Psyllid ID: psy8351

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFHEEKDVNGIKFSAYNAGHVLGAAMFLIEIAGVKIARYLFLWYQVNVNQNNQEFRIGT
ccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccEEEEccEEEEEEEcccHHccEEEEEEEccEEEEEEEEEEEEEccccccccccccc
cccHHHHHHHHHHHHHEEEEccccccccccHHHHHHHHccEEEEEccEEEEEccEEEEEccccHHHHHHHHHHHHHHHHHHHHHEEEEEEEccccccEEEEcc
MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETinfheekdvngikfsaynAGHVLGAAMFLIEIAGVKIARYLFLWYQVNVnqnnqefrigt
MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFheekdvngIKFSAYNAGHVLGAAMFLIEIAGVKIARYLFLWYQVNvnqnnqefrigt
MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFHEEKDVNGIKFSAYNAGHVLGAAMFLIEIAGVKIARYLFLWYQVNVNQNNQEFRIGT
*****KAIYRWLLSDYIKVSNISTEQMLYTESDL***MDKIETINFHEEKDVNGIKFSAYNAGHVLGAAMFLIEIAGVKIARYLFLWYQVNVN**********
MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFHEEKDVNGIKFSAYNAGHVLGAAMFLIEIAGVKIARYLFLWYQVNVNQNN*******
MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFHEEKDVNGIKFSAYNAGHVLGAAMFLIEIAGVKIARYLFLWYQVNVNQNNQEFRIGT
*THATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFHEEKDVNGIKFSAYNAGHVLGAAMFLIEIAGVKIARYLFLWYQVNVNQNNQEFRIGT
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFHEEKDVNGIKFSAYNAGHVLGAAMFLIEIAGVKIARYLFLWYQVNVNQNNQEFRIGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
FB|FBgn0261065 684 Cpsf73 "Cleavage and polyadeny 0.776 0.116 0.837 5.1e-32
UNIPROTKB|C9JZH6136 CPSF3 "Cleavage and polyadenyl 0.766 0.580 0.835 2.6e-31
UNIPROTKB|G5E9W3 647 CPSF3 "Cleavage and polyadenyl 0.776 0.123 0.825 8.5e-31
UNIPROTKB|P79101 684 CPSF3 "Cleavage and polyadenyl 0.776 0.116 0.825 1e-30
UNIPROTKB|Q9UKF6 684 CPSF3 "Cleavage and polyadenyl 0.776 0.116 0.825 1e-30
MGI|MGI:1859328 684 Cpsf3 "cleavage and polyadenyl 0.776 0.116 0.825 1e-30
UNIPROTKB|F1NKW5 685 CPSF3 "Uncharacterized protein 0.776 0.116 0.825 1e-30
UNIPROTKB|G3V6W7 685 Cpsf3 "Protein Cpsf3" [Rattus 0.776 0.116 0.825 1e-30
ZFIN|ZDB-GENE-030131-3275 690 cpsf3 "cleavage and polyadenyl 0.776 0.115 0.825 1.1e-30
UNIPROTKB|E2R7R2 717 CPSF3 "Uncharacterized protein 0.776 0.111 0.825 1.2e-30
FB|FBgn0261065 Cpsf73 "Cleavage and polyadenylation specificity factor 73" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 358 (131.1 bits), Expect = 5.1e-32, P = 5.1e-32
 Identities = 67/80 (83%), Positives = 76/80 (95%)

Query:     1 MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFHEEKDVNGIKFSAY 60
             MTHATKAIYRW+LSDYIK+SNISTEQMLYTE+DLE SM+KIETINFHEE+DV G++F AY
Sbjct:   101 MTHATKAIYRWMLSDYIKISNISTEQMLYTEADLEASMEKIETINFHEERDVMGVRFCAY 160

Query:    61 NAGHVLGAAMFLIEIAGVKI 80
              AGHVLGAAMF+IEIAG+KI
Sbjct:   161 IAGHVLGAAMFMIEIAGIKI 180
GO:0006379 "mRNA cleavage" evidence=ISS
GO:0005847 "mRNA cleavage and polyadenylation specificity factor complex" evidence=ISS;NAS
GO:0006378 "mRNA polyadenylation" evidence=ISS;IMP
GO:0016787 "hydrolase activity" evidence=IEA
GO:0006398 "histone mRNA 3'-end processing" evidence=IMP
GO:0003677 "DNA binding" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|C9JZH6 CPSF3 "Cleavage and polyadenylation-specificity factor subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G5E9W3 CPSF3 "Cleavage and polyadenylation-specificity factor subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P79101 CPSF3 "Cleavage and polyadenylation specificity factor subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UKF6 CPSF3 "Cleavage and polyadenylation specificity factor subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1859328 Cpsf3 "cleavage and polyadenylation specificity factor 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKW5 CPSF3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6W7 Cpsf3 "Protein Cpsf3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3275 cpsf3 "cleavage and polyadenylation specific factor 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R7R2 CPSF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
COG1236 427 COG1236, YSH1, Predicted exonuclease of the beta-l 4e-23
TIGR03675 630 TIGR03675, arCOG00543, arCOG00543 universal archae 1e-09
COG1782 637 COG1782, COG1782, Predicted metal-dependent RNase, 1e-08
TIGR04122 326 TIGR04122, Xnuc_lig_assoc, putative exonuclease, D 4e-06
>gnl|CDD|224157 COG1236, YSH1, Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score = 90.9 bits (226), Expect = 4e-23
 Identities = 29/80 (36%), Positives = 48/80 (60%), Gaps = 1/80 (1%)

Query: 1   MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFHEEKDVNGIKFSAY 60
            T  T A+ + LL D +K++    +   Y+E D+E+  D I  + + E  +V G+K + Y
Sbjct: 80  ATPPTAALLKVLLGDSLKLAEGPDKP-PYSEEDVERVPDLIRPLPYGEPVEVGGVKVTFY 138

Query: 61  NAGHVLGAAMFLIEIAGVKI 80
           NAGH+LG+A  L+E+ G +I
Sbjct: 139 NAGHILGSAAILLEVDGGRI 158

Length = 427
>gnl|CDD|188365 TIGR03675, arCOG00543, arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>gnl|CDD|224696 COG1782, COG1782, Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|200373 TIGR04122, Xnuc_lig_assoc, putative exonuclease, DNA ligase-associated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 103
COG1782 637 Predicted metal-dependent RNase, consists of a met 99.92
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase f 99.91
KOG1136|consensus 501 99.87
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 99.83
KOG1137|consensus 668 99.8
KOG1135|consensus 764 99.56
KOG1138|consensus 653 98.99
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 98.47
KOG1361|consensus 481 98.19
PF12706194 Lactamase_B_2: Beta-lactamase superfamily domain; 97.79
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta 97.65
TIGR03307238 PhnP phosphonate metabolism protein PhnP. This fam 97.55
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 97.34
PRK11244250 phnP carbon-phosphorus lyase complex accessory pro 97.34
PRK00685228 metal-dependent hydrolase; Provisional 97.16
PRK11921 394 metallo-beta-lactamase/flavodoxin domain-containin 96.29
TIGR03413 248 GSH_gloB hydroxyacylglutathione hydrolase. Members 96.12
PRK11709 355 putative L-ascorbate 6-phosphate lactonase; Provis 96.07
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 95.95
COG0491252 GloB Zn-dependent hydrolases, including glyoxylase 95.75
PLN02469 258 hydroxyacylglutathione hydrolase 95.18
PLN02398 329 hydroxyacylglutathione hydrolase 94.59
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 94.44
PLN02962251 hydroxyacylglutathione hydrolase 94.42
PRK10241 251 hydroxyacylglutathione hydrolase; Provisional 94.02
PF00753194 Lactamase_B: Metallo-beta-lactamase superfamily; I 93.46
KOG0813|consensus 265 92.92
TIGR02651 299 RNase_Z ribonuclease Z. Processing of the 3-prime 92.75
PRK04286 298 hypothetical protein; Provisional 92.53
PRK02113252 putative hydrolase; Provisional 91.96
TIGR02649 303 true_RNase_BN ribonuclease BN. Members of this pro 90.32
TIGR02108302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 89.45
PRK05184302 pyrroloquinoline quinone biosynthesis protein PqqB 87.78
PRK11539 755 ComEC family competence protein; Provisional 85.25
TIGR00361662 ComEC_Rec2 DNA internalization-related competence 85.09
KOG3772|consensus325 82.64
COG2220258 Predicted Zn-dependent hydrolases of the beta-lact 81.84
KOG0814|consensus237 80.61
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information 
Probab=99.92  E-value=2.3e-25  Score=175.26  Aligned_cols=96  Identities=27%  Similarity=0.429  Sum_probs=91.5

Q ss_pred             CCHHHHHHHHHHHHHHHhhhhcCCCCCCCCHHHHHHHHhhcccccCCcEEEe-CCEEEEEEeCCccccceEEEEEECC--
Q psy8351           1 MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFHEEKDV-NGIKFSAYNAGHVLGAAMFLIEIAG--   77 (103)
Q Consensus         1 ~T~~T~~l~~~lL~D~~ki~~~~~~~p~y~~~dv~~~~~~~~~v~y~~~~~i-~~~~v~~~~AGHIlGsa~~~i~~~~--   77 (103)
                      ||+||+||+-+|+.|++++.++++..|||+++||++++++.++++|++..+| +++++|||||||||||||.++-+++  
T Consensus       265 ~T~PTRDlm~LLq~Dyi~va~keg~~ppY~~k~v~~~lkhtItldYgevTDIaPDirLTf~NAGHILGSA~~HlHIGdGl  344 (637)
T COG1782         265 CTPPTRDLMVLLQLDYIEVAEKEGGEPPYESKDVRKVLKHTITLDYGEVTDIAPDIRLTFYNAGHILGSAMAHLHIGDGL  344 (637)
T ss_pred             eCCCcHHHHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHheeeeeccCcccccCCccEEEEecccchhcceeeEEEecCCc
Confidence            8999999999999999999999999999999999999999999999999999 6999999999999999999999965  


Q ss_pred             eEEEeeeeeEEEecCCCCCccceeC
Q psy8351          78 VKIARYLFLWYQVNVNQNNQEFRIG  102 (103)
Q Consensus        78 ~~i~~~~~~~ysgD~~~~~~~~~~g  102 (103)
                      .++      +|||||++..+++.++
T Consensus       345 yNi------~yTGDfk~~~trLl~~  363 (637)
T COG1782         345 YNI------VYTGDFKFEKTRLLEP  363 (637)
T ss_pred             eeE------EEecccccceeeecCh
Confidence            477      9999999999998765

>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1136|consensus Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>KOG1137|consensus Back     alignment and domain information
>KOG1135|consensus Back     alignment and domain information
>KOG1138|consensus Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>KOG1361|consensus Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>KOG0813|consensus Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>KOG3772|consensus Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>KOG0814|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 1e-35
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 9e-33
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 2e-28
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 1e-27
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 1e-26
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 3e-22
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Length = 459 Back     alignment and structure
 Score =  125 bits (315), Expect = 1e-35
 Identities = 66/80 (82%), Positives = 74/80 (92%)

Query: 1   MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFHEEKDVNGIKFSAY 60
           MTHATKAIYRWLLSDY+KVSNIS + MLYTE+DLE+SMDKIETINFHE K+V GIKF  Y
Sbjct: 95  MTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEESMDKIETINFHEVKEVAGIKFWCY 154

Query: 61  NAGHVLGAAMFLIEIAGVKI 80
           +AGHVLGAAMF+IEIAGVK+
Sbjct: 155 HAGHVLGAAMFMIEIAGVKL 174
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Length = 431 Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Length = 651 Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 636 Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Length = 640 Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Length = 717 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 99.69
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 99.63
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 99.59
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 99.55
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 99.53
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 99.53
3zdk_A 336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 99.01
4b87_A 367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 98.94
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 98.79
2az4_A 429 Hypothetical protein EF2904; structural genomics, 98.73
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 98.72
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, 97.91
3g1p_A258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 97.88
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 97.76
3m8t_A294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 97.66
2wyl_A 360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 97.65
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 97.52
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 97.51
3kl7_A235 Putative metal-dependent hydrolase; structural gen 97.49
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 97.34
3bv6_A 379 Metal-dependent hydrolase; metallo protein, beta-l 97.3
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 97.17
4efz_A 298 Metallo-beta-lactamase family protein; structural 97.16
3esh_A280 Protein similar to metal-dependent hydrolase; stru 97.07
1ztc_A221 Hypothetical protein TM0894; structural genomics, 97.07
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 97.03
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 96.97
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 96.95
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 96.94
2gcu_A245 Putative hydroxyacylglutathione hydrolase 3; ethyl 96.93
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 96.92
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetall 96.87
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 96.81
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 96.81
2zo4_A 317 Metallo-beta-lactamase family protein; hydrolase; 96.77
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 96.77
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 96.56
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 96.53
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A { 96.52
3aj3_A274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 96.48
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 96.47
2qed_A 258 Hydroxyacylglutathione hydrolase; metallo-B- super 96.46
3adr_A261 Putative uncharacterized protein ST1585; quorum se 96.45
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 96.44
3r2u_A 466 Metallo-beta-lactamase family protein; structural 96.43
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 96.35
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 96.33
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 96.31
1vjn_A220 Zn-dependent hydrolase of metallo-beta-lactamase s 96.25
3rpc_A264 Possible metal-dependent hydrolase; structural gen 96.22
4hl2_A243 Beta-lactamase NDM-1; structural genomics, PSI-bio 96.17
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 96.06
2y8b_A265 Metallo-B-lactamase; hydrolase, cephalosporins, an 95.95
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural 95.83
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, a 95.62
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein 95.4
4ax1_B303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 95.22
3jxp_A 321 Coenzyme PQQ synthesis protein B; alpha-beta prote 95.1
2p97_A201 Hypothetical protein; putative metal-dependent hyd 94.93
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrol 94.55
4dik_A 410 Flavoprotein; TM0755, electron transport, DI-iron 94.25
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 94.04
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 93.57
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, 91.41
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 91.37
3q6v_A233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 90.01
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 88.52
4eyb_A270 Beta-lactamase NDM-1; metallo beta lactamase, anti 84.21
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 82.23
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
Probab=99.69  E-value=1.5e-16  Score=122.55  Aligned_cols=90  Identities=19%  Similarity=0.350  Sum_probs=84.4

Q ss_pred             CCHHHHHHHHHHHHHHHhhhhcCCCCCCCCHHHHHHHHhhcccccCCcEEEeCCEEEEEEeCCccccceEEEEEECCeEE
Q psy8351           1 MTHATKAIYRWLLSDYIKVSNISTEQMLYTESDLEKSMDKIETINFHEEKDVNGIKFSAYNAGHVLGAAMFLIEIAGVKI   80 (103)
Q Consensus         1 ~T~~T~~l~~~lL~D~~ki~~~~~~~p~y~~~dv~~~~~~~~~v~y~~~~~i~~~~v~~~~AGHIlGsa~~~i~~~~~~i   80 (103)
                      ||++|+++++.++.|+.+++..    |+|+.+|+++++.++++++|+++++++++++++++|||++||+++.|+.++.++
T Consensus        82 ~t~~t~~l~~~~l~d~~~~~~~----~~y~~~~~~~~~~~~~~l~~~~~~~l~g~~v~~~~agH~~Gs~~~~i~~~~~~i  157 (431)
T 3iek_A           82 ATRATVLLMEIVLEDALKVMDE----PFFGPEDVEEALGHLRPLEYGEWLRLGALSLAFGQAGHLPGSAFVVAQGEGRTL  157 (431)
T ss_dssp             ECHHHHHHHHHHHHHHHHHCSS----CSSCHHHHHHHHHTEEECCTTCCEEETTEEEEEEECCSSTTCEEEEEEETTEEE
T ss_pred             EcHHHHHHHHHHHHHHHhhccc----CCCCHHHHHHHHhccEEcCCCCeEEeCCEEEEEEeCCCCcCceEEEEEECCEEE
Confidence            6899999999999999988752    889999999999999999999999999999999999999999999999999999


Q ss_pred             EeeeeeEEEecCCCCCccce
Q psy8351          81 ARYLFLWYQVNVNQNNQEFR  100 (103)
Q Consensus        81 ~~~~~~~ysgD~~~~~~~~~  100 (103)
                            +||||++..+++++
T Consensus       158 ------lfsGD~~~~~~~~l  171 (431)
T 3iek_A          158 ------VYSGDLGNREKDVL  171 (431)
T ss_dssp             ------EECCCCCCTTSSSS
T ss_pred             ------EEeCCCCCCCCccc
Confidence                  99999998887765
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 103
d2i7xa1 514 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two 1e-14
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 514 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: beta-CASP RNA-metabolising hydrolases
domain: Cleavage factor two protein 2, CFT2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 65.6 bits (159), Expect = 1e-14
 Identities = 18/86 (20%), Positives = 33/86 (38%), Gaps = 6/86 (6%)

Query: 1   MTHATKAIYRWLLSDYIKVSNI--STEQMLYTESDLEKSMDKIETINFHEEKDV----NG 54
            T     + R    D    + +    +       D+E S D I  + + +  D+    +G
Sbjct: 89  ATLPVINLGRVSTIDSYASAGVIGPYDTNKLDLEDIEISFDHIVPLKYSQLVDLRSRYDG 148

Query: 55  IKFSAYNAGHVLGAAMFLIEIAGVKI 80
           +   AYNAG   G +++ I     K+
Sbjct: 149 LTLLAYNAGVCPGGSIWCISTYSEKL 174

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
d2i7xa1 514 Cleavage factor two protein 2, CFT2 {Baker's yeast 99.87
d2i7ta1 451 Cleavage and polyadenylation specificity factor su 99.63
d2dkfa1 431 Putative RNA-degradation protein TTHA0252 {Thermus 99.63
d2az4a1183 Hypothetical protein EF2904 {Enterococcus faecalis 98.98
d1p9ea_294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 97.34
d1zkpa1244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 97.2
d1k07a_262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 96.36
d1mqoa_221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 95.77
d1qh5a_ 260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 95.67
d1vjna_209 Hypothetical protein TM0207 {Thermotoga maritima [ 95.21
d1xm8a_ 254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 95.13
d2q0ia1 298 Quinolone signal response protein PqsE {Pseudomona 95.02
d2qeda1 251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 94.83
d1e5da2249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 94.53
d1ztca1207 Hypothetical protein TM0894 {Thermotoga maritima [ 93.82
d1ko3a_230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 93.7
d1x8ha_228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 93.33
d1ycga2249 Nitric oxide reductase N-terminal domain {Moorella 93.32
d2aioa1266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 92.02
d2gmna1264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 91.16
d1wraa1305 Teichoic acid phosphorylcholine esterase Pce (LytD 86.58
d1znba_230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 86.54
d1m2xa_219 Zn metallo-beta-lactamase {Chryseobacterium mening 84.96
d2cfua2 505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 83.63
d1jjta_220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 82.51
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 80.9
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: beta-CASP RNA-metabolising hydrolases
domain: Cleavage factor two protein 2, CFT2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.87  E-value=1.7e-22  Score=156.85  Aligned_cols=96  Identities=21%  Similarity=0.267  Sum_probs=88.9

Q ss_pred             CCHHHHHHHHHHHHHHHhhhhcCC--CCCCCCHHHHHHHHhhcccccCCcEEEeC----CEEEEEEeCCccccceEEEEE
Q psy8351           1 MTHATKAIYRWLLSDYIKVSNIST--EQMLYTESDLEKSMDKIETINFHEEKDVN----GIKFSAYNAGHVLGAAMFLIE   74 (103)
Q Consensus         1 ~T~~T~~l~~~lL~D~~ki~~~~~--~~p~y~~~dv~~~~~~~~~v~y~~~~~i~----~~~v~~~~AGHIlGsa~~~i~   74 (103)
                      ||+||++|++++|.|+++.++...  ..|+|+.+|++++++++.+++|+|+++++    ++++++++||||||||+|.|+
T Consensus        89 ~T~~T~~l~~~~l~d~~~~~~~~~~~~~~~~~~~dv~~~~~~~~~~~y~e~~~i~~~~~~~~~~~~~aGHilGsa~~~I~  168 (514)
T d2i7xa1          89 ATLPVINLGRVSTIDSYASAGVIGPYDTNKLDLEDIEISFDHIVPLKYSQLVDLRSRYDGLTLLAYNAGVCPGGSIWCIS  168 (514)
T ss_dssp             EEHHHHHHHHHHHHHHHHHTTSSSSBTTCCSCHHHHHHHHHTSEEECTTCCEEETTTTTTEEEEEEECSSSTTCEEEEEE
T ss_pred             eCHHHHHHHHHHHHHHHHHhhhhcccccCCCCHHHHHHHHHhcccCCCCCeEEecCCcccEEEEEccCCCCCCceEEEEE
Confidence            699999999999999999886543  46889999999999999999999999994    799999999999999999999


Q ss_pred             ECCeEEEeeeeeEEEecCCCCCccceeC
Q psy8351          75 IAGVKIARYLFLWYQVNVNQNNQEFRIG  102 (103)
Q Consensus        75 ~~~~~i~~~~~~~ysgD~~~~~~~~~~g  102 (103)
                      .++.+|      +||||++..+++++.|
T Consensus       169 ~~~~~I------vytGD~~~~~~~~l~~  190 (514)
T d2i7xa1         169 TYSEKL------VYAKRWNHTRDNILNA  190 (514)
T ss_dssp             CSSCEE------EECSSCCSSCCSSCCC
T ss_pred             ECCeEE------EEEeccCCCCCccCCC
Confidence            999999      9999999999998765
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure