Psyllid ID: psy836

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MIITYQAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNEL
ccHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEEcccccEEEcccccccccccccEEEcccccEEEEcccEEEccHHHHHHHHHHHHHHHHHcc
cEEEEEcccEEEEEEHHHHcccccHHHHHHHHHHHHHHHccEcccccccccEEEEEccEEEEcccccEEEccccccccccccccccccccEEEEEccEEEcccHHHHHHHHHHHHHHHHHcc
MIITYQakrtkkvgitgkygtrYGASLRKMVKKMEITQHAKytcsfcgkdsmkrscvgiwsckrckrivaggawdsmkrscvgiwsckrckrivaggawvyntTAATSVRSAIRRLREVNEL
miityqakrtkkvgitgkygtrygaSLRKMVKKMEITQHAKytcsfcgkdsmKRSCVGIWSCKRCKRIvaggawdsmkrsCVGIWSCKRCKRIVaggawvynttaatsvrsairrlrevnel
MIITYQAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNEL
****YQAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRS***********
*************GITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREV***
MIITYQAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNEL
MIITYQAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVN**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIITYQAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query122 2.2.26 [Sep-21-2011]
Q9VMU492 60S ribosomal protein L37 yes N/A 0.737 0.978 0.695 7e-36
O6146292 60S ribosomal protein L37 N/A N/A 0.737 0.978 0.617 6e-32
O6159891 60S ribosomal protein L37 N/A N/A 0.737 0.989 0.582 2e-30
Q7SZB492 60S ribosomal protein L37 N/A N/A 0.737 0.978 0.591 8e-30
P3204692 60S ribosomal protein L37 yes N/A 0.737 0.978 0.591 2e-29
P6151592 Putative 60S ribosomal pr yes N/A 0.737 0.978 0.591 3e-29
Q5RBF992 60S ribosomal protein L37 yes N/A 0.737 0.978 0.591 3e-29
P6151492 60S ribosomal protein L37 yes N/A 0.737 0.978 0.591 3e-29
P6151392 60S ribosomal protein L37 yes N/A 0.737 0.978 0.591 3e-29
Q3MIC092 60S ribosomal protein L37 yes N/A 0.737 0.978 0.591 3e-29
>sp|Q9VMU4|RL37A_DROME 60S ribosomal protein L37a OS=Drosophila melanogaster GN=RpL37A PE=1 SV=3 Back     alignment and function desciption
 Score =  149 bits (375), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 80/115 (69%), Positives = 84/115 (73%), Gaps = 25/115 (21%)

Query: 7   AKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCK 66
           AKRTKKVGI GKYGTRYGASLRKMVKKMEITQH+KYTCSFCGKDSMKR+ VGIWSCKRCK
Sbjct: 2   AKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCK 61

Query: 67  RIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNE 121
           R VA                         GGAWVY+TTAA SVRSA+RRLRE  E
Sbjct: 62  RTVA-------------------------GGAWVYSTTAAASVRSAVRRLRETKE 91

Drosophila melanogaster (taxid: 7227)
>sp|O61462|RL37A_CRYST 60S ribosomal protein L37a OS=Cryptochiton stelleri GN=RPL37A PE=3 SV=3 Back     alignment and function description
>sp|O61598|RL37A_OSTOS 60S ribosomal protein L37a OS=Ostertagia ostertagi GN=rpl-37a PE=3 SV=3 Back     alignment and function description
>sp|Q7SZB4|RL37A_XENLA 60S ribosomal protein L37a OS=Xenopus laevis GN=rpl37a PE=3 SV=3 Back     alignment and function description
>sp|P32046|RL37A_CHICK 60S ribosomal protein L37a OS=Gallus gallus GN=RPL37A PE=2 SV=2 Back     alignment and function description
>sp|P61515|RL37P_RAT Putative 60S ribosomal protein L37a OS=Rattus norvegicus GN=Rpl37a-ps1 PE=5 SV=2 Back     alignment and function description
>sp|Q5RBF9|RL37A_PONAB 60S ribosomal protein L37a OS=Pongo abelii GN=RPL37A PE=3 SV=3 Back     alignment and function description
>sp|P61514|RL37A_MOUSE 60S ribosomal protein L37a OS=Mus musculus GN=Rpl37a PE=2 SV=2 Back     alignment and function description
>sp|P61513|RL37A_HUMAN 60S ribosomal protein L37a OS=Homo sapiens GN=RPL37A PE=1 SV=2 Back     alignment and function description
>sp|Q3MIC0|RL37A_BOVIN 60S ribosomal protein L37a OS=Bos taurus GN=RPL37A PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
9082000492 ribosomal protein L37Ae-like protein [Gr 0.745 0.989 0.724 5e-37
7090989592 ribosomal protein L37Ae [Timarcha balear 0.737 0.978 0.721 3e-36
270012418122 hypothetical protein TcasGA2_TC006567 [T 0.754 0.754 0.683 3e-36
26466745192 ribosomal protein L37A [Chrysomela tremu 0.737 0.978 0.713 4e-36
7090988792 ribosomal protein L37Ae [Agriotes lineat 0.737 0.978 0.713 4e-36
7090988992 ribosomal protein L37Ae [Cicindela litto 0.737 0.978 0.721 5e-36
7090989392 ribosomal protein L37Ae [Sphaerius sp. A 0.737 0.978 0.713 7e-36
7090989192 ribosomal protein L37Ae [Georissus sp. A 0.737 0.978 0.713 1e-35
18924034492 PREDICTED: similar to ribosomal protein 0.737 0.978 0.695 2e-35
33237420892 unknown [Dendroctonus ponderosae] 0.737 0.978 0.704 3e-35
>gi|90820004|gb|ABD98759.1| ribosomal protein L37Ae-like protein [Graphocephala atropunctata] Back     alignment and taxonomy information
 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 90/116 (77%), Gaps = 25/116 (21%)

Query: 7   AKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCK 66
           AKRTKKVGITGKYGTRYGASLRKMVKKMEITQH+KYTCSFCGK++MKRSCVGIW+CKRCK
Sbjct: 2   AKRTKKVGITGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKEAMKRSCVGIWNCKRCK 61

Query: 67  RIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNEL 122
           R VA                         GGAWVY+TTAATSVRSA+RRLREVNEL
Sbjct: 62  RTVA-------------------------GGAWVYSTTAATSVRSAVRRLREVNEL 92

Source: Graphocephala atropunctata

Species: Graphocephala atropunctata

Genus: Graphocephala

Family: Cicadellidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|70909895|emb|CAJ17434.1| ribosomal protein L37Ae [Timarcha balearica] Back     alignment and taxonomy information
>gi|270012418|gb|EFA08866.1| hypothetical protein TcasGA2_TC006567 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|264667451|gb|ACY71311.1| ribosomal protein L37A [Chrysomela tremula] Back     alignment and taxonomy information
>gi|70909887|emb|CAJ17430.1| ribosomal protein L37Ae [Agriotes lineatus] Back     alignment and taxonomy information
>gi|70909889|emb|CAJ17431.1| ribosomal protein L37Ae [Cicindela littoralis] Back     alignment and taxonomy information
>gi|70909893|emb|CAJ17433.1| ribosomal protein L37Ae [Sphaerius sp. APV-2005] Back     alignment and taxonomy information
>gi|70909891|emb|CAJ17432.1| ribosomal protein L37Ae [Georissus sp. APV-2005] Back     alignment and taxonomy information
>gi|189240344|ref|XP_971874.2| PREDICTED: similar to ribosomal protein L37Ae [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332374208|gb|AEE62245.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
FB|FBgn026160892 RpL37A "Ribosomal protein L37A 0.557 0.739 0.926 1.6e-31
UNIPROTKB|F1NDE192 RPL37A "60S ribosomal protein 0.721 0.956 0.685 3.1e-28
ZFIN|ZDB-GENE-070928-3192 zgc:171772 "zgc:171772" [Danio 0.713 0.945 0.693 3.9e-28
UNIPROTKB|F2Z4M791 RPL37A "60S ribosomal protein 0.713 0.956 0.681 1e-27
UNIPROTKB|P3204692 RPL37A "60S ribosomal protein 0.713 0.945 0.681 1e-27
UNIPROTKB|Q3MIC092 RPL37A "60S ribosomal protein 0.713 0.945 0.681 1.3e-27
UNIPROTKB|P6151392 RPL37A "60S ribosomal protein 0.713 0.945 0.681 1.3e-27
MGI|MGI:9806892 Rpl37a "ribosomal protein L37a 0.713 0.945 0.681 1.3e-27
RGD|156118192 Rpl37a-ps1 "ribosomal protein 0.713 0.945 0.681 1.3e-27
UNIPROTKB|P6151592 Rpl37a-ps1 "Putative 60S ribos 0.713 0.945 0.681 1.3e-27
FB|FBgn0261608 RpL37A "Ribosomal protein L37A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 346 (126.9 bits), Expect = 1.6e-31, P = 1.6e-31
 Identities = 63/68 (92%), Positives = 65/68 (95%)

Query:     7 AKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCK 66
             AKRTKKVGI GKYGTRYGASLRKMVKKMEITQH+KYTCSFCGKDSMKR+ VGIWSCKRCK
Sbjct:     2 AKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCK 61

Query:    67 RIVAGGAW 74
             R VAGGAW
Sbjct:    62 RTVAGGAW 69
GO:0006412 "translation" evidence=ISS
GO:0003735 "structural constituent of ribosome" evidence=ISS
GO:0022625 "cytosolic large ribosomal subunit" evidence=ISS
GO:0000022 "mitotic spindle elongation" evidence=IMP
GO:0007052 "mitotic spindle organization" evidence=IMP
UNIPROTKB|F1NDE1 RPL37A "60S ribosomal protein L37a" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070928-31 zgc:171772 "zgc:171772" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4M7 RPL37A "60S ribosomal protein L37a" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P32046 RPL37A "60S ribosomal protein L37a" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MIC0 RPL37A "60S ribosomal protein L37a" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P61513 RPL37A "60S ribosomal protein L37a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:98068 Rpl37a "ribosomal protein L37a" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1561181 Rpl37a-ps1 "ribosomal protein L37a, pseudogene 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P61515 Rpl37a-ps1 "Putative 60S ribosomal protein L37a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A4S6Z4RL37A_OSTLUNo assigned EC number0.53040.73770.9782yesN/A
O26777RL37A_METTHNo assigned EC number0.40900.70490.9662yesN/A
Q2NEX3RL37A_METSTNo assigned EC number0.37640.68030.9325yesN/A
Q9U2A8RL37A_CAEELNo assigned EC number0.53910.73770.9890yesN/A
P61513RL37A_HUMANNo assigned EC number0.59130.73770.9782yesN/A
P61515RL37P_RATNo assigned EC number0.59130.73770.9782yesN/A
P61514RL37A_MOUSENo assigned EC number0.59130.73770.9782yesN/A
Q5QM99RL37A_ORYSJNo assigned EC number0.51750.72950.9673yesN/A
Q8RXU5R37A2_ARATHNo assigned EC number0.52170.73770.9782yesN/A
O96184RL37A_PLAF7No assigned EC number0.50430.73770.9375yesN/A
P0CX25RL43A_YEASTNo assigned EC number0.53040.73770.9782yesN/A
P0CX26RL43B_YEASTNo assigned EC number0.53040.73770.9782yesN/A
P54051RL37A_METJANo assigned EC number0.36600.71310.9456yesN/A
Q00VK4RL37A_OSTTANo assigned EC number0.52170.73770.9782yesN/A
Q9HGL8RL43A_SCHPONo assigned EC number0.61190.53270.6914yesN/A
Q9VMU4RL37A_DROMENo assigned EC number0.69560.73770.9782yesN/A
P32046RL37A_CHICKNo assigned EC number0.59130.73770.9782yesN/A
Q6FRG6RL43_CANGANo assigned EC number0.51300.73770.9782yesN/A
Q54UG4RL37A_DICDINo assigned EC number0.55650.73770.9890yesN/A
Q3MIC0RL37A_BOVINNo assigned EC number0.59130.73770.9782yesN/A
Q751L1RL43_ASHGONo assigned EC number0.52170.73770.9782yesN/A
Q5RBF9RL37A_PONABNo assigned EC number0.59130.73770.9782yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
pfam0178090 pfam01780, Ribosomal_L37ae, Ribosomal L37ae protei 2e-38
PTZ0025590 PTZ00255, PTZ00255, 60S ribosomal protein L37a; Pr 2e-37
TIGR0028092 TIGR00280, L37a, ribosomal protein L37a 3e-21
PRK0397690 PRK03976, rpl37ae, 50S ribosomal protein L37Ae; Re 4e-21
COG199789 COG1997, RPL43A, Ribosomal protein L37AE/L43A [Tra 8e-20
>gnl|CDD|216695 pfam01780, Ribosomal_L37ae, Ribosomal L37ae protein family Back     alignment and domain information 
 Score =  124 bits (313), Expect = 2e-38
 Identities = 60/115 (52%), Positives = 72/115 (62%), Gaps = 25/115 (21%)

Query: 7   AKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCK 66
           AKRTKKVGI G++GTRYGASLRK VKK+EI+QHAKYTC FCGK                 
Sbjct: 1   AKRTKKVGIAGRFGTRYGASLRKRVKKIEISQHAKYTCPFCGK----------------- 43

Query: 67  RIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNE 121
                   D++KR  VGIW C++C +  AGGA+   T A  +VR  IRRLRE+ E
Sbjct: 44  --------DAVKRKAVGIWKCRKCGKTFAGGAYTPETPAGKTVRRTIRRLRELKE 90

This ribosomal protein is found in archaebacteria and eukaryotes. It contains four conserved cysteine residues that may bind to zinc. Length = 90
>gnl|CDD|240332 PTZ00255, PTZ00255, 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>gnl|CDD|232904 TIGR00280, L37a, ribosomal protein L37a Back     alignment and domain information
>gnl|CDD|235183 PRK03976, rpl37ae, 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>gnl|CDD|224908 COG1997, RPL43A, Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
KOG0402|consensus92 100.0
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 100.0
PTZ0025590 60S ribosomal protein L37a; Provisional 100.0
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 100.0
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 100.0
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 100.0
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 97.25
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 97.23
PTZ0025590 60S ribosomal protein L37a; Provisional 97.2
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 97.19
KOG0402|consensus92 96.76
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 95.83
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 94.72
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 94.39
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 94.29
PRK0043250 30S ribosomal protein S27ae; Validated 93.93
PHA0062659 hypothetical protein 93.1
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 93.1
PRK00464154 nrdR transcriptional regulator NrdR; Validated 92.17
PF1435461 Lar_restr_allev: Restriction alleviation protein L 91.84
PF0827340 Prim_Zn_Ribbon: Zinc-binding domain of primase-hel 91.71
COG4888104 Uncharacterized Zn ribbon-containing protein [Gene 91.52
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 91.42
PRK04023 1121 DNA polymerase II large subunit; Validated 90.84
smart0066152 RPOL9 RNA polymerase subunit 9. 90.39
COG0675364 Transposase and inactivated derivatives [DNA repli 90.34
PRK0971064 lar restriction alleviation and modification prote 88.52
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 88.52
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 88.27
PF08646146 Rep_fac-A_C: Replication factor-A C terminal domai 87.84
PF1178136 RRN7: RNA polymerase I-specific transcription init 87.83
PRK1489299 putative transcription elongation factor Elf1; Pro 87.52
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 87.25
PRK00423 310 tfb transcription initiation factor IIB; Reviewed 86.94
PF04981 236 NMD3: NMD3 family ; InterPro: IPR007064 The NMD3 p 86.81
PRK14714 1337 DNA polymerase II large subunit; Provisional 86.61
PF0512981 Elf1: Transcription elongation factor Elf1 like; I 85.73
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 85.49
smart00531147 TFIIE Transcription initiation factor IIE. 85.41
PF03833 900 PolC_DP2: DNA polymerase II large subunit DP2; Int 85.31
PRK11823 446 DNA repair protein RadA; Provisional 84.46
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 83.28
PF0877273 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon lik 83.26
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 82.54
PRK12366637 replication factor A; Reviewed 82.44
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 82.19
PHA02942383 putative transposase; Provisional 81.85
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 81.77
cd04476166 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds cor 80.48
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 80.26
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 80.12
>KOG0402|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.8e-46  Score=266.32  Aligned_cols=92  Identities=73%  Similarity=1.192  Sum_probs=89.8

Q ss_pred             hhhcceeeeeccccccccChhhhHhHHHHHHHhhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeee
Q psy836            6 QAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIW   85 (122)
Q Consensus         6 M~krtkkvgi~gkyG~RYG~slRK~v~kie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~   85 (122)
                      |+||||||||+|+||+|||+||||++++||++||++|+|+||||..|||.|||||.                        
T Consensus         1 m~krtKKVgI~gkyGtrYGaSLrk~vKkiei~Qhaky~CsfCGK~~vKR~AvGiW~------------------------   56 (92)
T KOG0402|consen    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIQQHAKYTCSFCGKKTVKRKAVGIWK------------------------   56 (92)
T ss_pred             CCcccceeeeeecccchhhHHHHHHHHHHHHHHhhhhhhhhcchhhhhhhceeEEe------------------------
Confidence            89999999999999999999999999999999999999999999999999999999                        


Q ss_pred             eecCcCeEEeccccccCchHHHHHHHHHHHHHHhhhC
Q psy836           86 SCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNEL  122 (122)
Q Consensus        86 s~~rC~~~~AGGAy~~~T~~~~~~~~~i~rl~e~~~~  122 (122)
                       |..|++++|||||+++|+++.+++++||||||+.|+
T Consensus        57 -C~~C~kv~agga~~~~t~aa~t~rs~irrlre~~e~   92 (92)
T KOG0402|consen   57 -CGSCKKVVAGGAYTVTTAAAATVRSTIRRLRELVEQ   92 (92)
T ss_pred             -cCCccceeccceEEeccchhHHHHHHHHHHHHHhcC
Confidence             788999999999999999999999999999999885

>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0402|consensus Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>PF08273 Prim_Zn_Ribbon: Zinc-binding domain of primase-helicase; InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4 Back     alignment and domain information
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08646 Rep_fac-A_C: Replication factor-A C terminal domain; InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing Back     alignment and domain information
>PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>PF04981 NMD3: NMD3 family ; InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF03833 PolC_DP2: DNA polymerase II large subunit DP2; InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF08772 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon like; InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1 Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK12366 replication factor A; Reviewed Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PHA02942 putative transposase; Provisional Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70) Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
2zkr_z92 Structure Of A Mammalian Ribosomal 60s Subunit With 2e-30
4a17_Y103 T.Thermophila 60s Ribosomal Subunit In Complex With 3e-26
3izs_m92 Localization Of The Large Subunit Ribosomal Protein 9e-26
1s1i_991 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 1e-25
3izr_m92 Localization Of The Large Subunit Ribosomal Protein 1e-25
3zf7_o93 High-resolution Cryo-electron Microscopy Structure 1e-20
1ysh_D73 Localization And Dynamic Behavior Of Ribosomal Prot 2e-19
3jyw_972 Structure Of The 60s Proteins For Eukaryotic Riboso 2e-18
3j21_i83 Promiscuous Behavior Of Proteins In Archaeal Riboso 1e-11
1ffk_W73 Crystal Structure Of The Large Ribosomal Subunit Fr 5e-09
3cc2_Z116 The Refined Crystal Structure Of The Haloarcula Mar 1e-08
3cpw_Y92 The Structure Of The Antibiotic Linezolid Bound To 2e-08
2qa4_Z92 A More Complete Structure Of The The L7L12 STALK OF 4e-08
1jj2_Y73 Fully Refined Crystal Structure Of The Haloarcula M 5e-08
1yhq_Z83 Crystal Structure Of Azithromycin Bound To The G209 6e-07
3g4s_Z73 Co-Crystal Structure Of Tiamulin Bound To The Large 7e-07
1s72_Z73 Refined Crystal Structure Of The Haloarcula Marismo 8e-07
>pdb|2ZKR|ZZ Chain z, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 92 Back     alignment and structure 
Iteration: 1

 Score =  127 bits (318), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 77/115 (66%), Gaps = 25/115 (21%)
Query: 7   AKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCK 66
           AKRTKKVGI GKYGTRYGASLRKMVKK+EI+QHAKYTCSFCGK  MKR  VGI       
Sbjct: 2   AKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGI------- 54
Query: 67  RIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNE 121
                             W C  C + VAGGAW YNTT+A +V+SAIRRL+E+ +
Sbjct: 55  ------------------WHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD 91
>pdb|4A17|Y Chain Y, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 5s Rrna, 5.8s Rrna And Proteins Of Molecule 2. Length = 103 Back     alignment and structure
>pdb|3IZS|MM Chain m, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 92 Back     alignment and structure
>pdb|1S1I|9 Chain 9, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 91 Back     alignment and structure
>pdb|3IZR|MM Chain m, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 92 Back     alignment and structure
>pdb|3ZF7|OO Chain o, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 93 Back     alignment and structure
>pdb|1YSH|D Chain D, Localization And Dynamic Behavior Of Ribosomal Protein L30e Length = 73 Back     alignment and structure
>pdb|3JYW|9 Chain 9, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 72 Back     alignment and structure
>pdb|3J21|II Chain i, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (50s Ribosomal Proteins) Length = 83 Back     alignment and structure
>pdb|1FFK|W Chain W, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 73 Back     alignment and structure
>pdb|3CC2|Z Chain Z, The Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution With Rrna Sequence For The 23s Rrna And Genome-Derived Sequences For R-Proteins Length = 116 Back     alignment and structure
>pdb|3CPW|Y Chain Y, The Structure Of The Antibiotic Linezolid Bound To The Large Ribosomal Subunit Of Haloarcula Marismortui Length = 92 Back     alignment and structure
>pdb|2QA4|Z Chain Z, A More Complete Structure Of The The L7L12 STALK OF THE Haloarcula Marismortui 50s Large Ribosomal Subunit Length = 92 Back     alignment and structure
>pdb|1JJ2|Y Chain Y, Fully Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 73 Back     alignment and structure
>pdb|1YHQ|Z Chain Z, Crystal Structure Of Azithromycin Bound To The G2099a Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui Length = 83 Back     alignment and structure
>pdb|3G4S|Z Chain Z, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 73 Back     alignment and structure
>pdb|1S72|Z Chain Z, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 4e-34
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 1e-32
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 1e-32
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 2e-32
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 5e-30
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 2e-25
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 1e-23
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Length = 116 Back     alignment and structure
 Score =  113 bits (285), Expect = 4e-34
 Identities = 29/115 (25%), Positives = 46/115 (40%), Gaps = 25/115 (21%)

Query: 7   AKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCK 66
           A ++ K G +G++G RYG   R+ V ++E   +  + C  CG+                 
Sbjct: 26  ASKSGKTGSSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGE----------------- 68

Query: 67  RIVAGGAWDSMKRSCVGIWSCKRCKRIVAGGAWVYNTTAATSVRSAIRRLREVNE 121
                   D + R   GIW C  C     GG++   T    +VR +IR     +E
Sbjct: 69  --------DRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSEDE 115
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Length = 103 Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Length = 83 Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Length = 73 Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 100.0
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 100.0
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 100.0
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 100.0
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 100.0
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 100.0
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 100.0
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 100.0
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 99.35
3j21_g51 50S ribosomal protein L40E; archaea, archaeal, KIN 98.34
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 97.63
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 97.61
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 97.61
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 97.53
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 97.02
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 96.97
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 96.86
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 94.43
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 94.17
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 93.21
3ga8_A78 HTH-type transcriptional regulator MQSA (YGIT/B30; 91.89
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 91.22
4bbr_M 345 Transcription initiation factor IIB; RNA polymeras 88.57
3j21_g51 50S ribosomal protein L40E; archaea, archaeal, KIN 87.86
3u50_C172 Telomerase-associated protein 82; TEB1, processivi 87.3
1l1o_C181 Replication protein A 70 kDa DNA-binding subunit; 85.3
1vd4_A62 Transcription initiation factor IIE, alpha subunit 84.8
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 84.32
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 81.96
2con_A79 RUH-035 protein, NIN one binding protein; ribosome 81.74
1nui_A 255 DNA primase/helicase; zinc-biding domain, toprim f 81.63
3o9x_A133 Uncharacterized HTH-type transcriptional regulato; 81.57
1qyp_A57 RNA polymerase II; transcription, RPB9, Zn ribbon, 80.92
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1l1o_C Replication protein A 70 kDa DNA-binding subunit; eukaryotic SSB, ssDNA binding protein, OB-fold; 2.80A {Homo sapiens} SCOP: b.40.4.3 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1 Back     alignment and structure
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 Back     alignment and structure
>3o9x_A Uncharacterized HTH-type transcriptional regulato; HTH-XRE DNA binding motif, transcriptional regulator, bacter antitoxin, Zn binding protein, transcription regulator-DNA; HET: DNA; 2.10A {Escherichia coli} PDB: 3gn5_A* 3gn5_B* 2kz8_A Back     alignment and structure
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 122
d1vqoz173 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archae 5e-28
d1jj2y_73 g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Ha 2e-27
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 73 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: Zn-binding ribosomal proteins
family: Ribosomal protein L37ae
domain: Ribosomal protein L37ae
species: Archaeon Haloarcula marismortui [TaxId: 2238]

 Score = 95.5 bits (238), Expect = 5e-28
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 16 TGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAW 74
          +G++G RYG   R+ V ++E   +  + C  CG+D + R   GIW C  C     GG++
Sbjct: 2  SGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSY 60
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 100.0
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 100.0
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 97.38
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 97.27
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 89.77
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 87.31
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 85.04
d2cona166 RNA-binding protein NOB1 (Nin one binding) {Mouse 83.59
d1l1oc_178 Replication protein A 70 KDa subunit (RPA70) {Huma 82.81
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 81.92
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 81.27
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 80.96
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Zn-binding ribosomal proteins
family: Ribosomal protein L37ae
domain: Ribosomal protein L37ae
species: Archaeon Haloarcula marismortui [TaxId: 2238]

Probab=100.00  E-value=8.2e-38  Score=213.17  Aligned_cols=72  Identities=39%  Similarity=0.785  Sum_probs=66.1

Q ss_pred             ccccccccChhhhHhHHHHHHHhhccccCCCCCCceeEeEEeeeeeecCcceeeecceeeeeccceeeeeeecCcCeEEe
Q psy836           16 TGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKDSMKRSCVGIWSCKRCKRIVAGGAWDSMKRSCVGIWSCKRCKRIVA   95 (122)
Q Consensus        16 ~gkyG~RYG~slRK~v~kie~~~~aky~Cp~Cgk~~mkR~avGIW~C~~C~~~vAggAy~~~t~~AvtV~s~~rC~~~~A   95 (122)
                      +||||+|||++|||+|++||++||++|+|||||+++|+|.++|||+                         |.+|+++||
T Consensus         2 TGrfG~RYG~slRk~v~kie~~q~~ky~Cp~Cgk~~vkR~a~GIW~-------------------------C~kC~~~~A   56 (73)
T d1jj2y_           2 TGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWM-------------------------CGHCGYKIA   56 (73)
T ss_dssp             GGGGTTCSCHHHHHHHHHHHHHHHSCBCCSSSCCSCEEEEETTEEE-------------------------ETTTCCEEE
T ss_pred             CCccccccCHHHHHHHHHHHHHhcCCccCCCCCCCceEEEEEEEEE-------------------------CCCCCCEEe
Confidence            6999999999999999999999999999999999999999999999                         677777888


Q ss_pred             ccccccCchHHHHHHHH
Q psy836           96 GGAWVYNTTAATSVRSA  112 (122)
Q Consensus        96 GGAy~~~T~~~~~~~~~  112 (122)
                      ||||+|+||++.+|+++
T Consensus        57 GgAy~p~T~a~~tv~~~   73 (73)
T d1jj2y_          57 GGCYQPETVAGKAVMKA   73 (73)
T ss_dssp             CCSSSSSCHHHHHHHHC
T ss_pred             CccceecchHHhhhccC
Confidence            88888888888888763
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l1oc_ b.40.4.3 (C:) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure