~G~~~~~C~~-------~P~C~~v~p~~~~~g~~~~  329 (642)
                      ++ |+.|+.+.||.+.......|.    +|++|+|+|+ +||.|.|+..++|+.       .|.|+++.++.+.++.+..
T Consensus       388 ~~-C~~p~~~~ng~~~~~~~~~~~----~g~~v~~~C~-~Gy~l~G~~~~~C~~~G~Ws~~~p~C~~~~C~~~~~~~~~~  461 (951)
T 2gsx_A          388 KE-CQAPPNILNGQKEDRHMVRFD----PGTSIKYSCN-PGYVLVGEESIQCTSEGVWTPPVPQCKVAACEATGRQLLTK  461 (951)
T ss_pred             cc-cCCCCcccCCeEecCCCcccC----CCCEEEEEcC-CCCEECCCCCeEECCCCcCCCCCCccceeeCCCCCcccccC
Confidence            97 999999999998864322222    7999999999 999999999999996       4899988865555443321


Q ss_pred             ------CCCCccCCCcCceecccccCCCCCCCcccccccccceeeeccCC-cccCccce--eEEee--EEeeceecc---
Q psy833          330 ------SSINATSESPYLVRVNACSVPLIPGPRVQELLAEKNVRLFNVLR-TLANMEVY--VYRLA--ILVKGVVTN---  395 (642)
Q Consensus       330 ------~~~~~~~~~~~y~~~~~~~~~~~~g~~~~~~l~g~~~~~c~~~g-Ws~~~p~c--v~~~~--~~~~g~~~~---  395 (642)
                            .....++|+.||                  .|.|...++|+.+| |++..|.|  +.|..  .+.+|....   
T Consensus       462 ~~~~~~~~~~~~~C~~Gy------------------~l~G~~~~~C~~~g~Ws~~~p~C~~i~C~~pp~i~nG~~~~~~~  523 (951)
T 2gsx_A          462 PQHQFVRPDVNSSCGEGY------------------KLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTGSSL  523 (951)
T ss_pred             CCCceecCeEEEEcCCCc------------------EEcCCCeeEccCcccccCCCceecceeCCCCCCCCCCeEeCCCC
Confidence                  123567899999                  88999999999999 99999999  67752  112232211   


Q ss_pred             --cccccceeeeeeEeeccc----cceEEeeccceeccC----CCCCccCcc--c------ccCc---c-------ceee
Q psy833          396 --DIVGRPTEIRFFYKQAES----ENFVVYFPNFNLTMR----DPGNYGELA--M------ITLP---K-------FVQA  447 (642)
Q Consensus       396 --~~~g~~~~~~~~~~~~~~----~~~~~~~p~~~~~~~----~~g~~~~~~--~------~~~~---~-------~~~~  447 (642)
                        ..+|..    +.|.....    ..|.. .-.-.++|.    .+|.|+...  .      +..+   .       ....
T Consensus       524 ~~~~~g~~----v~y~C~~g~~~~~~y~l-~G~~~~~C~~~~~~~G~Ws~~~P~C~~~~~~~~C~~p~~~~~~~~~~~~~  598 (951)
T 2gsx_A          524 EDFPYGTT----VTYTCNPGPERGVEFSL-IGESTIRCTSNDQERGTWSGPAPLCKLSLLAVQCSHVHIANGYKISGKEA  598 (951)
T ss_pred             CccccCCE----EEEEcCCCCCCCceEEE-ecCceEEecccCCCCccCcCCCceeecCCCccCCcCCCCCCCceEeCCCC
Confidence              111111    22222211    00222 122346776    789998642  1      1111   0       1124


Q ss_pred             eeEEeeEEEEEeCcccceeecc-----cCCCCCcCcccccCCCCCCcCCCCCeeecCCCCceEEEeCCCCeeeEEEcCCc
Q psy833          448 RFVILGIVSYMDNACLKFELMG-----CEEPKVEPLLGYDYGYSPCVDNEPPVFQNCPQQPIIVRKGPNGIEPVNITEPV  522 (642)
Q Consensus       448 ~~~~~~~v~~~C~~~~gf~l~G-----C~~~g~~~~~~Ws~~~P~C~d~~pP~~~~CP~~~i~~~~~~~~~~~v~~~~p~  522 (642)
                      .|.+|++|+|+|++  ||+|.|     |+++|     +|++..|+|+.+      .|+.....+    ++     +    
T Consensus       599 ~~~~g~~v~~~C~~--Gy~l~G~~~~~C~~~g-----~Ws~~~P~C~~~------~C~~~~~~~----~~-----~----  652 (951)
T 2gsx_A          599 PYFYNDTVTFKCYS--GFTLKGSSQIRCKADN-----TWDPEIPVCEKE------TCQHVRQSL----QE-----L----  652 (951)
T ss_pred             cccCCCEEEEEeCC--CCEEcCCCceEECCCC-----CCCCCCCcceec------ccCCCCCCc----CC-----C----
Confidence            68899999999999  999999     99999     999999999975      455431100    00     0    


Q ss_pred             eecCCCceeEEEEccCCCCCCceeecceEEEEEEEeCCCCEEEEEEEEEEecCCCC---eEeCCCCcEEEccCCCceeEE
Q psy833          523 AVDNSGSIARLEIKPQSFKTPMITFHDMAVKYIAYDFDGNVAICEINITVVDETPP---LLSCPQSYIIELVDKQDSYVM  599 (642)
Q Consensus       523 ~~dnsg~~~~~~~~~~~~~~~~~~~G~~~Vtyta~D~~Gn~a~C~f~v~v~d~~pP---~i~Cp~~~~i~~~~~~~~~~v  599 (642)
                         ..|+.+.+.  .....+.+.+.|...+++.. +.+|.          ++...|   .|.|+.++.+.++...     
T Consensus       653 ---~~g~~~~~~--~~~C~~Gy~l~g~~~~~C~~-~~~g~----------Ws~~~p~C~~i~C~~p~~i~nG~~~-----  711 (951)
T 2gsx_A          653 ---PAGSRVELV--NTSCQDGYQLTGHAYQMCQD-AENGI----------WFKKIPLCKVIHCHPPPVIVNGKHT-----  711 (951)
T ss_pred             ---CcCCEEEEE--ecCCCCCcEECCCccceeec-CCCce----------eCCCCceecceeCCCCCcCCCCeEe-----
Confidence               012222222  01122334455666666551 12232          233444   3459998888766331     


Q ss_pred             EecCCCcceeeecCCCCeEEEeCCCCccccCCCceEEEEEE
Q psy833          600 NFNETRRRVNVSDASGEVTVTFSPDRATILLGDFENVTVTA  640 (642)
Q Consensus       600 ~w~~p~~~~~~~Dnsg~~~v~~~~~~g~~~~G~~~~v~~ta  640 (642)
                       -..      ..+..-...|++..++|...+|.. .++.++
T Consensus       712 -~~~------~~~~~~g~~v~y~C~~Gy~l~G~~-~~~C~~  744 (951)
T 2gsx_A          712 -GMM------AENFLYGNEVSYECDQGFYLLGEK-KLQCRS  744 (951)
T ss_pred             -ccc------CCCcccCCEEEEEeCCCceeCCCc-ceEEcc
Confidence             000      001111245777777887788887 777765

PyMOL of 2gsx

>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus}	Back alignment and structure

>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens}	Back alignment and structure

>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A	Back alignment and structure

>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens}	Back alignment and structure

>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A	Back alignment and structure

>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens}	Back alignment and structure

>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M*	Back alignment and structure

>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus}	Back alignment and structure

>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A	Back alignment and structure

>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A	Back alignment and structure

>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A	Back alignment and structure

>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens}	Back alignment and structure

>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus}	Back alignment and structure

>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A	Back alignment and structure

>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A	Back alignment and structure

>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus}	Back alignment and structure

>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M*	Back alignment and structure

>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A	Back alignment and structure

>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A	Back alignment and structure

>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A	Back alignment and structure

>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens}	Back alignment and structure

>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens}	Back alignment and structure

>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A	Back alignment and structure

>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens}	Back alignment and structure

>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens}	Back alignment and structure

>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F*	Back alignment and structure

>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A	Back alignment and structure

>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B*	Back alignment and structure

>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens}	Back alignment and structure

>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens}	Back alignment and structure

>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A	Back alignment and structure

>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F*	Back alignment and structure

>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A	Back alignment and structure

>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1	Back alignment and structure

>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A	Back alignment and structure

>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C	Back alignment and structure

>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1	Back alignment and structure

>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A	Back alignment and structure

>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A	Back alignment and structure

>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A	Back alignment and structure

>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C	Back alignment and structure

>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens}	Back alignment and structure

>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A	Back alignment and structure

>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens}	Back alignment and structure

>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens}	Back alignment and structure

>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens}	Back alignment and structure

>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B*	Back alignment and structure

>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus}	Back alignment and structure

>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C	Back alignment and structure

>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C	Back alignment and structure

>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens}	Back alignment and structure

>4ayi_A H factor 1, complement factor H; immune system, antigens; 2.31A {Homo sapiens} PDB: 4aye_A 4ayd_A 4aym_A 2w80_A 2w81_A 2jgw_A 2jgx_A	Back alignment and structure

>4ayi_A H factor 1, complement factor H; immune system, antigens; 2.31A {Homo sapiens} PDB: 4aye_A 4ayd_A 4aym_A 2w80_A 2w81_A 2jgw_A 2jgx_A	Back alignment and structure

>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus}	Back alignment and structure

>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A	Back alignment and structure

>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A	Back alignment and structure

>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1	Back alignment and structure

>2b5i_D Interleukin-2 receptor alpha chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 3nfp_I 3iu3_I 1z92_B 2erj_A*	Back alignment and structure

>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1	Back alignment and structure

>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens}	Back alignment and structure

>1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A	Back alignment and structure

>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2b5i_D Interleukin-2 receptor alpha chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 3nfp_I 3iu3_I 1z92_B 2erj_A*	Back alignment and structure

>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens}	Back alignment and structure

>1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A	Back alignment and structure

>1jma_B Herpesvirus entry mediator; V-type IG molecule and TNFR superfamily, viral protein; HET: NAG; 2.65A {Human herpesvirus 1} SCOP: g.24.1.1 g.24.1.1 PDB: 2aw2_B*	Back alignment and structure

>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens}	Back alignment and structure

>2hey_R Tumor necrosis factor receptor superfamily member; cytokine, receptor-ligan complex, CO-stimulator, TNFSF; 2.00A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 2hev_R	Back alignment and structure

>1jma_B Herpesvirus entry mediator; V-type IG molecule and TNFR superfamily, viral protein; HET: NAG; 2.65A {Human herpesvirus 1} SCOP: g.24.1.1 g.24.1.1 PDB: 2aw2_B*	Back alignment and structure

>1sg1_X Tumor necrosis factor receptor superfamily member 16; nerve growth factor, NGF, neurotrophin, common neurotrophin receptor; 2.40A {Rattus norvegicus} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 g.24.1.1 PDB: 3buk_C* 3ij2_X	Back alignment and structure

>2hey_R Tumor necrosis factor receptor superfamily member; cytokine, receptor-ligan complex, CO-stimulator, TNFSF; 2.00A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 2hev_R	Back alignment and structure

>3alq_R Tumor necrosis factor receptor superfamily member; ligand-receptor complex, cytokine, cytokine-cytokine recepto; 3.00A {Homo sapiens}	Back alignment and structure

>3alq_R Tumor necrosis factor receptor superfamily member; ligand-receptor complex, cytokine, cytokine-cytokine recepto; 3.00A {Homo sapiens}	Back alignment and structure

>1ext_A Tumor necrosis factor receptor; binding protein, cytokine, signalling protein; 1.85A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 1ft4_A* 1ncf_A 1tnr_R	Back alignment and structure

>3me4_A Tumor necrosis factor receptor superfamily member; RANK, rankl, rankl-RANK complex, tnfsf11, tnfrsf11A, TNF SUP signaling protein; 2.01A {Mus musculus} PDB: 3me2_R 3qbq_B 4giq_R* 3nzy_B	Back alignment and structure

>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens}	Back alignment and structure

>3u3p_A Tumor necrosis factor receptor superfamily member; trigger apoptosis, apoptosis; 2.09A {Homo sapiens} PDB: 3u3q_A 3u3s_A 3u3t_A 3u3v_A 3qo4_A	Back alignment and structure

>1sg1_X Tumor necrosis factor receptor superfamily member 16; nerve growth factor, NGF, neurotrophin, common neurotrophin receptor; 2.40A {Rattus norvegicus} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 g.24.1.1 PDB: 3buk_C* 3ij2_X	Back alignment and structure

>3urf_Z Tumor necrosis factor receptor superfamily member; cystein-rich domain, beta-sandwich, cytokine; HET: NAG; 2.70A {Homo sapiens} PDB: 4e4d_R	Back alignment and structure

>2uwi_A CRME protein; receptor, poxvirus TNF receptor, receptor immunomodulator, TNF alpha receptor; 2.0A {Vaccinia virus}	Back alignment and structure

>1du3_A Death receptor 5; trail, DR5, complex; 2.20A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 1d0g_R 2h9g_R 1za3_R 1d4v_A	Back alignment and structure

>3k51_B Decoy receptor 3; DCR3, TL1A, TNF, TNFR, immunity, cytokine, D bond, glycoprotein, membrane, secreted, signal-anchor, transmembrane, apoptosis; 2.45A {Homo sapiens} PDB: 3mi8_D 3mhd_D	Back alignment and structure

>3qd6_R CD40L receptor, tumor necrosis factor receptor superfamily member; immune regulator, cytokine-cytokine receptor compl; HET: NAG; 3.50A {Homo sapiens}	Back alignment and structure

>3me4_A Tumor necrosis factor receptor superfamily member; RANK, rankl, rankl-RANK complex, tnfsf11, tnfrsf11A, TNF SUP signaling protein; 2.01A {Mus musculus} PDB: 3me2_R 3qbq_B 4giq_R* 3nzy_B	Back alignment and structure

>2psm_F Interleukin-15 receptor alpha chain; cytokine, glycoprotein, secreted, alternative splicing, endoplasmic reticulum, golgi apparatus, membrane; 2.19A {Mus musculus} SCOP: g.18.1.1	Back alignment and structure

>1du3_A Death receptor 5; trail, DR5, complex; 2.20A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 1d0g_R 2h9g_R 1za3_R 1d4v_A	Back alignment and structure

>3u3p_A Tumor necrosis factor receptor superfamily member; trigger apoptosis, apoptosis; 2.09A {Homo sapiens} PDB: 3u3q_A 3u3s_A 3u3t_A 3u3v_A 3qo4_A	Back alignment and structure

>3qd6_R CD40L receptor, tumor necrosis factor receptor superfamily member; immune regulator, cytokine-cytokine receptor compl; HET: NAG; 3.50A {Homo sapiens}	Back alignment and structure

>1ext_A Tumor necrosis factor receptor; binding protein, cytokine, signalling protein; 1.85A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 1ft4_A* 1ncf_A 1tnr_R	Back alignment and structure

>3tje_F Tumor necrosis factor receptor superfamily member; agonistic antibody, FAB fragment, antibody-receptor complex, cysteine-rich domain, FAS, immune; HET: EDO; 1.93A {Homo sapiens} PDB: 3thm_F*	Back alignment and structure

>2z3q_B Interleukin-15 receptor alpha chain; protein-protein complex, cytokine/cytokine receptor complex; 1.85A {Homo sapiens} SCOP: g.18.1.1 PDB: 2z3r_B 2ers_A	Back alignment and structure

>2uwi_A CRME protein; receptor, poxvirus TNF receptor, receptor immunomodulator, TNF alpha receptor; 2.0A {Vaccinia virus}	Back alignment and structure

>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1	Back alignment and structure

>3tje_F Tumor necrosis factor receptor superfamily member; agonistic antibody, FAB fragment, antibody-receptor complex, cysteine-rich domain, FAS, immune; HET: EDO; 1.93A {Homo sapiens} PDB: 3thm_F*	Back alignment and structure

>3k51_B Decoy receptor 3; DCR3, TL1A, TNF, TNFR, immunity, cytokine, D bond, glycoprotein, membrane, secreted, signal-anchor, transmembrane, apoptosis; 2.45A {Homo sapiens} PDB: 3mi8_D 3mhd_D	Back alignment and structure

>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A*	Back alignment and structure

>3urf_Z Tumor necrosis factor receptor superfamily member; cystein-rich domain, beta-sandwich, cytokine; HET: NAG; 2.70A {Homo sapiens} PDB: 4e4d_R	Back alignment and structure

>4fhq_A Tumor necrosis factor receptor superfamily member; cysteine rich domain, TNF receptor, structural genomics, PSI protein structure initiative; 2.25A {Homo sapiens} PDB: 2aw2_B*	Back alignment and structure

>4fhq_A Tumor necrosis factor receptor superfamily member; cysteine rich domain, TNF receptor, structural genomics, PSI protein structure initiative; 2.25A {Homo sapiens} PDB: 2aw2_B*	Back alignment and structure

>1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase-growth F complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1	Back alignment and structure

>2psm_F Interleukin-15 receptor alpha chain; cytokine, glycoprotein, secreted, alternative splicing, endoplasmic reticulum, golgi apparatus, membrane; 2.19A {Mus musculus} SCOP: g.18.1.1	Back alignment and structure

>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa}	Back alignment and structure

>1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase-growth F complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1	Back alignment and structure

>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A	Back alignment and structure

>2z3q_B Interleukin-15 receptor alpha chain; protein-protein complex, cytokine/cytokine receptor complex; 1.85A {Homo sapiens} SCOP: g.18.1.1 PDB: 2z3r_B 2ers_A	Back alignment and structure

>1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A*	Back alignment and structure

>1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A*	Back alignment and structure

>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa}	Back alignment and structure

>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A*	Back alignment and structure

>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1	Back alignment and structure

>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A	Back alignment and structure

>3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP nucleotide-binding, tyrosine-protein kinase; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} PDB: 3ltf_A* 3ltg_A	Back alignment and structure

>1n8y_C Protooncoprotein; tyrosin kinase receptor, cell surface receptor, transferase; HET: NAG; 2.40A {Rattus norvegicus} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 1n8z_C* 3be1_A* 1s78_A* 3mzw_A* 3n85_A* 2a91_A* 3h3b_A	Back alignment and structure

>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A	Back alignment and structure

>3hny_M Coagulation factor VIII; blood clotting, acute phase, blood coagulation, calcium, DIS mutation, disulfide bond, glycoprotein, hemophilia; 1.07A {Homo sapiens} SCOP: b.18.1.2 PDB: 3hnb_M 3hob_M 1d7p_M 1iqd_C 1cfg_A 1fac_A	Back alignment and structure

>2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A*	Back alignment and structure

>2kpn_A Bacillolysin; solution structure, BIG_3 domain, PF07523, PSI BIG-open NESG, cell WALL, hydrolase, peptidoglycan-anchor; NMR {Bacillus cereus atcc 14579}	Back alignment and structure

>4deq_A Neuropilin-1, vascular endothelial growth factor; coagulation factor domain, heparin binding domain, angiogene protein binding-cytokine complex; 2.65A {Homo sapiens} PDB: 1kmx_A 1vgh_A 2vgh_A	Back alignment and structure

>2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens}	Back alignment and structure

>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A*	Back alignment and structure

>1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A*	Back alignment and structure

>2kpn_A Bacillolysin; solution structure, BIG_3 domain, PF07523, PSI BIG-open NESG, cell WALL, hydrolase, peptidoglycan-anchor; NMR {Bacillus cereus atcc 14579}	Back alignment and structure

>3bn6_A Lactadherin; anticoagulation, anti-coagulation, anticoagulant, anti- coagulant, membrane binding, phosphatidyl-serine binding; 1.67A {Bos taurus} PDB: 2pqs_A	Back alignment and structure

>2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A*	Back alignment and structure

>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A*	Back alignment and structure

>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B*	Back alignment and structure

>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A*	Back alignment and structure

>1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		642
d1czsa_		160	b.18.1.2 (A:) C2 domain of factor V {Human (Homo s	5e-12
d1d7pm_		159	b.18.1.2 (M:) C2 domain of factor VIII {Human (Hom	3e-09
d1sddb3		162	b.18.1.2 (B:1863-2024) C2 domain of factor V {Cow	4e-09
d2qqia2		155	b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Hu	1e-07
d2qqia1		156	b.18.1.2 (A:431-586) C2 domain of factor VIII {Hum	3e-07
d2ok5a2		62	g.18.1.1 (A:138-199) Complement factor B {Human (H	2e-04
d2ok5a2		62	g.18.1.1 (A:138-199) Complement factor B {Human (H	0.002
d1hfia_		62	g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum	5e-04
d1exta1		59	g.24.1.1 (A:13-71) Tumor necrosis factor (TNF) rec	5e-04
d1exta1		59	g.24.1.1 (A:13-71) Tumor necrosis factor (TNF) rec	0.002
d1jmab1		56	g.24.1.1 (B:4-59) Cellular receptor HveA {Human (H	0.001
d1quba4		60	g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (	0.002
d1quba2		58	g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H	0.002
d2heyr3		54	g.24.1.1 (R:29-82) Tumor necrosis factor receptor	0.003

>d1czsa_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]} Length = 160	Back information, alignment and structure


class: All beta proteins
fold: Galactose-binding domain-like
superfamily: Galactose-binding domain-like
family: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain)
domain: C2 domain of factor V
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 62.2 bits (150), Expect = 5e-12
 Identities = 27/164 (16%), Positives = 54/164 (32%), Gaps = 21/164 (12%)

Query: 319 PLGLASGRIPDSSINATSE---------SPYLVRVNACSVPLIPGPRVQELLAEKNVRLF 369
           PLG+ +G+I +  I A+S           P+  R+NA         +         + L 
Sbjct: 5   PLGMENGKIENKQITASSFKKSWWGDYWEPFRARLNAQGRVNAWQAKANNNKQWLEIDLL 64

Query: 370 NVLRTLANMEVYVYRLAILVKGVVTNDIVGRPTEIRFFYKQAESENFVVYFPNFNLTMRD 429
            + +            AI+ +G  +             Y +   E       +  +    
Sbjct: 65  KIKKI----------TAIITQGCKSLSSEMYVKSYTIHYSEQGVEWKPYRLKSSMVDKIF 114

Query: 430 PGNYGELAMIT--LPKFVQARFVILGIVSYMDNACLKFELMGCE 471
            GN      +       + +RF+ +   ++  +  L+ EL GC+
Sbjct: 115 EGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSITLRLELFGCD 158

PyMOL of d1czsa_

>d1d7pm_ b.18.1.2 (M:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Length = 159	Back information, alignment and structure

>d1sddb3 b.18.1.2 (B:1863-2024) C2 domain of factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 162	Back information, alignment and structure

>d2qqia2 b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 155	Back information, alignment and structure

>d2qqia1 b.18.1.2 (A:431-586) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Length = 156	Back information, alignment and structure

>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62	Back information, alignment and structure

>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62	Back information, alignment and structure

>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62	Back information, alignment and structure

>d1exta1 g.24.1.1 (A:13-71) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 59	Back information, alignment and structure

>d1exta1 g.24.1.1 (A:13-71) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 59	Back information, alignment and structure

>d1jmab1 g.24.1.1 (B:4-59) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60	Back information, alignment and structure

>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58	Back information, alignment and structure

>d2heyr3 g.24.1.1 (R:29-82) Tumor necrosis factor receptor superfamily member 4, OX40L receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 54	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		642
d1quba2		58	beta2-glycoprotein I {Human (Homo sapiens) [TaxId:	99.19
d1ppqa_		68	Complement receptor 1, cr1 {Human (Homo sapiens) [	99.19
d2ok5a3		61	Complement factor B {Human (Homo sapiens) [TaxId:	99.15
d2ok5a2		62	Complement factor B {Human (Homo sapiens) [TaxId:	99.15
d2o39c2		64	CD46 (membrane cofactor protein, MCP) {Human (Homo	99.13
d1gpza2		68	Complement C1R protease domains {Human (Homo sapie	99.12
d1quba4		60	beta2-glycoprotein I {Human (Homo sapiens) [TaxId:	99.12
d1ly2a1		67	Complement receptor 2, cr2 {Human (Homo sapiens) [	99.11
d1ly2a2		63	Complement receptor 2, cr2 {Human (Homo sapiens) [	99.1
d1g40a3		58	Complement control protein {Vaccinia virus [TaxId:	99.1
d1hfia_		62	Factor H, 15th and 16th modules {Human (Homo sapie	99.09
d1md8a2		76	Complement C1R protease domains {Human (Homo sapie	99.09
d1quba3		63	beta2-glycoprotein I {Human (Homo sapiens) [TaxId:	99.08
d1g40a2		62	Complement control protein {Vaccinia virus [TaxId:	99.08
d1elva2		68	Complement C1S protease domain {Human (Homo sapien	99.06
d1quba1		62	beta2-glycoprotein I {Human (Homo sapiens) [TaxId:	99.05
d1hcca_		59	Factor H, 15th and 16th modules {Human (Homo sapie	99.05
d1h03p2		63	Complement decay-accelerating factor (Daf, CD55) {	99.05
d1ok3a1		64	Complement decay-accelerating factor (Daf, CD55) {	99.04
d2z3qb1		78	Interleukin-15 receptor subunit alpha {Human (Homo	99.04
d1h03p1		62	Complement decay-accelerating factor (Daf, CD55) {	99.03
d1q3xa2		75	Mannan-binding lectin serine protease 2 (MASP-2) d	99.03
d1g40a4		59	Complement control protein {Vaccinia virus [TaxId:	99.01
d1ok3a2		64	Complement decay-accelerating factor (Daf, CD55) {	98.99
d1gkga2		70	Complement receptor 1, cr1 {Human (Homo sapiens) [	98.92
d1gkna1		64	Complement receptor 1, cr1 {Human (Homo sapiens) [	98.9
d1quba2		58	beta2-glycoprotein I {Human (Homo sapiens) [TaxId:	98.88
d1g40a2		62	Complement control protein {Vaccinia virus [TaxId:	98.84
d1gpza2		68	Complement C1R protease domains {Human (Homo sapie	98.82
d1zjka2		53	Complement C1R protease domains {Human (Homo sapie	98.82
d1srza_		68	GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId:	98.79
d2o39c1		62	CD46 (membrane cofactor protein, MCP) {Human (Homo	98.79
d2o39c2		64	CD46 (membrane cofactor protein, MCP) {Human (Homo	98.79
d2ok5a3		61	Complement factor B {Human (Homo sapiens) [TaxId:	98.76
d1gkga2		70	Complement receptor 1, cr1 {Human (Homo sapiens) [	98.73
d1quba4		60	beta2-glycoprotein I {Human (Homo sapiens) [TaxId:	98.68
d2ok5a2		62	Complement factor B {Human (Homo sapiens) [TaxId:	98.68
d1ly2a1		67	Complement receptor 2, cr2 {Human (Homo sapiens) [	98.66
d1ppqa_		68	Complement receptor 1, cr1 {Human (Homo sapiens) [	98.65
d1g40a3		58	Complement control protein {Vaccinia virus [TaxId:	98.65
d1md8a2		76	Complement C1R protease domains {Human (Homo sapie	98.65
d1h03p2		63	Complement decay-accelerating factor (Daf, CD55) {	98.57
d1quba3		63	beta2-glycoprotein I {Human (Homo sapiens) [TaxId:	98.55
d1quba1		62	beta2-glycoprotein I {Human (Homo sapiens) [TaxId:	98.54
d1g40a4		59	Complement control protein {Vaccinia virus [TaxId:	98.54
d1hfia_		62	Factor H, 15th and 16th modules {Human (Homo sapie	98.53
d1h03p1		62	Complement decay-accelerating factor (Daf, CD55) {	98.52
d1ly2a2		63	Complement receptor 2, cr2 {Human (Homo sapiens) [	98.51
d1q3xa2		75	Mannan-binding lectin serine protease 2 (MASP-2) d	98.51
d2z3qb1		78	Interleukin-15 receptor subunit alpha {Human (Homo	98.5
d1elva2		68	Complement C1S protease domain {Human (Homo sapien	98.5
d1srza_		68	GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId:	98.47
d1hcca_		59	Factor H, 15th and 16th modules {Human (Homo sapie	98.47
d1ok3a2		64	Complement decay-accelerating factor (Daf, CD55) {	98.45
d1ok3a1		64	Complement decay-accelerating factor (Daf, CD55) {	98.39
d1gkna1		64	Complement receptor 1, cr1 {Human (Homo sapiens) [	98.38
d1zjka2		53	Complement C1R protease domains {Human (Homo sapie	98.32
d2o39c1		62	CD46 (membrane cofactor protein, MCP) {Human (Homo	98.05
d1jmab1		56	Cellular receptor HveA {Human (Homo sapiens) [TaxI	97.18
d1exta1		59	Tumor necrosis factor (TNF) receptor {Human (Homo	97.09
d1exta1		59	Tumor necrosis factor (TNF) receptor {Human (Homo	97.05
d1jmab1		56	Cellular receptor HveA {Human (Homo sapiens) [TaxI	96.93
d2heyr3		54	Tumor necrosis factor receptor superfamily member	96.73
d2ok5a4		68	Complement factor B {Human (Homo sapiens) [TaxId:	96.5
d1sddb3		162	C2 domain of factor V {Cow (Bos taurus) [TaxId: 99	95.59
d2heyr3		54	Tumor necrosis factor receptor superfamily member	95.54
d2ok5a4		68	Complement factor B {Human (Homo sapiens) [TaxId:	95.29
d2b5id2		63	Interleukin-2 receptor alpha chain {Human (Homo sa	93.99
d2qqia2		155	B1 domain of neuropilin-1 {Human (Homo sapiens) [T	93.95
d1czsa_		160	C2 domain of factor V {Human (Homo sapiens) [TaxId	93.14
d1moxa3		149	EGF receptor Cys-rich domains {Human (Homo sapiens	92.73
d1moxa3		149	EGF receptor Cys-rich domains {Human (Homo sapiens	91.44
d1sg1x3		42	Low affinity neurotrophin receptor p75NTR {Rat (Ra	91.43
d2dtge6		155	Insulin receptor {Human (Homo sapiens) [TaxId: 960	90.75
d1d7pm_		159	C2 domain of factor VIII {Human (Homo sapiens) [Ta	90.11
d1sg1x3		42	Low affinity neurotrophin receptor p75NTR {Rat (Ra	90.04
d1igra3		150	Type 1 insulin-like growth factor receptor Cys-ric	88.99
d1n8yc4		120	Protooncoprotein Her2 extracellular domain {Rat (R	87.53
d2b5id2		63	Interleukin-2 receptor alpha chain {Human (Homo sa	84.17
d1igra3		150	Type 1 insulin-like growth factor receptor Cys-ric	83.73
d1g40a1		64	Complement control protein {Vaccinia virus [TaxId:	81.84
d1kloa2		56	Laminin gamma1 chain {Mouse (Mus musculus) [TaxId:	80.67
d1m6ba3		145	Receptor protein-tyrosine kinase Erbb-3 Cys-rich d	80.11

>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: Complement control module/SCR domain
superfamily: Complement control module/SCR domain
family: Complement control module/SCR domain
domain: beta2-glycoprotein I
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.19  E-value=1.1e-11  Score=92.80  Aligned_cols=57  Identities=25%  Similarity=0.483  Sum_probs=49.9

Q ss_pred             cCCCCCCCCCceeeecceeeeeeCCcCCCCccccccCcEEEEEcccCccccCCccCCCceEEeccCCeecCCCCceec
Q psy833          180 VCSDPGRPVDGYQVATSYEQVRYDDEQYGNFLDTRYQSSFFFGCQDTFKLAGQTDKNDNVVRCQANGIWDFGDLRCEG  257 (642)
Q Consensus       180 ~C~~p~~~~~g~~~~~~~~~C~~~~~~~g~~~~~~~gs~~~~~C~~Gy~l~G~~~~~~~~~~C~~~G~Ws~~~P~C~~  257 (642)
                      .|+.|..+.||.+..                ..+.||++|+|+|++||.|.|+..     ++|+++|+|++..|.|++
T Consensus         2 ~C~~p~~~~nG~~~~----------------~~~~~g~~v~y~C~~Gy~l~G~~~-----~~C~~~g~Ws~~~P~C~P   58 (58)
T d1quba2           2 VCPFAGILENGAVRY----------------TTFEYPNTISFSCNTGFYLNGADS-----AKCTEEGKWSPELPVCAP   58 (58)
T ss_dssp             BCCCCCCCTTEEEEC----------------SCSBTTCEEEEEECTTEEEESCSE-----EEECTTSCEESCCCEEEE
T ss_pred             CCcCCCCCCCcEEEC----------------CCcccCCEEEEEcCCCCEEcCCCC-----eEECCCCeECCCCCEeCC
Confidence            599999999998322                347899999999999999999975     899999999999999974

PyMOL of d1quba2

>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]}	Back information, alignment and structure

>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]}	Back information, alignment and structure

>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]}	Back information, alignment and structure

>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]}	Back information, alignment and structure

>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]}	Back information, alignment and structure

>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]}	Back information, alignment and structure

>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmab1 g.24.1.1 (B:4-59) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1exta1 g.24.1.1 (A:13-71) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1exta1 g.24.1.1 (A:13-71) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmab1 g.24.1.1 (B:4-59) Cellular receptor HveA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2heyr3 g.24.1.1 (R:29-82) Tumor necrosis factor receptor superfamily member 4, OX40L receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sddb3 b.18.1.2 (B:1863-2024) C2 domain of factor V {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2heyr3 g.24.1.1 (R:29-82) Tumor necrosis factor receptor superfamily member 4, OX40L receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b5id2 g.18.1.1 (D:103-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2qqia2 b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1czsa_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sg1x3 g.24.1.1 (X:96-137) Low affinity neurotrophin receptor p75NTR {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1d7pm_ b.18.1.2 (M:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sg1x3 g.24.1.1 (X:96-137) Low affinity neurotrophin receptor p75NTR {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n8yc4 g.3.9.1 (C:489-608) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2b5id2 g.18.1.1 (D:103-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g40a1 g.18.1.1 (A:1-64) Complement control protein {Vaccinia virus [TaxId: 10245]}	Back information, alignment and structure

>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure