Psyllid ID: psy8382

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860----
MELLATVSNSRPRSGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNISDLYDKVHSFVWYSSQYGHFTPCYVHTNGFYRPSPRSGFDKGNLEWLEQLFRQTVAYTSLRIHHNLVCLPRSGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNEFIDAMHQFAGQSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQIDHLTMALFEDADSENRGAITYESLKNQLEKHGGLLENLSISIDRWLVPPKPKKLANQSRLSQLIALRPYQLTLPYIKNNYVYLGFMFFYLLVNIVLFTSRMYVFRKSNYYVIFARACGQCLNFNCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYFHKMTGFFIFGYSVLHTIMHLLNFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPTGVCLIIILTIMFICSQTFVRKSGSFELLFLGGFNVTLQGFWRVMQPDDSVTHVVLGAFTPTFHKLYACLSSKPHVVTVEWLKQTKLSQLLGAGYQEEFMKRDNPKNNKKASTHLVCPTCSGSKYNAALKWGFPSVNKKWLLECARTGKRVSEQQYLTGSDEASQNVGSQSNGFGLQQNVGSHNGVGSQTNGVQSRLNGARSDAKPNEPDRLDTKENHTSSRKNPEFESASQGSQLSGKSASKKRKLCLLNNGDGEGLCSPVKRTALDSKHSPVKQSQNSSFSQGKPTREERKQWEKLMDNLSKNCQKLSANNKVEAWVNENELLAQARTPNSGQRTTNNSERTPSQNNPSSQRIANNPSNERTPSQTNISSQAKSSQASQPSDLVKTIDELNQQLSRAKSRTSRDSDETNSPPKRNSVHARKYVQT
ccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHcHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHEEcccEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccccccccccccccccccccccEEEcEEEEEEEEEEEEEEEEEEEEEEEEEccccEEEEcccccccccccccEEEEEccccccccccccccccccEEEHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccHHcHHHHHHHHccccccccccccccccccccccccccccccc
ccEEEccccccccccccHHHHHHHHHHHHHHHccccHcHHHHHHHHHHHccccEEEEcccccccccHccccEHEHHHHccHHHHcccccccccccHHHHHHHHHHHHcccccHHHHHHHHHcHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHEcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccccccccccHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHHHHcHHHHccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccEEEEEEEcccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccHHcccccccccccccEcccccccccHHHHcccccccccccHHcccccccHHHHHHHHHHHHHHccccEEEEcHHHHHHHcccccccccccEEcccccccccccHcHEEcccccccccccccHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccccccEccccEccc
mellatvsnsrprsgfdkgnLEWLEQLFRQTVGDEKEICRDDFKKILITKNISDLYDKVHSFVWyssqyghftpcyvhtngfyrpsprsgfdkgnLEWLEQLFRQTVAYTSLRIHHnlvclprsgfdkgnLEWLEQLFRQTVGDEKEICRDDFKKILITKNEFIDAMHqfagqspddKIKFLFRVydldgdgliQHKELQHVMRACMeengmqfsEEQIDHLTMALfedadsenrgaitYESLKNQLEKHggllenlsisidrwlvppkpkklanQSRLSQLIAlrpyqltlpyiknnyVYLGFMFFYLLVNIVLFTSRMYVFRKSNYYVIFARACGQCLNFNCMFVLVLMLRHCITFLRtrgfsvflpldqhiyfhKMTGFFIFGYSVLHTIMHLLNFSLnvlgdgtinkkglSLTEWlftsrpglfglingwanptGVCLIIILTIMFICSQTFVRKSGSFELLFLGGFNVTLQGFwrvmqpddsvthvvlgaftpTFHKLYAClsskphvvtVEWLKQTKLSQLLGAgyqeefmkrdnpknnkkasthlvcptcsgskynaalkwgfpsvnKKWLLECARtgkrvseqqyltgsdeasqnvgsqsngfglqqnvgshngvgsqtngvqsrlngarsdakpnepdrldtkenhtssrknpefesasqgsqlsgksaskKRKLCllnngdgeglcspvkrtaldskhspvkqsqnssfsqgkptrEERKQWEKLMDNLSKNCQKLSANNKVEAWVNENELLaqartpnsgqrttnnsertpsqnnpssqriannpsnertpsqtnissqakssqasqpsdLVKTIDELNQQLSRaksrtsrdsdetnsppkrnsvharkyvqt
mellatvsnsrprsgfdkgnleWLEQLFRqtvgdekeicRDDFKKILITKNISDLYDKVHSFVWYSSQYGHFTPCYVHTNGFYRPSPRSGFDKGNLEWLEQLFRQTVAYTSLRIHHNLVCLPRSGFDKGNLEWLEQLFRqtvgdekeiCRDDFKKILITKNEFIDAMHQFAGQSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQIDHLTMALFEDADSENRGAITYESLKNQLEKHGGLLENLSISIDRWLVPPKPKKLANQSRLSQLIALRPYQLTLPYIKNNYVYLGFMFFYLLVNIVLFTSRMYVFRKSNYYVIFARACGQCLNFNCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYFHKMTGFFIFGYSVLHTIMHLLNFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPTGVCLIIILTIMFICSQTFVRKSGSFELLFLGGFNVTLQGFWRVMQPDDSVTHVVLGAFTPTFHKLYACLSSKPHVVTVEWLKQTKLSQLLGAGYQEEFMKRDNPKNNKKASTHLVCPTCSGSKYNAALKWGFPSVNKKWLLECARTGKRVSEQQYLTGSDEASQNVGSQSNGFGLQQNVGSHNGVGSQTNGVQSRLNGarsdakpnepdrldtkenhtssrknpefesasqgsqlsgksaskKRKLCLLNNGDGEGLCSPVKRTALdskhspvkqsqnssfsqgkptrEERKQWEKLMDNLSKNCQKLSANNKVEAWVNENELlaqartpnsgqrttnnsertpsqnnpssqriannpsnertPSQTNISSQakssqasqpsdLVKTIDELNQQlsraksrtsrdsdetnsppkrnsvharkyvqt
MELLATVSNSRPRSGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNISDLYDKVHSFVWYSSQYGHFTPCYVHTNGFYRPSPRSGFDKGNLEWLEQLFRQTVAYTSLRIHHNLVCLPRSGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNEFIDAMHQFAGQSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQIDHLTMALFEDADSENRGAITYESLKNQLEKHGGLLENLSISIDRWLVPPKPKKLANQSRLSQLIALRPYQLTLPYIKNNYVYLGFMFFYLLVNIVLFTSRMYVFRKSNYYVIFARACGQCLNFNCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYFHKMTGFFIFGYSVLHTIMHLLNFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPTGVCLIIILTIMFICSQTFVRKSGSFELLFLGGFNVTLQGFWRVMQPDDSVTHVVLGAFTPTFHKLYACLSSKPHVVTVEWLKQTKLSQLLGAGYQEEFMKRDNPKNNKKASTHLVCPTCSGSKYNAALKWGFPSVNKKWLLECARTGKRVSEQQYLTGSDEASQNVGSQSNGFGLQQNVGSHNGVGSQTNGVQSRLNGARSDAKPNEPDRLDTKENHTSSRKNPEFESASQGSQLSGKSASKKRKLCLLNNGDGEGLCSPVKRTALDSKHSPVKQSQNSSFSQGKPTREERKQWEKLMDNLSKNCQKLSANNKVEAWVNENELLAQARTPNSGQRTTNNSERTPSQNNPSSQRIANNPSNERTPSQTNIssqakssqasqpsDLVKTIDELNQQLSRAKSRTSRDSDETNSPPKRNSVHARKYVQT
******************GNLEWLEQLFRQTVGDEKEICRDDFKKILITKNISDLYDKVHSFVWYSSQYGHFTPCYVHTNGFYRPSPRSGFDKGNLEWLEQLFRQTVAYTSLRIHHNLVCLPRSGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNEFIDAMHQFAGQSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQIDHLTMALFE*******GAITYESLKNQLEKHGGLLENLSISIDRWLVPPK***LANQSRLSQLIALRPYQLTLPYIKNNYVYLGFMFFYLLVNIVLFTSRMYVFRKSNYYVIFARACGQCLNFNCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYFHKMTGFFIFGYSVLHTIMHLLNFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPTGVCLIIILTIMFICSQTFVRKSGSFELLFLGGFNVTLQGFWRVMQPDDSVTHVVLGAFTPTFHKLYACLSSKPHVVTVEWLKQTKLSQLLGAGYQ****************THLVCPTCSGSKYNAALKWGFPSVNKKWLLECARTG*************************************************************************************************************************************************************************WV************************************************************************************************************
*EL****SNSRP**GFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNISDLYDKVH***************************R*GFDKGNLEWLEQLFRQTVA*****IH***VCL********NLEWLEQLFRQTVGDEKEICRDDFKKILITKNEFIDAMHQFAGQSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQIDHLTMALFEDADSENRGAITYESLKNQLEKHGGLLENLSISIDRWLVPPKPKKLANQSRLSQLIALRPYQLTLPYIKNNYVYLGFMFFYLLVNIVLFTSRMYVFRKSNYYVIFARACGQCLNFNCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYFHKMTGFFIFGYSVLHTIMHLLNFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPTGVCLIIILTIMFICSQTFVRKSGSFELLFLGGFNVTLQGFWRVMQPDDSVTHVVLGAFTPTFHKLYACLSSKPHVVTVEWLKQTKLSQLLGAGYQEEFMKRDNPKNNKKASTHLVCPTCSGSKYNAALKWGFPSVNKKWLLECARTGKRVSEQQYL******************************************************************************************************************************************************************************************************************************************************************************
*************SGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNISDLYDKVHSFVWYSSQYGHFTPCYVHTNGFYRPSPRSGFDKGNLEWLEQLFRQTVAYTSLRIHHNLVCLPRSGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNEFIDAMHQFAGQSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQIDHLTMALFEDADSENRGAITYESLKNQLEKHGGLLENLSISIDRWLVPPKPKKLANQSRLSQLIALRPYQLTLPYIKNNYVYLGFMFFYLLVNIVLFTSRMYVFRKSNYYVIFARACGQCLNFNCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYFHKMTGFFIFGYSVLHTIMHLLNFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPTGVCLIIILTIMFICSQTFVRKSGSFELLFLGGFNVTLQGFWRVMQPDDSVTHVVLGAFTPTFHKLYACLSSKPHVVTVEWLKQTKLSQLLGAGYQEEFMKRDNPKNNKKASTHLVCPTCSGSKYNAALKWGFPSVNKKWLLECARTGKRVSEQQYLTGSDEASQNVGSQSNGFGLQQNVGSHNGVGSQTN***************************************************KKRKLCLLNNGDGEGLCSPVKRTA***************************QWEKLMDNLSKNCQKLSANNKVEAWVNENELLAQAR*******************************************************LVKTIDELNQ*********************************
*ELL*TVSNSRPRSGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNISDLYDKVHSFVWYSSQYGHFTPCYVHTNGFYRPSPRSGFDKGNLEWLEQLFRQTVAYTSLRIHHNLVCLPRSGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNEFIDAMHQFAGQSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQIDHLTMALFEDADSENRGAITYESLKNQLEKHG****************************SQLIALRPYQLTLPYIKNNYVYLGFMFFYLLVNIVLFTSRMYVFRKSNYYVIFARACGQCLNFNCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYFHKMTGFFIFGYSVLHTIMHLLNFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPTGVCLIIILTIMFICSQTFVRKSGSFELLFLGGFNVTLQGFWRVMQPDDSVTHVVLGAFTPTFHKLYACLSSKPHVVTVEWLKQTKLSQLLGAGYQEEFMKRDNPKNNKKASTHLVCPTCSGSKYNAALKWGFPSVNKKWLLECARTGKRVSEQQYLTGSDEASQNVGSQSNGFGLQQNVGSHNG**SQTNGV********SD*KPNE*D***********************************KLCLLNNGDGEGLCSPVKRTALDSKHSPVKQSQN*****************KLMDNLSKNCQKLSANNKVEAWVNENELLAQARTPN*****T*N**********************************************K******QQ********************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELLATVSNSRPRSGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNISDLYDKVHSFVWYSSQYGHFTPCYVHTNGFYRPSPRSGFDKGNLEWLEQLFRQTVAYTSLRIHHNLVCLPRSGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKNEFIDAMHQFAGQSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQIDHLTMALFEDADSENRGAITYESLKNQLEKHGGLLENLSISIDRWLVPPKPKKLANQSRLSQLIALRPYQLTLPYIKNNYVYLGFMFFYLLVNIVLFTSRMYVFRKSNYYVIFARACGQCLNFNCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYFHKMTGFFIFGYSVLHTIMHLLNFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPTGVCLIIILTIMFICSQTFVRKSGSFELLFLGGFNVTLQGFWRVMQPDDSVTHVVLGAFTPTFHKLYACLSSKPHVVTVEWLKQTKLSQLLGAGYQEEFMKRDNPKNNKKASTHLVCPTCSGSKYNAALKWGFPSVNKKWLLECARTGKRVSEQQYLTGSDEASQNVGSQSNGFGLQQNVGSHNGVGSQTNGVQSRLNGARSDAKPNEPDRLDTKENHTSSRKNPEFESASQGSQLSGKSASKKRKLCLLNNGDGEGLCSPVKRTALDSKHSPVKQSQNSSFSQGKPTREExxxxxxxxxxxxxxxxxxxxxNKVEAWVNENELLAQARTPNSGQRTTNNSERTPSQNNPSSQRIANNPSNERTPSQTNISSQAKSSQASQPSDLVKTxxxxxxxxxxxxxxxxxxxxxTNSPPKRNSVHARKYVQT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query864 2.2.26 [Sep-21-2011]
Q96PH1765 NADPH oxidase 5 OS=Homo s yes N/A 0.377 0.426 0.345 6e-57
Q9VQH21537 Dual oxidase OS=Drosophil no N/A 0.371 0.208 0.252 2e-21
Q9NRD91551 Dual oxidase 1 OS=Homo sa no N/A 0.339 0.188 0.226 1e-20
Q948U0963 Respiratory burst oxidase N/A N/A 0.365 0.328 0.242 3e-20
Q8HZK31553 Dual oxidase 1 OS=Sus scr no N/A 0.346 0.192 0.210 2e-19
Q9SBI0843 Respiratory burst oxidase yes N/A 0.351 0.360 0.246 9e-17
Q2HXL0938 Respiratory burst oxidase N/A N/A 0.388 0.358 0.234 1e-16
O48538944 Respiratory burst oxidase no N/A 0.362 0.331 0.224 2e-16
Q9ES451517 Dual oxidase 2 OS=Rattus yes N/A 0.371 0.211 0.209 3e-16
Q8CIY21551 Dual oxidase 1 OS=Rattus no N/A 0.339 0.188 0.216 3e-16
>sp|Q96PH1|NOX5_HUMAN NADPH oxidase 5 OS=Homo sapiens GN=NOX5 PE=1 SV=1 Back     alignment and function desciption
 Score =  223 bits (567), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 135/391 (34%), Positives = 207/391 (52%), Gaps = 65/391 (16%)

Query: 127 DKGNLEWLEQLFRQTVGDEKEICRDDFKKIL----------------------ITKNEFI 164
           D   L W+ Q F+   G++ EI   +FK  L                      IT  E  
Sbjct: 24  DARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESFFAERFFALFDSDRSGTITLQELQ 83

Query: 165 DAMHQFAGQSPDDKIKFLFRVYDLD----------------------------GDGLIQH 196
           +A+      SP DK+KFLF+VYD+D                            G G I  
Sbjct: 84  EALTLLIHGSPMDKLKFLFQVYDIDVCARQGASAGTEWGAGAGPHWASSPLGTGSGSIDP 143

Query: 197 KELQHVMRACMEENGMQFSEEQIDHLTMALFEDADSENRGAITYESLKNQLEKHGGLLEN 256
            EL+ V+++C+ E+ +   +E++D LT+ALFE AD++  GAIT+E L+++L++  G++EN
Sbjct: 144 DELRTVLQSCLRESAISLPDEKLDQLTLALFESADADGNGAITFEELRDELQRFPGVMEN 203

Query: 257 LSISIDRWLVPPKPKKLANQSRLSQLIALRPYQLTLPYIKNNYVYLGFMFFYLLVNIVLF 316
           L+IS   WL  P P+    + R          QLT  Y  N+   L  +  Y  ++++LF
Sbjct: 204 LTISAAHWLTAPAPRPRPRRPR----------QLTRAYWHNHRSQLFCLATYAGLHVLLF 253

Query: 317 TSRMYVFRKSNYYVIFARACGQCLNFNCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYF 376
                  R     V+ A+ CGQCLNF+C F+ VLMLR C+T+LR    +  LPLDQ+I F
Sbjct: 254 GLAASAHRDLGASVMVAKGCGQCLNFDCSFIAVLMLRRCLTWLRATWLAQVLPLDQNIQF 313

Query: 377 HKMTGFFIFGYSVLHTIMHLLNFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWAN 436
           H++ G+ + G S++HT+ H +NF L    + +         E L T+RPG+ G ++G A+
Sbjct: 314 HQLMGYVVVGLSLVHTVAHTVNFVLQAQAEAS----PFQFWELLLTTRPGI-GWVHGSAS 368

Query: 437 PTGVCLIIILTIMFICSQTFVRKSGSFELLF 467
           PTGV L+++L +MFICS + +R+SG FE+ +
Sbjct: 369 PTGVALLLLLLLMFICSSSCIRRSGHFEVFY 399
Calcium-dependent NADPH oxidase that generates superoxide. Also functions as a calcium-dependent proton channel and may regulate redox-dependent processes in lymphocytes and spermatozoa. May play a role in cell growth and apoptosis. Isoform v2 and isoform v5 are involved in endothelial generation of reactive oxygen species (ROS), proliferation and angiogenesis and contribute to endothelial response to thrombin.
Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 6EC: .EC: 3EC: .EC: -
>sp|Q9VQH2|DUOX_DROME Dual oxidase OS=Drosophila melanogaster GN=Duox PE=1 SV=2 Back     alignment and function description
>sp|Q9NRD9|DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens GN=DUOX1 PE=1 SV=1 Back     alignment and function description
>sp|Q948U0|RBOHA_SOLTU Respiratory burst oxidase homolog protein A OS=Solanum tuberosum GN=RBOHA PE=1 SV=1 Back     alignment and function description
>sp|Q8HZK3|DUOX1_PIG Dual oxidase 1 OS=Sus scrofa GN=DUOX1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SBI0|RBOHB_ARATH Respiratory burst oxidase homolog protein B OS=Arabidopsis thaliana GN=RBOHB PE=2 SV=1 Back     alignment and function description
>sp|Q2HXL0|RBOHC_SOLTU Respiratory burst oxidase homolog protein C OS=Solanum tuberosum GN=RBOHC PE=1 SV=2 Back     alignment and function description
>sp|O48538|RBOHF_ARATH Respiratory burst oxidase homolog protein F OS=Arabidopsis thaliana GN=RBOHF PE=1 SV=1 Back     alignment and function description
>sp|Q9ES45|DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus GN=Duox2 PE=2 SV=1 Back     alignment and function description
>sp|Q8CIY2|DUOX1_RAT Dual oxidase 1 OS=Rattus norvegicus GN=Duox1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query864
328705704 1175 PREDICTED: NADPH oxidase 5-like [Acyrtho 0.401 0.295 0.710 1e-157
189239162 1137 PREDICTED: similar to AGAP008072-PA [Tri 0.398 0.302 0.695 1e-149
270010804 1108 hypothetical protein TcasGA2_TC013283 [T 0.398 0.310 0.695 1e-149
242015786 973 NADPH oxidase, putative [Pediculus human 0.398 0.353 0.659 1e-140
151427580 1032 TPA: predicted NADPH oxidase [Anopheles 0.395 0.331 0.649 1e-137
158297105 1053 AGAP008072-PA [Anopheles gambiae str. PE 0.395 0.324 0.649 1e-137
380028229 1098 PREDICTED: LOW QUALITY PROTEIN: NADPH ox 0.428 0.336 0.597 1e-136
328781962 1084 PREDICTED: NADPH oxidase 5 [Apis mellife 0.428 0.341 0.597 1e-133
345485658 1158 PREDICTED: LOW QUALITY PROTEIN: NADPH ox 0.413 0.308 0.605 1e-133
383857984 1093 PREDICTED: LOW QUALITY PROTEIN: NADPH ox 0.399 0.315 0.633 1e-133
>gi|328705704|ref|XP_003242881.1| PREDICTED: NADPH oxidase 5-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  563 bits (1450), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 263/370 (71%), Positives = 305/370 (82%), Gaps = 23/370 (6%)

Query: 120 CLPRSGFDKGNLEWLEQLFRQTVGDEKEICRDDFKKILITKN------------------ 161
           C  +SGFD  NL WLEQLFRQTVGDE EI RDDF KILITKN                  
Sbjct: 224 CRVKSGFDSENLMWLEQLFRQTVGDEMEIKRDDFNKILITKNPFFTERVFQIFDKDNSGS 283

Query: 162 ----EFIDAMHQFAGQSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEE 217
               EF+DAMHQFAGQ+PDDKI+FLF+VYDLDGDGLIQH+ELQHVMRACMEENGMQFSE+
Sbjct: 284 ISLHEFLDAMHQFAGQTPDDKIRFLFKVYDLDGDGLIQHRELQHVMRACMEENGMQFSED 343

Query: 218 QIDHLTMALFEDADSENRGAITYESLKNQLEKHGGLLENLSISIDRWLVPPKPKKLANQS 277
           Q++ LTMALFEDADSE+RGAITYE+LKNQL+KH GLLENLSISIDRWLVPPKPK+    S
Sbjct: 344 QVEDLTMALFEDADSESRGAITYEALKNQLQKHNGLLENLSISIDRWLVPPKPKQ-PPAS 402

Query: 278 RLSQLIALRPYQLTLPYIKNNYVYLGFMFFYLLVNIVLFTSRMYVFRKSNYYVIFARACG 337
              ++ ALRPYQLTLPY++NNYVYL F+  Y+LVN++LF +R+Y +R SN Y I ARACG
Sbjct: 403 VWGKITALRPYQLTLPYMRNNYVYLMFLAVYVLVNVLLFGTRIYQYRNSNIYTILARACG 462

Query: 338 QCLNFNCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYFHKMTGFFIFGYSVLHTIMHLL 397
           QCLNFNC FVLVLMLRHCITFLRTRGFS+FLPLDQHIYFHK+TGFFIFGYS+LHT MHLL
Sbjct: 463 QCLNFNCTFVLVLMLRHCITFLRTRGFSLFLPLDQHIYFHKITGFFIFGYSILHTFMHLL 522

Query: 398 NFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPTGVCLIIILTIMFICSQTFV 457
           NFS  ++ D  +N +G +++EWLFT+ PGLFGLI+G+ANPTGV LI+IL +MFICSQ FV
Sbjct: 523 NFSTVIIYDPNLNYEGFTVSEWLFTTDPGLFGLISGFANPTGVLLIVILFVMFICSQPFV 582

Query: 458 RKSGSFELLF 467
           R+ G FE+ +
Sbjct: 583 RRGGCFEIFY 592

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189239162|ref|XP_972375.2| PREDICTED: similar to AGAP008072-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270010804|gb|EFA07252.1| hypothetical protein TcasGA2_TC013283 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242015786|ref|XP_002428528.1| NADPH oxidase, putative [Pediculus humanus corporis] gi|212513162|gb|EEB15790.1| NADPH oxidase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|151427580|tpd|FAA00347.1| TPA: predicted NADPH oxidase [Anopheles gambiae] Back     alignment and taxonomy information
>gi|158297105|ref|XP_317385.4| AGAP008072-PA [Anopheles gambiae str. PEST] gi|157015035|gb|EAA12239.5| AGAP008072-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|380028229|ref|XP_003697810.1| PREDICTED: LOW QUALITY PROTEIN: NADPH oxidase 5-like [Apis florea] Back     alignment and taxonomy information
>gi|328781962|ref|XP_391999.3| PREDICTED: NADPH oxidase 5 [Apis mellifera] Back     alignment and taxonomy information
>gi|345485658|ref|XP_003425313.1| PREDICTED: LOW QUALITY PROTEIN: NADPH oxidase 5-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383857984|ref|XP_003704483.1| PREDICTED: LOW QUALITY PROTEIN: NADPH oxidase 5-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query864
FB|FBgn0085428 1340 Nox "NADPH oxidase" [Drosophil 0.495 0.319 0.496 1.7e-109
UNIPROTKB|Q96PH1765 NOX5 "NADPH oxidase 5" [Homo s 0.304 0.343 0.395 5.2e-57
UNIPROTKB|A7E3L4755 Nox5 "Uncharacterized protein" 0.304 0.348 0.384 1.4e-56
UNIPROTKB|F1SIU1712 F1SIU1 "Uncharacterized protei 0.304 0.369 0.377 2.4e-55
UNIPROTKB|F1PQ38765 NOX5 "Uncharacterized protein" 0.337 0.381 0.357 3.6e-48
UNIPROTKB|F1NC63760 NOX5 "Uncharacterized protein" 0.298 0.339 0.364 1.1e-34
UNIPROTKB|I3LRC9662 I3LRC9 "Uncharacterized protei 0.325 0.424 0.324 4.1e-34
FB|FBgn00314641537 Duox "Dual oxidase" [Drosophil 0.229 0.128 0.278 2.4e-18
UNIPROTKB|Q7Q1471475 DUOX "AGAP009978-PA" [Anophele 0.189 0.111 0.284 4.2e-17
UNIPROTKB|I3LHU2206 I3LHU2 "Uncharacterized protei 0.120 0.504 0.394 4.6e-17
FB|FBgn0085428 Nox "NADPH oxidase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1058 (377.5 bits), Expect = 1.7e-109, Sum P(2) = 1.7e-109
 Identities = 223/449 (49%), Positives = 292/449 (65%)

Query:    22 EWLEQLFRQTVGDEKEICRDDFKKILITKNISDLYDKVHSFVWYS-SQYGHFTPCYVHTN 80
             E +E +     G+ K +   +F+ I  T+ I    DK++  +    S            +
Sbjct:   258 EQIESVAYVICGENKRVSFKNFRDIWHTRGI---LDKLYRLIELDGSNLVSTNQVMEFIS 314

Query:    81 GFYRPSPRSGFDKGNLEWLEQLFRQTVAYTS--LRIHHNLVCLPRSGFDKGNLEWLEQLF 138
                   PR+GFDK +L  LEQLFR TV       R     +   ++ F      + E++F
Sbjct:   315 HLTNSRPRTGFDKSSLARLEQLFRTTVGNEQEIRREEFQKIVTSKNPF------FTERVF 368

Query:   139 RQTVGDEKEICRDDFKKILITKNEFIDAMHQFAGQSPDDKIKFLFRVYDLDGDGLIQHKE 198
             +  + D     +D+   I +   EFIDA+HQF+GQS DDKI+FLF+VYD+DGDGLIQHKE
Sbjct:   369 Q--IFD-----KDNSGSISL--QEFIDAIHQFSGQSADDKIRFLFKVYDIDGDGLIQHKE 419

Query:   199 LQHVMRACMEENGMQFSEEQIDHLTMALFEDADSENRGAITYESLKNQLEKHGGLLENLS 258
             L  V+R C++ENGM+FSE+QI+ LT A+FEDAD  N G ITYE+LKNQL KHGGLLENLS
Sbjct:   420 LHDVIRHCIKENGMEFSEDQIEDLTSAMFEDADPHNSGEITYEALKNQLHKHGGLLENLS 479

Query:   259 ISIDRWLVPPKPKKLANQSRLSQLIALRPYQLTLPYIKNNYVYLGFMFFYLLVNIVLFTS 318
             I+IDRWLVP    + A  +  S      P+Q +L Y+KNN V++ ++FFY+ VN+ LF S
Sbjct:   480 ITIDRWLVPIAEDRQAGGAAKSGFWNSLPHQFSLAYMKNNQVFVTYLFFYITVNLCLFIS 539

Query:   319 RMYVFRKSNYYVIFARACGQCLNFNCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYFHK 378
             R   +R SN +VI ARACGQCLNFNC +VLVLMLRH +T+LR RG S +LPLD H+Y HK
Sbjct:   540 RAIQYRASNGFVIIARACGQCLNFNCAWVLVLMLRHSLTYLRGRGLSSYLPLDHHVYLHK 599

Query:   379 MTGFFIFGYSVLHTIMHLLNFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPT 438
             +TG  I   S++HTIMHL NFS+ V+ D  IN    ++ EWL T RPGLFGLI G ANPT
Sbjct:   600 LTGITISVLSLIHTIMHLFNFSIIVINDPNINAGHYTIGEWLLTDRPGLFGLIPGCANPT 659

Query:   439 GVCLIIILTIMFICSQTFVRKSGSFELLF 467
             GV L+ IL +MF+CSQ FVR+ GSFE+ +
Sbjct:   660 GVALLAILVVMFVCSQPFVRRKGSFEVFY 688
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
UNIPROTKB|Q96PH1 NOX5 "NADPH oxidase 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A7E3L4 Nox5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIU1 F1SIU1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQ38 NOX5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NC63 NOX5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LRC9 I3LRC9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0031464 Duox "Dual oxidase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Q147 DUOX "AGAP009978-PA" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|I3LHU2 I3LHU2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.11.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query864
pfam01794122 pfam01794, Ferric_reduct, Ferric reductase like tr 2e-11
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 1e-09
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 1e-08
pfam1273863 pfam12738, PTCB-BRCT, twin BRCT domain 1e-07
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 4e-07
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 4e-06
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 3e-04
PTZ00183158 PTZ00183, PTZ00183, centrin; Provisional 0.001
pfam0003629 pfam00036, efhand, EF hand 0.001
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 0.002
pfam1320225 pfam13202, EF_hand_3, EF hand 0.002
pfam0053377 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain 0.004
>gnl|CDD|216705 pfam01794, Ferric_reduct, Ferric reductase like transmembrane component Back     alignment and domain information 
 Score = 61.5 bits (150), Expect = 2e-11
 Identities = 25/123 (20%), Positives = 46/123 (37%), Gaps = 24/123 (19%)

Query: 343 NCMFVLVLMLRHCITFLRTRGFSVFLPLDQHIYFHKMTGFFIFGYSVLHTIMHLLNFSLN 402
               +L+L LR+      T      L LD+ + FH+  G   F  ++LH I++L+ +   
Sbjct: 8   LLPLLLLLALRNNPLEWLTG-----LSLDRLLLFHRWLGRLAFLLALLHVILYLVLW--- 59

Query: 403 VLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPTGVCLIIILTIMFICSQTFVRKSGS 462
                                   L   +       GV  +++L ++ I S   +R+   
Sbjct: 60  ----------------LRLGGILLLLEKLKRPYILLGVIALVLLLLLAITSLPPLRRRLG 103

Query: 463 FEL 465
           +EL
Sbjct: 104 YEL 106

This family includes a common region in the transmembrane proteins mammalian cytochrome B-245 heavy chain (gp91-phox), ferric reductase transmembrane component in yeast and respiratory burst oxidase from mouse-ear cress. This may be a family of flavocytochromes capable of moving electrons across the plasma membrane. The Frp1 protein from S. pombe is a ferric reductase component and is required for cell surface ferric reductase activity, mutants in frp1 are deficient in ferric iron uptake. Cytochrome B-245 heavy chain is a FAD-dependent dehydrogenase it is also has electron transferase activity which reduces molecular oxygen to superoxide anion, a precursor in the production of microbicidal oxidants. Mutations in the sequence of cytochrome B-245 heavy chain (gp91-phox) lead to the X-linked chronic granulomatous disease. The bacteriocidal ability of phagocytic cells is reduced and is characterized by the absence of a functional plasma membrane associated NADPH oxidase. The chronic granulomatous disease gene codes for the beta chain of cytochrome B-245 and cytochrome B-245 is missing from patients with the disease. Length = 122
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|193214 pfam12738, PTCB-BRCT, twin BRCT domain Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information
>gnl|CDD|205383 pfam13202, EF_hand_3, EF hand Back     alignment and domain information
>gnl|CDD|215978 pfam00533, BRCT, BRCA1 C Terminus (BRCT) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 864
KOG0039|consensus646 100.0
PLN02844722 oxidoreductase/ferric-chelate reductase 99.89
PLN02631699 ferric-chelate reductase 99.88
PLN02292702 ferric-chelate reductase 99.86
KOG0034|consensus187 99.7
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.68
KOG0044|consensus193 99.67
KOG0027|consensus151 99.57
KOG0028|consensus172 99.48
PTZ00183158 centrin; Provisional 99.42
PF01794125 Ferric_reduct: Ferric reductase like transmembrane 99.33
KOG0037|consensus221 99.32
PTZ00184149 calmodulin; Provisional 99.29
KOG0031|consensus171 99.29
KOG0038|consensus189 99.29
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.1
KOG0036|consensus463 99.0
KOG0030|consensus152 98.94
PF1273863 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2W 98.93
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.91
PTZ00183158 centrin; Provisional 98.85
KOG0027|consensus151 98.84
PTZ00184149 calmodulin; Provisional 98.8
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.78
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.76
PLN02964644 phosphatidylserine decarboxylase 98.76
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.64
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.59
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.58
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.57
KOG4223|consensus325 98.5
KOG0377|consensus631 98.5
KOG0028|consensus172 98.48
cd0005267 EH Eps15 homology domain; found in proteins implic 98.47
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.43
KOG0037|consensus221 98.43
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.43
KOG0034|consensus187 98.4
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.36
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.33
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.31
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.29
KOG1929|consensus811 98.26
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.23
KOG2643|consensus489 98.15
KOG0044|consensus193 98.15
PLN02964644 phosphatidylserine decarboxylase 98.11
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.07
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.02
PF1465866 EF-hand_9: EF-hand domain 98.0
PF0053378 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IP 97.99
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 97.92
cd0002772 BRCT Breast Cancer Suppressor Protein (BRCA1), car 97.84
KOG0041|consensus244 97.83
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 97.76
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.74
KOG4223|consensus325 97.64
KOG0031|consensus171 97.62
cd0005267 EH Eps15 homology domain; found in proteins implic 97.61
KOG4251|consensus362 97.6
cd0021388 S-100 S-100: S-100 domain, which represents the la 97.57
KOG0036|consensus463 97.55
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 97.54
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 97.54
smart0029280 BRCT breast cancer carboxy-terminal domain. 97.53
KOG3226|consensus508 97.51
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.51
KOG4666|consensus412 97.5
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.5
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 97.49
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 97.45
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.42
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 97.41
KOG2562|consensus493 97.4
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.39
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.39
KOG0030|consensus152 97.36
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.3
KOG4065|consensus144 97.25
KOG0377|consensus631 97.23
KOG2643|consensus489 97.22
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.16
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.14
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 96.99
KOG0041|consensus244 96.95
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.93
KOG1929|consensus 811 96.66
PRK05419205 putative sulfite oxidase subunit YedZ; Reviewed 96.59
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 96.56
KOG4251|consensus362 96.54
KOG0751|consensus694 96.46
KOG0033|consensus355 96.34
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 96.19
PLN03122 815 Poly [ADP-ribose] polymerase; Provisional 96.15
KOG0040|consensus2399 96.13
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.08
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 96.05
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 95.94
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 95.78
KOG0046|consensus627 95.74
KOG0040|consensus2399 95.56
COG4097438 Predicted ferric reductase [Inorganic ion transpor 95.45
KOG0039|consensus646 95.41
KOG0751|consensus694 95.07
PLN03123 981 poly [ADP-ribose] polymerase; Provisional 95.01
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 94.65
KOG2562|consensus493 94.46
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 94.42
PF1465866 EF-hand_9: EF-hand domain 94.27
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 94.17
KOG0038|consensus189 94.16
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 93.97
COG2717209 Predicted membrane protein [Function unknown] 93.87
KOG1029|consensus 1118 93.68
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 93.11
KOG4578|consensus421 92.93
KOG2043|consensus896 92.56
KOG0032|consensus382 92.47
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 91.88
PF08022105 FAD_binding_8: FAD-binding domain; InterPro: IPR01 91.64
PF0906990 EF-hand_3: EF-hand; InterPro: IPR015154 Like other 90.55
KOG0046|consensus627 90.26
KOG0169|consensus746 90.07
KOG3548|consensus1176 89.85
KOG3866|consensus442 88.99
KOG3555|consensus434 88.31
KOG2243|consensus 5019 87.37
KOG4666|consensus412 86.78
KOG1955|consensus737 85.66
KOG0607|consensus463 85.22
PLN02952599 phosphoinositide phospholipase C 83.0
KOG0042|consensus680 81.71
KOG0615|consensus475 80.98
KOG4065|consensus144 80.33
KOG0604|consensus400 80.32
>KOG0039|consensus Back     alignment and domain information 
Probab=100.00  E-value=4e-40  Score=391.56  Aligned_cols=395  Identities=24%  Similarity=0.340  Sum_probs=312.1

Q ss_pred             CCcccHHHHHHHHHhHHHHHHHHHHhcCCCChHHHHHHhhhhcCCCCCccCHHHHHHHHHHHHHhcCCCCCHHHHHHHHH
Q psy8382         145 EKEICRDDFKKILITKNEFIDAMHQFAGQSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQIDHLTM  224 (864)
Q Consensus       145 dG~I~~eEF~~~l~~~~EFl~~l~~~~~~~~eekL~~aFk~fD~dgdG~Is~eELr~vL~~l~~~~g~~ls~e~i~~iv~  224 (864)
                      +| |+++||.               +.+.+.|++++..|+++|. ++|.++.+|+..++...+.........+...++..
T Consensus         2 ~~-~~~~~~~---------------~~~~~~d~~l~~~f~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   64 (646)
T KOG0039|consen    2 EG-ISFQELK---------------ITDCSYDDKLQTFFDMYDK-GDGKLTEEEVRELIMSSISANWLSLIKKQTEEYAA   64 (646)
T ss_pred             CC-cchhhhc---------------ccCCChhHHHHHHHHHHhh-hcCCccHHHHHHHHHHHHHhhhhhhhhhhhhHHHH
Confidence            56 8888854               4467889999999999998 99999999999999987665554445666777777


Q ss_pred             HHHHHhcCCCCcceeHHHHHHHHHhccchHHHHHhhhhccccCCCCCCcchhhhHHHhhhccccccchhhhhhcccchhh
Q psy8382         225 ALFEDADSENRGAITYESLKNQLEKHGGLLENLSISIDRWLVPPKPKKLANQSRLSQLIALRPYQLTLPYIKNNYVYLGF  304 (864)
Q Consensus       225 ~if~~~D~d~dG~IsfeEF~~~l~~~p~ll~~l~~~~~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~n~~~~~~~  304 (864)
                      .++.+.|.++.|.+.++++..++...+........... ++.....+..+.. .  ....++.+.+...|+.+++.+.++
T Consensus        65 ~~~~~~~~~~~~y~~~~~~~~ll~~~~~~~~~~~~~~~-~~~~~~~~~~~~~-~--~~~~~~~~~~~~~~~~~~~~~~~~  140 (646)
T KOG0039|consen   65 LIMEELDPDHKGYITNEDLEILLLQIPTLLFAILLSFA-NLSLLLSQPLKPT-R--RKPLLRNLVRMGAFLPNLWLRVWV  140 (646)
T ss_pred             HhhhhccccccceeeecchhHHHHhchHHHHHHHHHHH-HHHhhhccccccc-c--ccccchheeeeeeeeccceEeeee
Confidence            89999999999999999999999998877666555543 1111111110000 0  000123345557889999999999


Q ss_pred             HHHHHHHHHHhhhhhhhhccccc------eeehhhhcccccccchhhHHHHHHHHHHHHhhh-hcCCcceeeCCchhhHH
Q psy8382         305 MFFYLLVNIVLFTSRMYVFRKSN------YYVIFARACGQCLNFNCMFVLVLMLRHCITFLR-TRGFSVFLPLDQHIYFH  377 (864)
Q Consensus       305 l~l~l~~~i~lf~~~~~~y~~~~------~~~~iaRg~g~~l~~n~alillpv~Rn~it~LR-~t~l~~~ipfD~~i~fH  377 (864)
                      +++|+++++++|.|+++.|....      ..+.+++++|.++++||+++++||||+.+++|| .+++..++|+|+++.||
T Consensus       141 ~~~~l~~~~~lf~~~~~~y~~~~~~~~~g~~~~~~~~~~~~l~~~~~~ill~~~R~~~~~L~~~~fl~~~~p~~~n~~fh  220 (646)
T KOG0039|consen  141 LFLWLGLNVGLFTWRFLQYVYLGTRHILGLCLALARGSAETLNFNMALILLPVCRNRLTFLRCSTFLFSYLPFDRNLNFH  220 (646)
T ss_pred             ehHHHHHHHHHHHHHHHHHHhhhhhhhhhheeeeeccccccchhhHHHHHHHHHHHHHHHHHHhhhhheEeeccccchHH
Confidence            99999999999999999998876      456789999999999999999999999999999 88888999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHhhhcccccccCCccccCCcceeeeccccCCcccccccccccchhHHHHHHHHHHHHhccccc
Q psy8382         378 KMTGFFIFGYSVLHTIMHLLNFSLNVLGDGTINKKGLSLTEWLFTSRPGLFGLINGWANPTGVCLIIILTIMFICSQTFV  457 (864)
Q Consensus       378 k~ig~~i~~~~~lH~iah~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~g~~~~TG~~~~l~l~lm~~~S~~~v  457 (864)
                      +++|+.+..+..+|+.+|.+++..........  .........+. .+...+++.++.++||++++++|++|+++|++++
T Consensus       221 ~l~g~~~~~~~~~H~w~~~~~~~~~~ih~~~~--~~~~~~~~~~~-~~~~~~~~~~~~~~tGv~~~i~~~im~v~s~~~f  297 (646)
T KOG0039|consen  221 KLVALTIAVFILLHIWLHLVNFFPFLVHGLEY--TISLASELFFL-PKTYKWLLLGVVGLTGVILLILMLIMFVLSLPFF  297 (646)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHH--HHHHHHHhccc-chhhhhhhcCCCcchhHHHHHHHHHHHHHhhHHH
Confidence            99999999999999999998876544442100  00000000001 2223456667778899999999999999999999


Q ss_pred             cccccchhhHHHHHHHHHHHHhhhhcCC-----CceEEEEeccccccccchhhcccCCCcceehhhhhhhhhhhhcCCce
Q psy8382         458 RKSGSFELLFLGGFNVTLQGFWRVMQPD-----DSVTHVVLGAFTPTFHKLYACLSSKPHVVTVEWLKQTKLSQLLGAGY  532 (864)
Q Consensus       458 RR~~~Fe~F~~tH~l~ivhg~~~~L~pp-----~~~~~ll~p~~l~~~drl~r~v~S~s~v~~~er~~l~~li~lLGa~~  532 (864)
                      ||+ +||+||||||+++++.++..+|-.     ..|+|+++|+++|++||+.|++++..++....       +.++|+++
T Consensus       298 RR~-~~e~F~ytH~l~~v~~illi~hg~~~~~~~~w~~~~~p~~ly~~dR~~r~~r~~~~~~i~~-------~~llp~~v  369 (646)
T KOG0039|consen  298 RRR-FYEAFWYTHHLYIVFYILLIIHGGFRLLGTTWMYIAVPVLLYILDRILRFLRSQKNVKIAK-------VVLLPSDV  369 (646)
T ss_pred             HHH-HHHHHHHHHHHHHHHHHHHHHHhcccccccchhHHHHHHHHHHHHHHHHHHHHhcCceEEE-------EEEcCCCe
Confidence            998 999999999999875555555433     57788888899999999999988765555544       78999999


Q ss_pred             eEeeeccC-CCCCCCCCceEEEecCCChhhhhHhhhcCCc
Q psy8382         533 QEEFMKRD-NPKNNKKASTHLVCPTCSGSKYNAALKWGFP  571 (864)
Q Consensus       533 ~e~~~rK~-~~k~~~gq~thLvcp~~sg~Kw~~A~~w~ip  571 (864)
                      .++.++|+ .+++.+|||.|++||.++.+|||+..=-..|
T Consensus       370 i~L~~~Kp~~f~y~~Gqyifv~~p~ls~~qwHPFTItSsp  409 (646)
T KOG0039|consen  370 LELIMSKPPGFKYKPGQYIFVNCPSLSKLEWHPFTITSAP  409 (646)
T ss_pred             EEEEEeCCCCCCCCCCCEEEEECccccccccCCceeecCC
Confidence            99999996 6789999999999999999999999755555

>PLN02844 oxidoreductase/ferric-chelate reductase Back     alignment and domain information
>PLN02631 ferric-chelate reductase Back     alignment and domain information
>PLN02292 ferric-chelate reductase Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PF01794 Ferric_reduct: Ferric reductase like transmembrane component; InterPro: IPR013130 This family includes a common region in the transmembrane proteins mammalian cytochrome b-245 heavy chain (gp91-phox), ferric reductase transmembrane component in yeast and respiratory burst oxidase from Arabidopsis thaliana Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>PF12738 PTCB-BRCT: twin BRCT domain; PDB: 3PA6_A 3KTF_C 2WT8_C 3EF1_A 3EF0_A Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG1929|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF00533 BRCT: BRCA1 C Terminus (BRCT) domain; InterPro: IPR001357 The BRCT domain (after the C_terminal domain of a breast cancer susceptibility protein) is found predominantly in proteins involved in cell cycle checkpoint functions responsive to DNA damage [], for example as found in the breast cancer DNA-repair protein BRCA1 Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd00027 BRCT Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>smart00292 BRCT breast cancer carboxy-terminal domain Back     alignment and domain information
>KOG3226|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG1929|consensus Back     alignment and domain information
>PRK05419 putative sulfite oxidase subunit YedZ; Reviewed Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PLN03122 Poly [ADP-ribose] polymerase; Provisional Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0039|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>PLN03123 poly [ADP-ribose] polymerase; Provisional Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>COG2717 Predicted membrane protein [Function unknown] Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>KOG2043|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF08022 FAD_binding_8: FAD-binding domain; InterPro: IPR013112 This FAD binding domain is associated with ferric reductase NAD binding proteins and the heavy chain of Cytochrome b-245 Back     alignment and domain information
>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>KOG3548|consensus Back     alignment and domain information
>KOG3866|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query864
1uhn_A189 The Crystal Structure Of The Calcium Binding Protei 6e-11
2zfd_A226 The Crystal Structure Of Plant Specific Calcium Bin 8e-10
2ehb_A207 The Structure Of The C-Terminal Domain Of The Prote 6e-08
1v1f_A222 Structure Of The Arabidopsis Thaliana Sos3 Complexe 8e-08
2bec_A202 Crystal Structure Of Chp2 In Complex With Its Bindi 3e-06
2ggz_A211 Crystal Structure Of Human Guanylate Cyclase Activa 3e-06
2p6b_B156 Crystal Structure Of Human Calcineurin In Complex W 2e-05
3ll8_B155 Crystal Structure Of Calcineurin In Complex With Ak 2e-05
1mf8_B170 Crystal Structure Of Human Calcineurin Complexed Wi 2e-05
1tco_B169 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-05
3a8r_A179 The Structure Of The N-Terminal Regulatory Domain O 3e-05
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 5e-05
2ct9_A208 The Crystal Structure Of Calcineurin B Homologous P 7e-05
1ggz_A148 Crystal Structure Of The Calmodulin-Like Protein (H 9e-05
2e30_A195 Solution Structure Of The Cytoplasmic Region Of Na+ 1e-04
1tcf_A159 Crystal Structure Of Calcium-Saturated Rabbit Skele 1e-04
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 1e-04
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 1e-04
2d8m_A129 Solution Structure Of The First Brct Domain Of Dna- 3e-04
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 3e-04
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 3e-04
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 3e-04
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 3e-04
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 3e-04
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 3e-04
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 4e-04
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 4e-04
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 4e-04
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 4e-04
2ygg_B150 Complex Of Cambr And Cam Length = 150 4e-04
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 4e-04
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 4e-04
5tnc_A162 Refined Crystal Structure Of Troponin C From Turkey 4e-04
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 4e-04
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 4e-04
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 4e-04
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 4e-04
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 4e-04
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 4e-04
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 4e-04
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 4e-04
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 4e-04
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 4e-04
1f71_A67 Refined Solution Structure Of Calmodulin C-Terminal 5e-04
1zot_B69 Crystal Structure Analysis Of The CyaaC-Cam With Pm 5e-04
2col_B67 Crystal Structure Analysis Of CyaaC-Cam With Pyroph 5e-04
1ytz_C162 Crystal Structure Of Skeletal Muscle Troponin In Th 6e-04
1fw4_A71 Crystal Structure Of E. Coli Fragment Tr2c From Cal 6e-04
1a2x_A159 Complex Of Troponin C With A 47 Residue (1-47) Frag 6e-04
2w49_0159 Isometrically Contracting Insect Asynchronous Fligh 6e-04
1cmf_A73 Nmr Solution Structure Of Apo Calmodulin Carboxy-Te 6e-04
4tnc_A162 Refined Structure Of Chicken Skeletal Muscle Tropon 6e-04
1yru_B74 Crystal Structure Analysis Of The Adenylyl Cyclaes 6e-04
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 7e-04
1up5_B148 Chicken Calmodulin Length = 148 7e-04
2r2i_A198 Myristoylated Guanylate Cyclase Activating Protein- 7e-04
2vb6_B149 Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigo 8e-04
1clm_A148 Structure Of Paramecium Tetraurelia Calmodulin At 1 8e-04
1exr_A148 The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Ca 8e-04
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 8e-04
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 8e-04
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 9e-04
>pdb|1UHN|A Chain A, The Crystal Structure Of The Calcium Binding Protein Atcbl2 From Arabidopsis Thaliana Length = 189 Back     alignment and structure 
Iteration: 1

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 60/99 (60%), Gaps = 1/99 (1%)
Query: 162 EFIDAMHQFAGQSP-DDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQID 220
           EF  A+  F   +P DDKI F F++YDL   G I+ +E++ ++ A + E+GM   +  I+
Sbjct: 75  EFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIE 134
Query: 221 HLTMALFEDADSENRGAITYESLKNQLEKHGGLLENLSI 259
            +    FE+AD+++ G I  E  ++ + +H  LL+N+++
Sbjct: 135 DIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTL 173
>pdb|2ZFD|A Chain A, The Crystal Structure Of Plant Specific Calcium Binding Protein Atcbl2 In Complex With The Regulatory Domain Of Atcipk14 Length = 226 Back     alignment and structure
>pdb|2EHB|A Chain A, The Structure Of The C-Terminal Domain Of The Protein Kinase Atsos2 Bound To The Calcium Sensor Atsos3 Length = 207 Back     alignment and structure
>pdb|1V1F|A Chain A, Structure Of The Arabidopsis Thaliana Sos3 Complexed With Calcium(Ii) And Manganese(Ii) Ions Length = 222 Back     alignment and structure
>pdb|2BEC|A Chain A, Crystal Structure Of Chp2 In Complex With Its Binding Region In Nhe1 And Insights Into The Mechanism Of Ph Regulation Length = 202 Back     alignment and structure
>pdb|2GGZ|A Chain A, Crystal Structure Of Human Guanylate Cyclase Activating Protein-3 Length = 211 Back     alignment and structure
>pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 Back     alignment and structure
>pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 Back     alignment and structure
>pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 Back     alignment and structure
>pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 Back     alignment and structure
>pdb|3A8R|A Chain A, The Structure Of The N-Terminal Regulatory Domain Of A Plant Nadph Oxidase Length = 179 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|2CT9|A Chain A, The Crystal Structure Of Calcineurin B Homologous Proein 1 (Chp1) Length = 208 Back     alignment and structure
>pdb|1GGZ|A Chain A, Crystal Structure Of The Calmodulin-Like Protein (Hclp) From Human Epithelial Cells Length = 148 Back     alignment and structure
>pdb|2E30|A Chain A, Solution Structure Of The Cytoplasmic Region Of Na+H+ Exchanger 1 Complexed With Essential Cofactor Calcineurin B Homologous Protein 1 Length = 195 Back     alignment and structure
>pdb|1TCF|A Chain A, Crystal Structure Of Calcium-Saturated Rabbit Skeletal Troponin C Length = 159 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|2D8M|A Chain A, Solution Structure Of The First Brct Domain Of Dna-Repair Protein Xrcc1 Length = 129 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|5TNC|A Chain A, Refined Crystal Structure Of Troponin C From Turkey Skeletal Muscle At 2.0 Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|1F71|A Chain A, Refined Solution Structure Of Calmodulin C-Terminal Domain Length = 67 Back     alignment and structure
>pdb|1ZOT|B Chain B, Crystal Structure Analysis Of The CyaaC-Cam With Pmeapp Length = 69 Back     alignment and structure
>pdb|2COL|B Chain B, Crystal Structure Analysis Of CyaaC-Cam With Pyrophosphate Length = 67 Back     alignment and structure
>pdb|1YTZ|C Chain C, Crystal Structure Of Skeletal Muscle Troponin In The Ca2+- Activated State Length = 162 Back     alignment and structure
>pdb|1FW4|A Chain A, Crystal Structure Of E. Coli Fragment Tr2c From Calmodulin To 1.7 A Resolution Length = 71 Back     alignment and structure
>pdb|1A2X|A Chain A, Complex Of Troponin C With A 47 Residue (1-47) Fragment Of Troponin I Length = 159 Back     alignment and structure
>pdb|2W49|0 Chain 0, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 159 Back     alignment and structure
>pdb|1CMF|A Chain A, Nmr Solution Structure Of Apo Calmodulin Carboxy-Terminal Domain Length = 73 Back     alignment and structure
>pdb|4TNC|A Chain A, Refined Structure Of Chicken Skeletal Muscle Troponin C In The Two-Calcium State At 2-Angstroms Resolution Length = 162 Back     alignment and structure
>pdb|1YRU|B Chain B, Crystal Structure Analysis Of The Adenylyl Cyclaes Catalytic Domain Of Adenylyl Cyclase Toxin Of Bordetella Pertussis In Presence Of C-Terminal Calmodulin And 1mm Calcium Chloride Length = 74 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|2R2I|A Chain A, Myristoylated Guanylate Cyclase Activating Protein-1 With Calcium Bound Length = 198 Back     alignment and structure
>pdb|2VB6|B Chain B, Myosin Vi (Md-Insert2-Cam, Delta Insert1) Post-Rigor State ( Crystal Form 2) Length = 149 Back     alignment and structure
>pdb|1CLM|A Chain A, Structure Of Paramecium Tetraurelia Calmodulin At 1.8 Angstroms Resolution Length = 148 Back     alignment and structure
>pdb|1EXR|A Chain A, The 1.0 Angstrom Crystal Structure Of Ca+2 Bound Calmodulin Length = 148 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query864
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 5e-33
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 8e-29
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 6e-28
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 3e-27
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 8e-26
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 2e-25
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 3e-25
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 4e-25
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 6e-25
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 3e-24
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 2e-23
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 8e-04
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 4e-23
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 7e-23
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 8e-23
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 1e-22
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 2e-22
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 2e-21
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 3e-20
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 2e-18
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 5e-18
2d8m_A129 DNA-repair protein XRCC1; parallel beta-sheet, DNA 2e-16
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 2e-13
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 8e-11
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 7e-06
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 3e-04
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 7e-13
3a4u_B143 Multiple coagulation factor deficiency protein 2; 1e-12
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 4e-12
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 7e-07
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 9e-05
3pa6_A107 Microcephalin; BRCT domain, cell cycle; HET: MSE; 4e-12
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 6e-12
3fwb_A161 Cell division control protein 31; gene gating, com 9e-12
3fwb_A161 Cell division control protein 31; gene gating, com 2e-06
3fwb_A161 Cell division control protein 31; gene gating, com 2e-04
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 1e-11
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-11
3akb_A166 Putative calcium binding protein; EF-hand, metal b 6e-09
3akb_A166 Putative calcium binding protein; EF-hand, metal b 9e-06
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-11
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 1e-06
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 1e-04
3l3e_A107 DNA topoisomerase 2-binding protein 1; BRCT domain 2e-11
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-11
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-04
1exr_A148 Calmodulin; high resolution, disorder, metal trans 2e-11
1exr_A148 Calmodulin; high resolution, disorder, metal trans 3e-06
1exr_A148 Calmodulin; high resolution, disorder, metal trans 7e-04
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 2e-11
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 2e-11
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 3e-04
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 3e-11
3l46_A112 Protein ECT2; alternative splicing, guanine-nucleo 3e-11
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 3e-11
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 4e-11
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 1e-06
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 4e-04
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 7e-04
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 4e-11
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 2e-06
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 2e-05
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 7e-11
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 1e-07
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 3e-04
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 7e-11
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 2e-06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 8e-04
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 7e-11
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 4e-04
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 7e-11
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 8e-11
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 7e-07
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 3e-04
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 9e-11
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 5e-07
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 1e-10
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 1e-06
2jnf_A158 Troponin C; stretch activated muscle contraction, 1e-10
2jnf_A158 Troponin C; stretch activated muscle contraction, 1e-05
2jnf_A158 Troponin C; stretch activated muscle contraction, 2e-04
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 1e-10
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 1e-06
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 1e-04
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 1e-10
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 2e-10
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 6e-05
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 2e-10
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 1e-05
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 2e-10
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 8e-04
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 2e-10
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 2e-10
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 6e-04
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 2e-10
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 1e-06
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 3e-04
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-10
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 3e-09
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 4e-06
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 4e-05
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 4e-04
3olc_X298 DNA topoisomerase 2-binding protein 1; BRCT domain 3e-10
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-10
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-07
2hps_A186 Coelenterazine-binding protein with bound coelent; 3e-04
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 3e-10
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 4e-04
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 3e-10
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 2e-05
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 7e-05
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 4e-10
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 8e-04
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 4e-10
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 4e-10
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 3e-06
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 1e-05
2cou_A109 ECT2 protein; BRCT domain, RHO GTPase, structural 4e-10
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 5e-10
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 6e-06
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-04
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 5e-10
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 2e-04
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 6e-10
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-06
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 6e-10
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 3e-06
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 6e-10
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 5e-07
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 7e-07
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 7e-10
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 1e-05
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 4e-05
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 9e-10
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 1e-09
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 1e-09
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 5e-05
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 1e-09
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 1e-09
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 6e-06
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 1e-09
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 4e-04
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 2e-09
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 3e-09
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 2e-06
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 3e-09
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 5e-07
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 4e-09
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 3e-04
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 4e-09
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-08
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-05
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 4e-09
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 1e-05
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 4e-05
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 4e-09
3li6_A66 Calcium-binding protein; calcium signaling protein 1e-08
3li6_A66 Calcium-binding protein; calcium signaling protein 5e-08
1y1x_A191 Leishmania major homolog of programmed cell death 1e-08
1y1x_A191 Leishmania major homolog of programmed cell death 6e-07
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 1e-08
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 9e-05
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 2e-08
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 8e-04
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 2e-08
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 3e-08
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 3e-06
1avs_A90 Troponin C; muscle contraction, calcium-activated, 4e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 4e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-06
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 5e-08
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 5e-08
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-04
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 6e-08
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 1e-07
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-07
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 8e-08
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 2e-07
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 6e-07
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 8e-07
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 1e-06
1wf6_A132 Similar to S.pombe -RAD4+/CUT5+product (A40727); B 2e-06
1wf6_A132 Similar to S.pombe -RAD4+/CUT5+product (A40727); B 1e-04
3l41_A220 BRCT-containing protein 1; BRC1, BRCT domain, tand 2e-06
2nte_A210 BARD-1, BRCA1-associated ring domain protein 1; BR 2e-06
2ebw_A97 DNA repair protein REV1; A/B/A 3 layers, parallel 2e-06
3al2_A235 DNA topoisomerase 2-binding protein 1; BRCT domain 4e-06
3sqd_A219 PAX-interacting protein 1; tandem BRCT domains, ce 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 6e-06
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 6e-05
3lij_A494 Calcium/calmodulin dependent protein kinase with A 6e-06
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-04
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 9e-06
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 7e-05
1t15_A214 Breast cancer type 1 susceptibility protein; prote 2e-05
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 2e-05
1kzy_C259 Tumor suppressor P53-binding protein 1; tandem-BRC 3e-05
1l0b_A229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 5e-05
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 5e-05
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 8e-05
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 9e-05
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 2e-04
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 2e-04
2vxb_A241 DNA repair protein RHP9; BRCT, nucleus, cell cycle 2e-04
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 2e-04
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 6e-04
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
 Score =  126 bits (318), Expect = 5e-33
 Identities = 44/177 (24%), Positives = 84/177 (47%), Gaps = 29/177 (16%)

Query: 124 SGFDKGNLEWLEQLFRQ---TVGDEKEICRDDFKKIL----------------------- 157
           + F    +E L +LF++    V D+  I +++F+  L                       
Sbjct: 40  TVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHN 99

Query: 158 --ITKNEFIDAMHQFAGQSP-DDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQF 214
             +   EF  A+  F   +P DDKI F F++YDL   G I+ +E++ ++ A + E+GM  
Sbjct: 100 GILGFEEFARALSVFHPNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNL 159

Query: 215 SEEQIDHLTMALFEDADSENRGAITYESLKNQLEKHGGLLENLSISIDRWLVPPKPK 271
            +  I+ +    FE+AD+++ G I  E  ++ + +H  LL+N+++   + +    P 
Sbjct: 160 KDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLKDITTTFPS 216
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Length = 107 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Length = 112 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Length = 298 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 Back     alignment and structure
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Length = 132 Back     alignment and structure
>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Length = 220 Back     alignment and structure
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Length = 210 Back     alignment and structure
>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Length = 235 Back     alignment and structure
>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Length = 219 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Length = 214 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Length = 103 Back     alignment and structure
>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Length = 259 Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Length = 229 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* Length = 241 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query864
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.71
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.69
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.69
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.67
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.66
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.65
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.65
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.64
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.63
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.62
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.62
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.62
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.61
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.61
3fwb_A161 Cell division control protein 31; gene gating, com 99.61
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.6
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.6
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.59
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.59
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.59
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.59
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.59
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.59
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.59
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.59
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.58
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.58
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.58
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.57
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.57
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.56
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.56
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.56
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.56
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.56
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.56
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.55
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.55
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.55
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.55
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.54
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.54
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.54
1y1x_A191 Leishmania major homolog of programmed cell death 99.54
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.54
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.53
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.53
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.53
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.53
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.52
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.52
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.52
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.52
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.51
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.51
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.51
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.5
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.5
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.5
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.49
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.49
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.48
3l46_A112 Protein ECT2; alternative splicing, guanine-nucleo 99.47
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.47
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.47
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.46
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.45
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.45
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.45
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.43
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.43
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.42
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.42
2cou_A109 ECT2 protein; BRCT domain, RHO GTPase, structural 99.42
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.41
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.4
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.39
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.38
1y1x_A191 Leishmania major homolog of programmed cell death 99.38
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.38
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.37
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.37
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.36
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.36
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.35
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.35
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.35
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.35
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.34
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.34
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.34
2d8m_A129 DNA-repair protein XRCC1; parallel beta-sheet, DNA 99.34
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.33
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.32
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.31
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.31
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.3
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.29
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.28
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.26
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.25
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.22
3l3e_A107 DNA topoisomerase 2-binding protein 1; BRCT domain 99.21
3pa6_A107 Microcephalin; BRCT domain, cell cycle; HET: MSE; 99.21
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.17
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.17
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.12
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.12
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.1
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.09
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.09
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.08
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.08
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.06
3fwb_A161 Cell division control protein 31; gene gating, com 99.05
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.03
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.03
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.03
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.03
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.03
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.02
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.02
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.01
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.0
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.0
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.99
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.99
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.99
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.99
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.98
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.98
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.98
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.97
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.97
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.97
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.96
3olc_X298 DNA topoisomerase 2-binding protein 1; BRCT domain 98.96
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.95
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.95
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.95
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.94
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.94
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.93
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.93
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.93
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.93
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.92
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.92
4id3_A92 DNA repair protein REV1; BRCT domain, protein bind 98.91
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.91
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.9
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.9
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.9
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.89
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.89
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.89
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.88
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.88
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.88
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.88
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.88
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.88
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.88
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.88
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.88
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.87
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.87
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.87
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.87
2ebw_A97 DNA repair protein REV1; A/B/A 3 layers, parallel 98.86
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.86
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.86
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.86
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.86
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.85
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.85
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.84
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.84
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.84
3li6_A66 Calcium-binding protein; calcium signaling protein 98.82
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.82
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.82
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.82
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.81
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.81
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.81
1c07_A95 Protein (epidermal growth factor receptor pathway 98.81
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.81
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.81
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.8
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.8
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.78
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.78
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.78
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.78
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.77
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.77
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.77
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.77
3ef1_A442 RNA polymerase II subunit A C-terminal domain phos 98.76
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.76
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 98.76
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.76
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.75
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.75
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.74
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.74
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.72
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.72
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.72
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.71
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.71
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.71
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.7
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.7
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.7
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.69
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.69
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.69
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.68
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.68
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.67
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.67
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.67
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.67
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.66
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.66
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.65
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.64
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.64
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.63
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.62
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.61
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.6
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.6
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.58
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.58
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.58
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.58
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.58
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.57
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.57
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.56
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.56
3sqd_A219 PAX-interacting protein 1; tandem BRCT domains, ce 98.55
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.54
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.52
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.51
1wf6_A132 Similar to S.pombe -RAD4+/CUT5+product (A40727); B 98.5
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.49
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.45
2nte_A210 BARD-1, BRCA1-associated ring domain protein 1; BR 98.44
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.43
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.42
1t15_A214 Breast cancer type 1 susceptibility protein; prote 98.42
1l0b_A229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 98.41
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.38
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.38
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.37
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.37
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.37
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.36
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.36
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.35
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.33
1c07_A95 Protein (epidermal growth factor receptor pathway 98.33
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.3
3pc6_A104 DNA repair protein XRCC1; BRCT domain, protein:pro 98.3
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.3
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.27
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.27
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 98.27
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.27
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.25
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.24
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.22
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.22
3al2_A235 DNA topoisomerase 2-binding protein 1; BRCT domain 98.21
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.21
2etx_A209 Mediator of DNA damage checkpoint protein 1; tande 98.21
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.2
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.18
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.14
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.12
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.11
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.1
3li6_A66 Calcium-binding protein; calcium signaling protein 98.09
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.09
3l41_A220 BRCT-containing protein 1; BRC1, BRCT domain, tand 98.08
3u3z_A199 Microcephalin; DNA repair, cell cycle regulation, 98.08
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.07
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.07
3olc_X298 DNA topoisomerase 2-binding protein 1; BRCT domain 98.06
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.06
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.06
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.03
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.03
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.03
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.02
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.01
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 98.0
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.0
2vxb_A241 DNA repair protein RHP9; BRCT, nucleus, cell cycle 97.98
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 97.95
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 97.92
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 97.92
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 97.91
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 97.91
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 97.89
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 97.89
2jq6_A139 EH domain-containing protein 1; metal binding prot 97.89
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 97.87
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.86
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 97.85
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 97.85
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 97.82
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 97.82
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 97.78
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 97.78
3a4u_B143 Multiple coagulation factor deficiency protein 2; 97.77
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 97.77
1kzy_C259 Tumor suppressor P53-binding protein 1; tandem-BRC 97.76
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 97.76
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 97.75
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 97.73
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 97.73
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 97.71
3ii6_X263 DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter 97.65
3u3z_A199 Microcephalin; DNA repair, cell cycle regulation, 97.63
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.61
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 97.61
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 97.52
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 97.48
3ii6_X263 DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alter 97.46
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.43
1l7b_A92 DNA ligase; BRCT, autostructure, structural genomi 97.34
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.31
2jw5_A106 DNA polymerase lambda; BRCT domain, family X polym 97.28
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 96.97
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 96.96
2k6g_A109 Replication factor C subunit 1; protein, BRCT, DNA 96.92
1t15_A214 Breast cancer type 1 susceptibility protein; prote 96.85
1kzy_C259 Tumor suppressor P53-binding protein 1; tandem-BRC 96.82
1z56_C264 DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA 96.78
1z56_C264 DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA 96.72
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 96.7
1l0b_A229 BRCA1; TANDEM-BRCT, three-helix bundle, unknown fu 96.63
2ebu_A112 Replication factor C subunit 1; A/B/A 3 layers, pa 96.63
2coe_A120 Deoxynucleotidyltransferase, terminal variant; BRC 96.58
2etx_A209 Mediator of DNA damage checkpoint protein 1; tande 96.41
2ep8_A100 Pescadillo homolog 1; A/B/A 3 layers, nucleolus, r 96.15
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 96.01
2cok_A113 Poly [ADP-ribose] polymerase-1; BRCT domain, DNA r 95.63
3pc7_A88 DNA ligase 3; DNA repair, BRCT domain, protein:pro 95.61
2dun_A133 POL MU, DNA polymerase MU; layers A/B/A, parallel 95.45
2nte_A210 BARD-1, BRCA1-associated ring domain protein 1; BR 95.42
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 95.18
1nub_A229 Basement membrane protein BM-40; extracellular mod 94.83
2vxb_A241 DNA repair protein RHP9; BRCT, nucleus, cell cycle 92.41
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 92.0
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 89.99
3sqd_A219 PAX-interacting protein 1; tandem BRCT domains, ce 89.95
2l42_A106 DNA-binding protein RAP1; BRCT domain, protein bin 89.42
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 83.53
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 82.33
1dgs_A667 DNA ligase; AMP complex, NAD+-dependent; HET: DNA 81.53
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 81.01
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 80.19
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
Probab=99.71  E-value=6e-17  Score=164.58  Aligned_cols=154  Identities=25%  Similarity=0.438  Sum_probs=128.3

Q ss_pred             hccCcCCHHHHHhhhhhcCCCHHHHHHHHHHHhh-hcC--CCCcccHHHHHHHHHh-----------H------------
Q psy8382         107 VAYTSLRIHHNLVCLPRSGFDKGNLEWLEQLFRQ-TVG--DEKEICRDDFKKILIT-----------K------------  160 (864)
Q Consensus       107 ~~s~~L~~~el~~l~~~l~fs~~eieeL~~~F~~-D~d--~dG~I~~eEF~~~l~~-----------~------------  160 (864)
                      ++++.++.+++..+.+.++++.++++++++.|.. |.|  ++|.|+.+||..++..           .            
T Consensus        12 ~~~g~l~~~el~~l~~~~~~s~~~~~~l~~~F~~~D~d~~~~G~i~~~e~~~~l~~~~~~~~~~~~~~f~~~D~d~~g~i   91 (207)
T 2ehb_A           12 NAMRPPGYEDPELLASVTPFTVEEVEALYELFKKLSSSIIDDGLIHKEEFQLALFRNRNRRNLFADRIFDVFDVKRNGVI   91 (207)
T ss_dssp             ---------CHHHHHHHSSCCHHHHHHHHHHHHHHTTSSSCSSCEEHHHHHHHHHSCTTCCCHHHHHHHHHHCTTCSSEE
T ss_pred             ccccccCHHHHHHHHHhCCCCHHHHHHHHHHHHHhccccCCCCccCHHHHHHHHhccccccHHHHHHHHHHhcCCCCCeE
Confidence            4667888899999999999999999999999999 999  9999999999988742           0            


Q ss_pred             --HHHHHHHHHhcC-CCChHHHHHHhhhhcCCCCCccCHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHhcCCCCcc
Q psy8382         161 --NEFIDAMHQFAG-QSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQIDHLTMALFEDADSENRGA  237 (864)
Q Consensus       161 --~EFl~~l~~~~~-~~~eekL~~aFk~fD~dgdG~Is~eELr~vL~~l~~~~g~~ls~e~i~~iv~~if~~~D~d~dG~  237 (864)
                        .||+.++..... ...+++++.+|+.||.|++|+|+.+||+.++..++...|..+++++++++++.+|+.+|.|+||.
T Consensus        92 ~~~Ef~~~~~~~~~~~~~~~~l~~~F~~~D~d~~G~I~~~E~~~~l~~~~~~~g~~~~~~~~~~~~~~~f~~~D~d~dG~  171 (207)
T 2ehb_A           92 EFGEFVRSLGVFHPSAPVHEKVKFAFKLYDLRQTGFIEREELKEMVVALLHESELVLSEDMIEVMVDKAFVQADRKNDGK  171 (207)
T ss_dssp             CHHHHHHHHGGGSTTSCHHHHHHHHHHHHCTTCCSSEEHHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHHHHHCTTCSSE
T ss_pred             eHHHHHHHHHHHccCCCHHHHHHHHHHHhCCCCCCcCcHHHHHHHHHHHHHHcccccCHHHHHHHHHHHHHHhCCCCCCc
Confidence              188888876653 35578899999999999999999999999998665556889999999998899999999999999


Q ss_pred             eeHHHHHHHHHhccchHHHHHhh
Q psy8382         238 ITYESLKNQLEKHGGLLENLSIS  260 (864)
Q Consensus       238 IsfeEF~~~l~~~p~ll~~l~~~  260 (864)
                      |+|+||+.++..+|.+++.+++.
T Consensus       172 I~~~Ef~~~~~~~~~~~~~~~~~  194 (207)
T 2ehb_A          172 IDIDEWKDFVSLNPSLIKNMTLP  194 (207)
T ss_dssp             ECHHHHHHHHHHCGGGGGGGCCT
T ss_pred             CcHHHHHHHHHhChHHHHHhcch
Confidence            99999999999999998887664
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3l46_A Protein ECT2; alternative splicing, guanine-nucleotide releasing factor, phosphoprotein, polymorphism, proto-oncogene, structural genomics; 1.48A {Homo sapiens} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2cou_A ECT2 protein; BRCT domain, RHO GTPase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2d8m_A DNA-repair protein XRCC1; parallel beta-sheet, DNA ligase III, poly(ADP-ribose) polymerase-1, DNA polymerase beta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3pa6_A Microcephalin; BRCT domain, cell cycle; HET: MSE; 1.50A {Homo sapiens} PDB: 3ktf_A* 2wt8_A* Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4id3_A DNA repair protein REV1; BRCT domain, protein binding; HET: DNA; 1.97A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2ebw_A DNA repair protein REV1; A/B/A 3 layers, parallel beta-sheet, DNA replication, translession synthesis, TLS, DNA polymerase zeta, PCNA; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1wf6_A Similar to S.pombe -RAD4+/CUT5+product (A40727); BRCT, topoisomerase II binding protein, checkpoint; NMR {Homo sapiens} SCOP: c.15.1.5 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3pc6_A DNA repair protein XRCC1; BRCT domain, protein:protein interactions, DNA L III-alpha BRCT2 domain, DNA binding protein; HET: DNA; 1.90A {Mus musculus} SCOP: c.15.1.1 PDB: 3pc8_A* 3qvg_B* 1cdz_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3al2_A DNA topoisomerase 2-binding protein 1; BRCT domain, protein binding, DNA binding protein; HET: DNA MSE; 2.00A {Homo sapiens} PDB: 3al3_A* Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>3l41_A BRCT-containing protein 1; BRC1, BRCT domain, tandem BRCT repeat, phosphoserine binding domain, DNA repair, cell division, mitosis; HET: SEP; 1.45A {Schizosaccharomyces pombe} PDB: 3l40_A* Back     alignment and structure
>3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3olc_X DNA topoisomerase 2-binding protein 1; BRCT domain, DNA repair, RAD9, DNA binding protein; HET: DNA; 2.40A {Homo sapiens} PDB: 2xnk_A* 2xnh_A* Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Back     alignment and structure
>3u3z_A Microcephalin; DNA repair, cell cycle regulation, cell cycle; HET: SEP PTR; 1.50A {Homo sapiens} PDB: 3szm_A* 3t1n_A* 3sht_A 3shv_A* Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3ii6_X DNA ligase 4; XRCC4, NHEJ, DNA repair, BRCT, alternative splicing, coiled coil, DNA damage, DNA recombination, isopeptide bond, nucleus; HET: DNA; 2.40A {Homo sapiens} PDB: 2e2w_A* Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1l7b_A DNA ligase; BRCT, autostructure, structural genomics, NESG, PSI, protein structure initiative, northeast structural genomics consortium; HET: DNA; NMR {Thermus thermophilus} SCOP: c.15.1.2 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2jw5_A DNA polymerase lambda; BRCT domain, family X polymerase, nonhomologous END joining (NHEJ), DNA damage, DNA repair, DNA replication, DNA synthesis; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2k6g_A Replication factor C subunit 1; protein, BRCT, DNA binding, activator, alternative splicing, ATP-binding, DNA replication, DNA- binding; NMR {Homo sapiens} PDB: 2k7f_A Back     alignment and structure
>1t15_A Breast cancer type 1 susceptibility protein; protein-peptide complex, antitumor protein; HET: SEP; 1.85A {Homo sapiens} SCOP: c.15.1.3 c.15.1.3 PDB: 1jnx_X* 1t29_A* 1t2v_A* 1y98_A* 3coj_X* 3k0h_A* 3k0k_A* 3pxe_A* 3pxb_A 3pxc_X 1t2u_A 1n5o_X 3pxa_A 3k15_A* 3k16_A* 3pxd_A 2ing_X 1oqa_A Back     alignment and structure
>1kzy_C Tumor suppressor P53-binding protein 1; tandem-BRCT and linker complexed with non-BRCT protein, three-helix bundle, parallel beta sheet; 2.50A {Homo sapiens} SCOP: c.15.1.4 c.15.1.4 PDB: 1gzh_B Back     alignment and structure
>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Back     alignment and structure
>1z56_C DNA ligase IV; DNA repair, BRCT, NHEJ, XRCC4, DNA ligase, coiled-coil; HET: DNA; 3.92A {Saccharomyces cerevisiae} Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1l0b_A BRCA1; TANDEM-BRCT, three-helix bundle, unknown function; 2.30A {Rattus norvegicus} SCOP: c.15.1.3 c.15.1.3 Back     alignment and structure
>2ebu_A Replication factor C subunit 1; A/B/A 3 layers, parallel beta-sheet, DNA replication, clamp loader, RFC1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2coe_A Deoxynucleotidyltransferase, terminal variant; BRCT domain, DNA polymerase, teminal deoxynucleotidyltransferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2etx_A Mediator of DNA damage checkpoint protein 1; tandem BRCT domains histone gamma-H2AX, cell cycle; 1.33A {Homo sapiens} PDB: 2azm_A* 3k05_A* 2ado_A Back     alignment and structure
>2ep8_A Pescadillo homolog 1; A/B/A 3 layers, nucleolus, ribosome biogenesis, DNA damage, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2cok_A Poly [ADP-ribose] polymerase-1; BRCT domain, DNA repair, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2le0_A Back     alignment and structure
>3pc7_A DNA ligase 3; DNA repair, BRCT domain, protein:protein interactions, XRCC1 domain, DNA binding protein; HET: DNA MSE; 1.65A {Homo sapiens} SCOP: c.15.1.2 PDB: 3pc8_C* 1imo_A* 1in1_A* 3qvg_A* Back     alignment and structure
>2dun_A POL MU, DNA polymerase MU; layers A/B/A, parallel beta-sheet of 4 strands, non- homologous END jonting, somatic hypermutation, V(D)J recombination; HET: DNA; NMR {Homo sapiens} PDB: 2htf_A* Back     alignment and structure
>2nte_A BARD-1, BRCA1-associated ring domain protein 1; BRCT, ring finger, zinc-binding protein, ubiquitin LI antitumor protein; 1.90A {Homo sapiens} PDB: 3fa2_A 2r1z_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2vxb_A DNA repair protein RHP9; BRCT, nucleus, cell cycle, DNA damage, DNA replication inhibitor, phosphoprotein, checkpoint signalling; HET: DNA; 2.3A {Schizosaccharomyces pombe} PDB: 2vxc_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3sqd_A PAX-interacting protein 1; tandem BRCT domains, cell cycle; HET: SEP; 2.15A {Homo sapiens} Back     alignment and structure
>2l42_A DNA-binding protein RAP1; BRCT domain, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 864
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 9e-15
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-14
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 7e-14
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 2e-13
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-12
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 5e-12
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 5e-12
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 4e-11
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 7e-11
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 6e-10
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 8e-04
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 7e-10
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 4e-04
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 8e-10
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 8e-05
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 1e-09
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-09
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 7e-04
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 3e-09
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-08
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.001
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 3e-08
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 4e-05
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 4e-08
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 4e-05
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 4e-08
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 6e-08
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 3e-05
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-07
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 3e-07
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 0.001
d1t15a1109 c.15.1.3 (A:1649-1757) Breast cancer associated pr 3e-07
d1t15a2102 c.15.1.3 (A:1758-1859) Breast cancer associated pr 4e-07
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 6e-07
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 0.001
d2hf5a133 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien 7e-07
d1kzyc1153 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) 1e-06
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 2e-06
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 2e-06
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 2e-06
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-06
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-06
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-04
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 3e-06
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 9e-06
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 1e-05
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 2e-05
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 0.001
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 0.002
d1wf6a_132 c.15.1.5 (A:) DNA topoisomerase II binding protein 2e-05
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 2e-05
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 2e-05
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 4e-05
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 6e-05
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 6e-05
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 2e-04
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 0.002
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 0.002
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 2e-04
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 2e-04
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 3e-04
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 3e-04
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 4e-04
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 0.002
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 4e-04
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 0.001
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 9e-04
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 0.004
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 0.002
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 0.004
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calcium- and integrin-binding protein, CIB
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 71.0 bits (173), Expect = 9e-15
 Identities = 27/179 (15%), Positives = 65/179 (36%), Gaps = 15/179 (8%)

Query: 90  GFDKGNLEWLEQLFRQTVAYTSLRIHHN-LVCLPRSGFDK----GNLEWLEQLFRQTVGD 144
              K  +    + F + +      +  +    +P              + E++ R     
Sbjct: 10  FLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRV---- 65

Query: 145 EKEICRDDFKKILITKNEFIDAMHQFAGQ-SPDDKIKFLFRVYDLDGDGLIQHKELQHVM 203
                     K  ++  +F+D +  F+   +PD K  + FR++D D DG +  ++L  ++
Sbjct: 66  ----FSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLV 121

Query: 204 RACMEEN-GMQFSEEQIDHLTMALFEDADSENRGAITYESLKNQLEKHGGLLENLSISI 261
                E    + S  ++  L   + E++D +  G I     ++ + +      +  I +
Sbjct: 122 NCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL 180
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query864
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.72
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.71
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.71
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.65
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.64
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.63
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.62
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.61
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.58
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.56
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.55
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.54
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.54
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.52
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.5
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.49
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.49
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.49
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.48
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.47
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.46
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.46
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.45
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.44
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.43
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.42
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.4
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.38
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.36
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.35
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.34
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.34
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.34
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.32
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.32
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.31
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.28
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.26
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.25
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.22
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.22
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.19
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.19
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.17
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.14
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.13
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.13
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.11
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.1
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.09
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.06
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.04
d1t15a1109 Breast cancer associated protein, BRCA1 {Human (Ho 98.98
d1wf6a_132 DNA topoisomerase II binding protein 1, TopBP1 {Hu 98.94
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.92
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.89
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.88
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.86
d1cdza_96 DNA-repair protein XRCC1 {Human (Homo sapiens) [Ta 98.84
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.81
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.8
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.78
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.77
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.76
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.76
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.74
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.73
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.72
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.72
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.7
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.7
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.69
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.69
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.69
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.68
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.66
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.65
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.65
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.64
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.64
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.64
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.64
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.61
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.6
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.6
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.59
d1t15a2102 Breast cancer associated protein, BRCA1 {Human (Ho 98.59
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.59
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.58
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.57
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.57
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.56
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.55
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.54
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.52
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.5
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.5
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.49
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.49
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.49
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.48
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.46
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.44
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.43
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.43
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.42
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.38
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.37
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.37
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.36
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.34
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.34
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.33
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.32
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.3
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1kzyc1153 53BP1 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.28
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.28
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.26
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.25
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.21
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.2
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.18
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.16
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.15
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.15
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.13
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.13
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.13
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.11
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.09
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.07
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.02
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 98.01
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 97.98
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 97.91
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.87
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.84
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 97.83
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.82
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 97.82
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 97.76
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 97.7
d1l7ba_92 NAD+-dependent DNA ligase, domain 4 {Thermus therm 97.67
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.65
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 97.45
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.4
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.38
d1in1a_88 DNA ligase III alpha {Human (Homo sapiens) [TaxId: 97.35
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.32
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.31
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 96.68
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 96.61
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.54
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 96.04
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 95.96
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 95.79
d1kzyc2106 53BP1 {Human (Homo sapiens) [TaxId: 9606]} 95.62
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.49
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 94.43
d1l0ba297 Breast cancer associated protein, BRCA1 {Rat (Ratt 94.18
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 90.02
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 88.37
d1eg3a297 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 86.09
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 84.89
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 81.22
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calcineurin B-like protein 2
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.72  E-value=2.1e-17  Score=163.95  Aligned_cols=142  Identities=29%  Similarity=0.543  Sum_probs=114.2

Q ss_pred             hhhhcCCCHHHHHHHHHHHhh-hcC--CCCcccHHHHHHHHHhH-------------------------HHHHHHHHHhc
Q psy8382         120 CLPRSGFDKGNLEWLEQLFRQ-TVG--DEKEICRDDFKKILITK-------------------------NEFIDAMHQFA  171 (864)
Q Consensus       120 l~~~l~fs~~eieeL~~~F~~-D~d--~dG~I~~eEF~~~l~~~-------------------------~EFl~~l~~~~  171 (864)
                      +.+.++|+.+|++.|++.|.. |.+  ++|.|+.+||..++...                         .||+.+++.+.
T Consensus         5 l~~~t~Fs~~ei~~L~~~F~~~d~~~~~~G~i~~~ef~~~l~~~~~~~~~~~~~lf~~~d~~~dg~I~f~EFl~~l~~~~   84 (183)
T d2zfda1           5 LARDTVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFH   84 (183)
T ss_dssp             HHHHSSCCHHHHHHHHHHHHHHHTSSSCSSSBCHHHHHHHHHSCSSCCCHHHHHHHHHHCSSCSSSBCHHHHHHHHHHTS
T ss_pred             HhhhCCCCHHHHHHHHHHHHHHCcCCCCCCcCcHHHHHHHHHhcCCCCCHHHHHHHHHHccCCCCcCcHHHHHHHHHhhh
Confidence            445566666666666666665 433  46666666666555311                         06777777765


Q ss_pred             C-CCChHHHHHHhhhhcCCCCCccCHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHhcCCCCcceeHHHHHHHHHhc
Q psy8382         172 G-QSPDDKIKFLFRVYDLDGDGLIQHKELQHVMRACMEENGMQFSEEQIDHLTMALFEDADSENRGAITYESLKNQLEKH  250 (864)
Q Consensus       172 ~-~~~eekL~~aFk~fD~dgdG~Is~eELr~vL~~l~~~~g~~ls~e~i~~iv~~if~~~D~d~dG~IsfeEF~~~l~~~  250 (864)
                      . ...+++++.+|++||.|++|+|+.+|++.++..++...|..++++.++++++.+|+++|.|+||.|+|+||.+++.++
T Consensus        85 ~~~~~~~~~~~~F~~~D~d~~G~Is~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~if~~~D~d~dG~Is~~EF~~~~~~~  164 (183)
T d2zfda1          85 PNAPIDDKIHFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLKDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRH  164 (183)
T ss_dssp             TTSCHHHHHHHHHHHHCTTSSSSEEHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHCSSCSSEECHHHHHHHHHHS
T ss_pred             ccCcHHHHHHHhhcccccCCCCCccHHHHHHHHHHHHhhhhcccchHHHHHHHHHHHHHhCCCCCCeEcHHHHHHHHHHC
Confidence            4 466789999999999999999999999999998887778889999999999999999999999999999999999999


Q ss_pred             cchHHHHHhhh
Q psy8382         251 GGLLENLSISI  261 (864)
Q Consensus       251 p~ll~~l~~~~  261 (864)
                      |++++.|.+..
T Consensus       165 p~~~~~~~l~~  175 (183)
T d2zfda1         165 PSLLKNMTLQY  175 (183)
T ss_dssp             GGGGGGGCCGG
T ss_pred             HHHHHHcCchh
Confidence            99999887753
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1t15a1 c.15.1.3 (A:1649-1757) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf6a_ c.15.1.5 (A:) DNA topoisomerase II binding protein 1, TopBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdza_ c.15.1.1 (A:) DNA-repair protein XRCC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1t15a2 c.15.1.3 (A:1758-1859) Breast cancer associated protein, BRCA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kzyc1 c.15.1.4 (C:1714-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l7ba_ c.15.1.2 (A:) NAD+-dependent DNA ligase, domain 4 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1in1a_ c.15.1.2 (A:) DNA ligase III alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1l0ba2 c.15.1.3 (A:1705-1801) Breast cancer associated protein, BRCA1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure