Psyllid ID: psy8387

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MSTITLVVLLYHSGNYNNSNLILNNSHVNNNNTSSPALPLRSRTEDQQHNHRLLVQQPRKRGASKKCSGGNSLLQQPPDLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKELRPEQATELGNLPPGWEVRQTASGRYYYVDHNNRTTQFTDPRLTPAIIQNLVKTLNVLSKHL
cccEEEEEEEEccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccEEEEcccccEEEEEcccccEEcccccccccccccccccccccccccEEEEcccccEEEEEccccEEEcccccccHHHHHHHHHccccccccc
cccEEEEEEEcccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEcccccEEccccccccHccccccccccccccccEEEEcccccEEEEEccccEEEcccccccccHccccccHccccHccc
MSTITLVVLLYHsgnynnsnlilnnshvnnnntsspalplrsrtedqqhnhrllvqqprkrgaskkcsggnsllqqppdlphgyeirttqqgqvyfyhlptgvstwhdpripkelrpeqatelgnlppgwevrqtasGRYYyvdhnnrttqftdprltPAIIQNLVKTLNVLSKHL
MSTITLVVLLYHSGNYNNSNLILNNSHVNNNNTSSPALPLRSRTEDQQHNHrllvqqprkrgaskkcsggnsllqqppdLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKELRPEQatelgnlppgwevrQTASGRYYYVDHNNrttqftdprltPAIIQNLVKTLNVLSKHL
MSTITLVVLLYHsgnynnsnlilnnshvnnnntssPALPLRSRTEDQQHNHRLLVQQPRKRGASKKCSGGNSLLQQPPDLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKELRPEQATELGNLPPGWEVRQTASGRYYYVDHNNRTTQFTDPRLTPAIIQNLVKTLNVLSKHL
***ITLVVLLYHSGNYNNSNLILN***********************************************************YEIRTTQQGQVYFYHLPTGVSTWHDPR***************LPPGWEVRQTASGRYYYVDHNNRTTQFTDPRLTPAIIQNLVKTLNVL****
**TITLVVLL************************************************************************GYEIRTTQQGQVYFYHLPTGVSTWHDP*******************GWEVRQTASGRYYYVDHNNRTTQFTDPR********************
MSTITLVVLLYHSGNYNNSNLILNNSHVNNNNTSSPALPLRSRTEDQQHNHRLLVQ**************NSLLQQPPDLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKELRPEQATELGNLPPGWEVRQTASGRYYYVDHNNRTTQFTDPRLTPAIIQNLVKTLNVLSKHL
*STITLVVLLYH******************************************************************DLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKELRPEQATELGNLPPGWEVRQTASGRYYYVDHNNRTTQFTDPRL*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTITLVVLLYHSGNYNNSNLILNNSHVNNNNTSSPALPLRSRTEDQQHNHRLLVQQPRKRGASKKCSGGNSLLQQPPDLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKELRPEQATELGNLPPGWEVRQTASGRYYYVDHNNRTTQFTDPRLTPAIIQNLVKTLNVLSKHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query176 2.2.26 [Sep-21-2011]
A9JRZ0 765 E3 ubiquitin-protein liga yes N/A 0.590 0.135 0.634 5e-33
Q9HAU4 748 E3 ubiquitin-protein liga yes N/A 0.482 0.113 0.729 1e-32
Q2TAS2 751 E3 ubiquitin-protein liga N/A N/A 0.403 0.094 0.729 1e-32
A2A5Z6 748 E3 ubiquitin-protein liga yes N/A 0.482 0.113 0.729 1e-32
Q9V853 1061 E3 ubiquitin-protein liga yes N/A 0.494 0.081 0.696 4e-32
Q9CUN6 731 E3 ubiquitin-protein liga no N/A 0.465 0.112 0.743 7e-31
Q9PUN2 731 E3 ubiquitin-protein liga N/A N/A 0.465 0.112 0.719 7e-30
Q9HCE7 757 E3 ubiquitin-protein liga no N/A 0.465 0.108 0.564 1e-26
O14326 786 E3 ubiquitin-protein liga yes N/A 0.534 0.119 0.416 2e-15
Q92462 767 E3 ubiquitin-protein liga no N/A 0.619 0.142 0.370 2e-13
>sp|A9JRZ0|SMUF2_DANRE E3 ubiquitin-protein ligase SMURF2 OS=Danio rerio GN=smurf2 PE=2 SV=1 Back     alignment and function desciption
 Score =  140 bits (352), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 76/104 (73%)

Query: 55  VQQPRKRGASKKCSGGNSLLQQPPDLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKE 114
           VQ+ R R    +     + L  PPDLP GYE RTTQQGQVYF H  TGVSTWHDPR+P++
Sbjct: 228 VQERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRD 287

Query: 115 LRPEQATELGNLPPGWEVRQTASGRYYYVDHNNRTTQFTDPRLT 158
           L      ELG LPPGWE+R TA+GR Y+VDHNNRTTQFTDPRL+
Sbjct: 288 LSNVNCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLS 331
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Danio rerio (taxid: 7955)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9HAU4|SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens GN=SMURF2 PE=1 SV=1 Back     alignment and function description
>sp|Q2TAS2|SMUF2_XENLA E3 ubiquitin-protein ligase SMURF2 OS=Xenopus laevis GN=smurf2 PE=2 SV=1 Back     alignment and function description
>sp|A2A5Z6|SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus GN=Smurf2 PE=1 SV=1 Back     alignment and function description
>sp|Q9V853|SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster GN=lack PE=1 SV=3 Back     alignment and function description
>sp|Q9CUN6|SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus GN=Smurf1 PE=2 SV=2 Back     alignment and function description
>sp|Q9PUN2|SMUF1_XENLA E3 ubiquitin-protein ligase SMURF1 OS=Xenopus laevis GN=smurf1 PE=2 SV=1 Back     alignment and function description
>sp|Q9HCE7|SMUF1_HUMAN E3 ubiquitin-protein ligase SMURF1 OS=Homo sapiens GN=SMURF1 PE=1 SV=2 Back     alignment and function description
>sp|O14326|PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub3 PE=2 SV=1 Back     alignment and function description
>sp|Q92462|PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pub1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
322793996 910 hypothetical protein SINV_00995 [Solenop 0.522 0.101 0.741 9e-35
328712432 750 PREDICTED: e3 ubiquitin-protein ligase S 0.551 0.129 0.690 2e-34
328784531 905 PREDICTED: e3 ubiquitin-protein ligase S 0.517 0.100 0.75 5e-34
350398007 906 PREDICTED: E3 ubiquitin-protein ligase S 0.517 0.100 0.75 5e-34
380029635 899 PREDICTED: E3 ubiquitin-protein ligase S 0.517 0.101 0.75 6e-34
340720899 906 PREDICTED: e3 ubiquitin-protein ligase S 0.517 0.100 0.75 9e-34
242015442 852 E3 ubiquitin-protein ligase Smurf1, puta 0.539 0.111 0.677 1e-33
345487811 918 PREDICTED: E3 ubiquitin-protein ligase S 0.534 0.102 0.726 1e-33
383852529 894 PREDICTED: E3 ubiquitin-protein ligase S 0.517 0.101 0.739 2e-33
189240467 1879 PREDICTED: similar to lethal with a chec 0.505 0.047 0.736 2e-33
>gi|322793996|gb|EFZ17234.1| hypothetical protein SINV_00995 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  151 bits (382), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 79/93 (84%), Gaps = 1/93 (1%)

Query: 76  QPPDLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKELRPEQAT-ELGNLPPGWEVRQ 134
           QPPDLP GYE+R TQQGQVYFYH+PTG STWHDPRIP++L+  + T ELG LP GWE+RQ
Sbjct: 352 QPPDLPRGYEMRKTQQGQVYFYHVPTGSSTWHDPRIPRDLQANELTNELGPLPSGWEMRQ 411

Query: 135 TASGRYYYVDHNNRTTQFTDPRLTPAIIQNLVK 167
           T SGR Y+VDHNNRTTQFTDPRL+  II NL+K
Sbjct: 412 TQSGRVYFVDHNNRTTQFTDPRLSSQIISNLLK 444

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328712432|ref|XP_001944806.2| PREDICTED: e3 ubiquitin-protein ligase SMURF2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328784531|ref|XP_396318.4| PREDICTED: e3 ubiquitin-protein ligase SMURF2 [Apis mellifera] Back     alignment and taxonomy information
>gi|350398007|ref|XP_003485059.1| PREDICTED: E3 ubiquitin-protein ligase SMURF2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380029635|ref|XP_003698473.1| PREDICTED: E3 ubiquitin-protein ligase SMURF2-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|340720899|ref|XP_003398866.1| PREDICTED: e3 ubiquitin-protein ligase SMURF2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|242015442|ref|XP_002428362.1| E3 ubiquitin-protein ligase Smurf1, putative [Pediculus humanus corporis] gi|212512974|gb|EEB15624.1| E3 ubiquitin-protein ligase Smurf1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345487811|ref|XP_001606601.2| PREDICTED: E3 ubiquitin-protein ligase SMURF2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383852529|ref|XP_003701779.1| PREDICTED: E3 ubiquitin-protein ligase SMURF2-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|189240467|ref|XP_966429.2| PREDICTED: similar to lethal with a checkpoint kinase CG4943-PA isoform 1 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
ZFIN|ZDB-GENE-030131-1830 765 smurf2 "SMAD specific E3 ubiqu 0.590 0.135 0.634 3.4e-32
UNIPROTKB|J3QQM4 561 SMURF2 "E3 ubiquitin-protein l 0.482 0.151 0.729 5.5e-32
UNIPROTKB|F1N3W8 730 SMURF2 "E3 ubiquitin-protein l 0.482 0.116 0.729 1.7e-31
RGD|1310067 732 Smurf2 "SMAD specific E3 ubiqu 0.482 0.116 0.729 1.7e-31
UNIPROTKB|F1LX00 732 Smurf2 "E3 ubiquitin-protein l 0.482 0.116 0.729 1.7e-31
UNIPROTKB|F1NJU6 737 SMURF2 "E3 ubiquitin-protein l 0.482 0.115 0.729 1.7e-31
UNIPROTKB|Q9HAU4 748 SMURF2 "E3 ubiquitin-protein l 0.482 0.113 0.729 1.8e-31
MGI|MGI:1913563 748 Smurf2 "SMAD specific E3 ubiqu 0.482 0.113 0.729 1.8e-31
RGD|1594738 731 Smurf1 "SMAD specific E3 ubiqu 0.636 0.153 0.612 2.2e-31
UNIPROTKB|J9NW19 556 SMURF1 "Uncharacterized protei 0.659 0.208 0.584 4.1e-31
ZFIN|ZDB-GENE-030131-1830 smurf2 "SMAD specific E3 ubiquitin protein ligase 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 361 (132.1 bits), Expect = 3.4e-32, P = 3.4e-32
 Identities = 66/104 (63%), Positives = 76/104 (73%)

Query:    55 VQQPRKRGASKKCSGGNSLLQQPPDLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKE 114
             VQ+ R R    +     + L  PPDLP GYE RTTQQGQVYF H  TGVSTWHDPR+P++
Sbjct:   228 VQERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRD 287

Query:   115 LRPEQATELGNLPPGWEVRQTASGRYYYVDHNNRTTQFTDPRLT 158
             L      ELG LPPGWE+R TA+GR Y+VDHNNRTTQFTDPRL+
Sbjct:   288 LSNVNCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLS 331
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0006464 "cellular protein modification process" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0016874 "ligase activity" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0045121 "membrane raft" evidence=IEA
UNIPROTKB|J3QQM4 SMURF2 "E3 ubiquitin-protein ligase SMURF2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N3W8 SMURF2 "E3 ubiquitin-protein ligase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1310067 Smurf2 "SMAD specific E3 ubiquitin protein ligase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LX00 Smurf2 "E3 ubiquitin-protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJU6 SMURF2 "E3 ubiquitin-protein ligase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HAU4 SMURF2 "E3 ubiquitin-protein ligase SMURF2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1913563 Smurf2 "SMAD specific E3 ubiquitin protein ligase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1594738 Smurf1 "SMAD specific E3 ubiquitin protein ligase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NW19 SMURF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9HAU4SMUF2_HUMAN6, ., 3, ., 2, ., -0.72940.48290.1136yesN/A
A2A5Z6SMUF2_MOUSE6, ., 3, ., 2, ., -0.72940.48290.1136yesN/A
Q9V853SMUF1_DROME6, ., 3, ., 2, ., -0.69660.49430.0819yesN/A
A9JRZ0SMUF2_DANRE6, ., 3, ., 2, ., -0.63460.59090.1359yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
smart0045633 smart00456, WW, Domain with 2 conserved Trp (W) re 2e-11
cd0020131 cd00201, WW, Two conserved tryptophans domain; als 5e-11
pfam0039730 pfam00397, WW, WW domain 1e-09
smart0045633 smart00456, WW, Domain with 2 conserved Trp (W) re 8e-07
cd0020131 cd00201, WW, Two conserved tryptophans domain; als 1e-06
pfam0039730 pfam00397, WW, WW domain 2e-05
COG5104 590 COG5104, PRP40, Splicing factor [RNA processing an 2e-04
COG5021 872 COG5021, HUL4, Ubiquitin-protein ligase [Posttrans 4e-04
>gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues Back     alignment and domain information 
 Score = 55.7 bits (135), Expect = 2e-11
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 126 LPPGWEVRQTASGRYYYVDHNNRTTQFTDPRL 157
           LPPGWE R+   GR YY +H  + TQ+  PR 
Sbjct: 2   LPPGWEERKDPDGRPYYYNHETKETQWEKPRE 33

Also known as the WWP or rsp5 domain. Binds proline-rich polypeptides. Length = 33
>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>gnl|CDD|215899 pfam00397, WW, WW domain Back     alignment and domain information
>gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>gnl|CDD|215899 pfam00397, WW, WW domain Back     alignment and domain information
>gnl|CDD|227435 COG5104, PRP40, Splicing factor [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|227354 COG5021, HUL4, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 176
KOG1891|consensus271 99.6
KOG3209|consensus 984 99.21
PF0039731 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp 99.2
KOG0940|consensus 358 99.19
smart0045632 WW Domain with 2 conserved Trp (W) residues. Also 99.11
cd0020131 WW Two conserved tryptophans domain; also known as 98.98
PF0039731 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp 98.82
KOG3209|consensus 984 98.68
smart0045632 WW Domain with 2 conserved Trp (W) residues. Also 98.67
COG5104 590 PRP40 Splicing factor [RNA processing and modifica 98.66
KOG1891|consensus 271 98.48
cd0020131 WW Two conserved tryptophans domain; also known as 98.48
KOG3259|consensus 163 98.11
KOG3259|consensus163 97.76
KOG0155|consensus 617 97.45
COG5104 590 PRP40 Splicing factor [RNA processing and modifica 95.96
COG5021 872 HUL4 Ubiquitin-protein ligase [Posttranslational m 94.36
KOG3552|consensus 1298 93.91
KOG0155|consensus 617 91.5
KOG4334|consensus 650 89.95
KOG4286|consensus 966 89.16
KOG0940|consensus 358 88.57
KOG4334|consensus 650 85.66
PF15238297 FAM181: FAM181 82.35
>KOG1891|consensus Back     alignment and domain information 
Probab=99.60  E-value=6.9e-16  Score=128.37  Aligned_cols=77  Identities=23%  Similarity=0.522  Sum_probs=70.1

Q ss_pred             CCCCCCCCCCCcEEEECCCCceEeecCCCCeeeccCCCCCCcCCccchhccCCCCCCceEEEcCCCceEEeeCCCCeeec
Q psy8387          73 LLQQPPDLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKELRPEQATELGNLPPGWEVRQTASGRYYYVDHNNRTTQF  152 (176)
Q Consensus        73 a~~s~~~LP~gWe~~~~~~GrvYY~nh~TrtTsW~~P~~~~~~~~~~~~~~~~LP~GWE~~~d~~Gr~YYiNh~tr~TtW  152 (176)
                      +.+.+.+||+||...++-.||.|||||++++|.|.||-.-           +.||+||+..+++.-.+||+|+.++.|++
T Consensus        87 ~~sedlPLPpgWav~~T~~grkYYIDHn~~tTHW~HPler-----------EgLppGW~rv~s~e~GtyY~~~~~k~tQy  155 (271)
T KOG1891|consen   87 DCSEDLPLPPGWAVEFTTEGRKYYIDHNNRTTHWVHPLER-----------EGLPPGWKRVFSPEKGTYYYHEEMKRTQY  155 (271)
T ss_pred             CCcccCCCCCCcceeeEecCceeEeecCCCcccccChhhh-----------ccCCcchhhccccccceeeeecccchhhh
Confidence            4577889999999999999999999999999999999633           45999999999999899999999999999


Q ss_pred             cCCCCcHH
Q psy8387         153 TDPRLTPA  160 (176)
Q Consensus       153 edPrl~~~  160 (176)
                      +||++...
T Consensus       156 ~HPc~~s~  163 (271)
T KOG1891|consen  156 EHPCISSP  163 (271)
T ss_pred             cCCCCCCC
Confidence            99998644

>KOG3209|consensus Back     alignment and domain information
>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet Back     alignment and domain information
>KOG0940|consensus Back     alignment and domain information
>smart00456 WW Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>smart00456 WW Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>COG5104 PRP40 Splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1891|consensus Back     alignment and domain information
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>KOG3259|consensus Back     alignment and domain information
>KOG3259|consensus Back     alignment and domain information
>KOG0155|consensus Back     alignment and domain information
>COG5104 PRP40 Splicing factor [RNA processing and modification] Back     alignment and domain information
>COG5021 HUL4 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>KOG0155|consensus Back     alignment and domain information
>KOG4334|consensus Back     alignment and domain information
>KOG4286|consensus Back     alignment and domain information
>KOG0940|consensus Back     alignment and domain information
>KOG4334|consensus Back     alignment and domain information
>PF15238 FAM181: FAM181 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
2kxq_A90 Solution Structure Of Smurf2 Ww2 And Ww3 Bound To S 5e-32
2lb1_A35 Structure Of The Second Domain Of Human Smurf1 In C 3e-12
2djy_A42 Solution Structure Of Smurf2 Ww3 Domain-Smad7 Py Pe 7e-12
2ltz_A37 Smurf2 Ww3 Domain In Complex With A Smad7 Derived P 7e-12
2ltx_A35 Smurf1 Ww2 Domain In Complex With A Smad7 Derived P 1e-11
1tk7_A88 Nmr Structure Of Ww Domains (Ww3-4) From Suppressor 2e-11
2lb0_A36 Structure Of The First Ww Domain Of Human Smurf1 In 4e-09
2laz_A33 Structure Of The First Ww Domain Of Human Smurf1 In 5e-09
3olm_A 429 Structure And Function Of A Ubiquitin Binding Site 8e-09
2jmf_A53 Solution Structure Of The Su(Dx) Ww4- Notch Py Pept 9e-07
2jo9_A37 Mouse Itch 3rd Ww Domain Complex With The Epstein-B 1e-06
1i5h_W50 Solution Structure Of The Rnedd4 Wwiii Domain-Renac 1e-06
2joc_A37 Mouse Itch 3rd Domain Phosphorylated In T30 Length 4e-06
2laj_A44 Third Ww Domain Of Human Nedd4l In Complex With Dou 5e-06
2op7_A39 Ww4 Length = 39 5e-06
2lb2_A35 Structure Of The Second Domain Of Human Nedd4l In C 7e-06
2kpz_A49 Human Nedd4 3rd Ww Domain Complex With The Human T- 7e-06
1wr4_A36 Solution Structure Of The Second Ww Domain Of Nedd4 9e-06
2lty_A34 Nedd4l Ww2 Domain In Complex With A Smad7 Derived P 1e-05
2ltv_A36 Yap Ww2 In Complex With A Smad7 Derived Peptide Len 2e-05
3l4h_A109 Helical Box Domain And Second Ww Domain Of The Huma 2e-05
1wr7_A41 Solution Structure Of The Third Ww Domain Of Nedd4- 2e-05
2ysf_A40 Solution Structure Of The Fourth Ww Domain From The 2e-05
1e0m_A37 Prototype Ww Domain Length = 37 5e-05
2law_A38 Structure Of The Second Ww Domain From Human Yap In 5e-05
2l4j_A46 Yap Ww2 Length = 46 7e-05
2ysd_A57 Solution Structure Of The First Ww Domain From The 9e-05
1wr3_A36 Solution Structure Of The First Ww Domain Of Nedd4- 1e-04
2kyk_A39 The Sandwich Region Between Two Lmp2a Py Motif Regu 2e-04
2ysb_A49 Solution Structure Of The First Ww Domain From The 2e-04
1wmv_A54 Solution Structure Of The Second Ww Domain Of Wwox 2e-04
1o6w_A75 Solution Structure Of The Prp40 Ww Domain Pair Of T 6e-04
2lax_A40 Structure Of First Ww Domain Of Human Yap In Comple 6e-04
2lay_A36 Structure Of The First Ww Domain Of Human Yap In Co 8e-04
>pdb|2KXQ|A Chain A, Solution Structure Of Smurf2 Ww2 And Ww3 Bound To Smad7 Py Motif Containing Peptide Length = 90 Back     alignment and structure 
Iteration: 1

 Score =  133 bits (335), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 69/86 (80%)
Query: 73  LLQQPPDLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKELRPEQATELGNLPPGWEV 132
           L   PPDLP GYE RTTQQGQVYF H  TGVSTWHDPR+P++L      ELG LPPGWE+
Sbjct: 3   LGGSPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEI 62
Query: 133 RQTASGRYYYVDHNNRTTQFTDPRLT 158
           R TA+GR Y+VDHNNRTTQFTDPRL+
Sbjct: 63  RNTATGRVYFVDHNNRTTQFTDPRLS 88
>pdb|2LB1|A Chain A, Structure Of The Second Domain Of Human Smurf1 In Complex With A Human Smad1 Derived Peptide Length = 35 Back     alignment and structure
>pdb|2DJY|A Chain A, Solution Structure Of Smurf2 Ww3 Domain-Smad7 Py Peptide Complex Length = 42 Back     alignment and structure
>pdb|2LTZ|A Chain A, Smurf2 Ww3 Domain In Complex With A Smad7 Derived Peptide Length = 37 Back     alignment and structure
>pdb|2LTX|A Chain A, Smurf1 Ww2 Domain In Complex With A Smad7 Derived Peptide Length = 35 Back     alignment and structure
>pdb|1TK7|A Chain A, Nmr Structure Of Ww Domains (Ww3-4) From Suppressor Of Deltex Length = 88 Back     alignment and structure
>pdb|2LB0|A Chain A, Structure Of The First Ww Domain Of Human Smurf1 In Complex With A Di- Phosphorylated Human Smad1 Derived Peptide Length = 36 Back     alignment and structure
>pdb|2LAZ|A Chain A, Structure Of The First Ww Domain Of Human Smurf1 In Complex With A Mono-Phosphorylated Human Smad1 Derived Peptide Length = 33 Back     alignment and structure
>pdb|3OLM|A Chain A, Structure And Function Of A Ubiquitin Binding Site Within The Catalytic Domain Of A Hect Ubiquitin Ligase Length = 429 Back     alignment and structure
>pdb|2JMF|A Chain A, Solution Structure Of The Su(Dx) Ww4- Notch Py Peptide Complex Length = 53 Back     alignment and structure
>pdb|2JO9|A Chain A, Mouse Itch 3rd Ww Domain Complex With The Epstein-Barr Virus Latent Membrane Protein 2a Derived Peptide Eeppppyed Length = 37 Back     alignment and structure
>pdb|1I5H|W Chain W, Solution Structure Of The Rnedd4 Wwiii Domain-Renac Bp2 Peptide Complex Length = 50 Back     alignment and structure
>pdb|2JOC|A Chain A, Mouse Itch 3rd Domain Phosphorylated In T30 Length = 37 Back     alignment and structure
>pdb|2LAJ|A Chain A, Third Ww Domain Of Human Nedd4l In Complex With Doubly Phosphorylated Human Smad3 Derived Peptide Length = 44 Back     alignment and structure
>pdb|2OP7|A Chain A, Ww4 Length = 39 Back     alignment and structure
>pdb|2LB2|A Chain A, Structure Of The Second Domain Of Human Nedd4l In Complex With A Phosphorylated Ptpy Motif Derived From Human Smad3 Length = 35 Back     alignment and structure
>pdb|2KPZ|A Chain A, Human Nedd4 3rd Ww Domain Complex With The Human T-Cell Leukemia Virus 1 Gag-Pro Poliprotein Derived Peptide Sdpqipppyvep Length = 49 Back     alignment and structure
>pdb|1WR4|A Chain A, Solution Structure Of The Second Ww Domain Of Nedd4-2 Length = 36 Back     alignment and structure
>pdb|2LTY|A Chain A, Nedd4l Ww2 Domain In Complex With A Smad7 Derived Peptide Length = 34 Back     alignment and structure
>pdb|2LTV|A Chain A, Yap Ww2 In Complex With A Smad7 Derived Peptide Length = 36 Back     alignment and structure
>pdb|3L4H|A Chain A, Helical Box Domain And Second Ww Domain Of The Human E3 Ubiq Protein Ligase Hecw1 Length = 109 Back     alignment and structure
>pdb|1WR7|A Chain A, Solution Structure Of The Third Ww Domain Of Nedd4-2 Length = 41 Back     alignment and structure
>pdb|2YSF|A Chain A, Solution Structure Of The Fourth Ww Domain From The Human E3 Ubiquitin-Protein Ligase Itchy Homolog, Itch Length = 40 Back     alignment and structure
>pdb|1E0M|A Chain A, Prototype Ww Domain Length = 37 Back     alignment and structure
>pdb|2LAW|A Chain A, Structure Of The Second Ww Domain From Human Yap In Complex With A Human Smad1 Derived Peptide Length = 38 Back     alignment and structure
>pdb|2L4J|A Chain A, Yap Ww2 Length = 46 Back     alignment and structure
>pdb|2YSD|A Chain A, Solution Structure Of The First Ww Domain From The Human Membrane-Associated Guanylate Kinase, Ww And Pdz Domain- Containing Protein 1. Magi-1 Length = 57 Back     alignment and structure
>pdb|1WR3|A Chain A, Solution Structure Of The First Ww Domain Of Nedd4-2 Length = 36 Back     alignment and structure
>pdb|2KYK|A Chain A, The Sandwich Region Between Two Lmp2a Py Motif Regulates The Interaction Between Aip4ww2domain And Py Motif Length = 39 Back     alignment and structure
>pdb|2YSB|A Chain A, Solution Structure Of The First Ww Domain From The Mouse Salvador Homolog 1 Protein (Sav1) Length = 49 Back     alignment and structure
>pdb|1WMV|A Chain A, Solution Structure Of The Second Ww Domain Of Wwox Length = 54 Back     alignment and structure
>pdb|1O6W|A Chain A, Solution Structure Of The Prp40 Ww Domain Pair Of The Yeast Splicing Factor Prp40 Length = 75 Back     alignment and structure
>pdb|2LAX|A Chain A, Structure Of First Ww Domain Of Human Yap In Complex With A Human Smad1 Doubly-Phosphorilated Derived Peptide Length = 40 Back     alignment and structure
>pdb|2LAY|A Chain A, Structure Of The First Ww Domain Of Human Yap In Complex With A Phosphorylated Human Smad1 Derived Peptide Length = 36 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 1e-31
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 2e-11
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 2e-07
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 9e-27
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 9e-12
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 5e-06
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 9e-21
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 7e-07
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 5e-18
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 4e-07
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 1e-17
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 2e-07
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 1e-17
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 2e-05
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 2e-17
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 2e-06
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 2e-17
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 7e-06
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 3e-17
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 1e-07
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 4e-17
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 3e-07
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 4e-17
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 6e-07
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 8e-17
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 1e-06
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 1e-16
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 1e-06
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 1e-16
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 2e-06
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} Leng 1e-16
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} Leng 2e-06
1ymz_A43 CC45; artificial protein, computational design, un 1e-16
1ymz_A43 CC45; artificial protein, computational design, un 2e-06
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 2e-16
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 6e-07
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 2e-16
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 6e-06
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 2e-16
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 2e-07
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 2e-16
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 1e-05
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 3e-16
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 3e-07
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 3e-16
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 1e-06
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 1e-04
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 4e-16
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 1e-05
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 5e-16
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 1e-05
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 4e-14
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 2e-07
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 5e-14
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 2e-05
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 3e-13
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 2e-05
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 5e-13
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 2e-06
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 2e-10
2jxw_A75 WW domain-binding protein 4; WW domain containing 8e-10
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 1e-08
1eg3_A 261 Dystrophin; EF-hand like domain, WW domain, struct 5e-06
1yw5_A 177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3tc5_A 166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 6e-04
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 7e-04
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 Back     alignment and structure
 Score =  108 bits (272), Expect = 1e-31
 Identities = 61/83 (73%), Positives = 68/83 (81%)

Query: 76  QPPDLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKELRPEQATELGNLPPGWEVRQT 135
            PPDLP GYE RTTQQGQVYF H  TGVSTWHDPR+P++L      ELG LPPGWE+R T
Sbjct: 6   SPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIRNT 65

Query: 136 ASGRYYYVDHNNRTTQFTDPRLT 158
           A+GR Y+VDHNNRTTQFTDPRL+
Sbjct: 66  ATGRVYFVDHNNRTTQFTDPRLS 88
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75 Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Length = 50 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Length = 50 Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Length = 46 Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Length = 46 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Length = 46 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Length = 46 Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Length = 53 Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Length = 53 Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Length = 39 Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Length = 39 Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Length = 38 Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Length = 38 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Length = 109 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Length = 109 Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 57 Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 57 Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Length = 36 Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Length = 36 Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Length = 49 Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Length = 49 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Length = 41 Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Length = 41 Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Length = 43 Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Length = 43 Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Length = 37 Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Length = 37 Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Length = 42 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Length = 42 Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Length = 46 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Length = 46 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Length = 49 Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Length = 49 Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Length = 36 Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Length = 36 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Length = 54 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Length = 54 Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Length = 49 Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Length = 49 Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 60 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 60 Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 49 Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Length = 429 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Length = 261 Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Length = 177 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Length = 166 Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Length = 55 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 99.93
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 99.92
3kys_B125 YAP65, 65 kDa YES-associated protein; immunoglobul 99.81
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 99.8
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 99.78
2jxw_A75 WW domain-binding protein 4; WW domain containing 99.72
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 99.67
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 99.65
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 99.59
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 99.58
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 99.58
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 99.57
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.55
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 99.54
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 99.53
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 99.53
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} 99.53
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.52
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 99.52
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 99.52
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 99.51
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 99.51
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 99.51
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 99.49
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 99.49
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 99.48
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 99.47
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 99.47
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 99.41
2ho2_A38 Fe65 protein, amyloid beta A4 protein-binding fami 99.38
1ymz_A43 CC45; artificial protein, computational design, un 99.37
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 99.37
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 99.29
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 99.25
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 99.24
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 99.24
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 99.23
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 99.23
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 99.21
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 99.2
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 99.19
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 99.19
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 99.18
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 99.18
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 99.17
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} 99.17
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.15
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 99.15
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 99.14
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.14
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 99.14
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 99.14
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 99.12
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 99.12
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 99.1
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 99.09
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 99.07
1eg3_A 261 Dystrophin; EF-hand like domain, WW domain, struct 99.07
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 99.05
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 99.03
1ymz_A43 CC45; artificial protein, computational design, un 99.03
3tc5_A 166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 98.98
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 98.98
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 98.94
2ho2_A38 Fe65 protein, amyloid beta A4 protein-binding fami 98.93
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 98.9
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 98.89
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 98.86
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 98.84
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 98.78
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 98.75
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 98.69
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 98.67
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 98.61
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 98.57
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 98.46
1eg3_A 261 Dystrophin; EF-hand like domain, WW domain, struct 98.44
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 98.42
1e0n_A27 Hypothetical protein; YJQ8WW domain, WW domain, sa 98.41
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 98.38
3olm_A 429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 98.36
2jxw_A75 WW domain-binding protein 4; WW domain containing 98.36
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 98.29
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 98.28
1e0n_A27 Hypothetical protein; YJQ8WW domain, WW domain, sa 97.96
2dk7_A73 Transcription elongation regulator 1; structural g 97.76
2dk1_A50 WW domain-binding protein 4; WBP-4, formin- bindin 97.68
2dk7_A73 Transcription elongation regulator 1; structural g 97.45
2dk1_A50 WW domain-binding protein 4; WBP-4, formin- bindin 97.2
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 96.79
3le4_A79 Microprocessor complex subunit DGCR8; WW motif, di 95.76
3le4_A79 Microprocessor complex subunit DGCR8; WW motif, di 93.97
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
Probab=99.93  E-value=2.9e-26  Score=165.55  Aligned_cols=85  Identities=72%  Similarity=1.282  Sum_probs=73.2

Q ss_pred             CCCCCCCCCcEEEECCCCceEeecCCCCeeeccCCCCCCcCCccchhccCCCCCCceEEEcCCCceEEeeCCCCeeeccC
Q psy8387          75 QQPPDLPHGYEIRTTQQGQVYFYHLPTGVSTWHDPRIPKELRPEQATELGNLPPGWEVRQTASGRYYYVDHNNRTTQFTD  154 (176)
Q Consensus        75 ~s~~~LP~gWe~~~~~~GrvYY~nh~TrtTsW~~P~~~~~~~~~~~~~~~~LP~GWE~~~d~~Gr~YYiNh~tr~TtWed  154 (176)
                      .+..+||+||+++++.+|++|||||.|++++|++|+....+.........+||.|||+++|.+|++|||||+|++|+|+|
T Consensus         5 ~~~~~LP~gWe~~~~~~Gr~YY~n~~t~~t~W~~P~~~~~~~~~~~~~~~~LP~gWe~~~~~~G~~Yy~n~~t~~t~w~~   84 (90)
T 2kxq_A            5 GSPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTD   84 (90)
T ss_dssp             SSCCSCCSSCEEEEETTTEEEEEETTTTEEESSCSSSCSSSCSCCGGGTCCCCSSCCEEECTTSCEEEEETTTTEEESSC
T ss_pred             CCCCCCCCCcEEEECCCCCEEEEECCCCeEeeecccccccccccCcccccccCCCceEEECCCCCEEEEECCCCcEecCC
Confidence            44567999999999999999999999999999999976543322223456899999999999999999999999999999


Q ss_pred             CCCcH
Q psy8387         155 PRLTP  159 (176)
Q Consensus       155 Prl~~  159 (176)
                      ||+.+
T Consensus        85 Pr~~~   89 (90)
T 2kxq_A           85 PRLSA   89 (90)
T ss_dssp             TTTSC
T ss_pred             CCcCC
Confidence            99863
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>3kys_B YAP65, 65 kDa YES-associated protein; immunoglobulin-like fold, activator, disease mutation, DNA- binding, nucleus, phosphoprotein, transcription; 2.80A {Homo sapiens} PDB: 3jua_B Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Back     alignment and structure
>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Back     alignment and structure
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Back     alignment and structure
>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Back     alignment and structure
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Back     alignment and structure
>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 Back     alignment and structure
>2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>3le4_A Microprocessor complex subunit DGCR8; WW motif, dimerization, 3D domain swapping, heme binding, MI processing, heme, iron, metal-binding, nucleus; 1.70A {Homo sapiens} Back     alignment and structure
>3le4_A Microprocessor complex subunit DGCR8; WW motif, dimerization, 3D domain swapping, heme binding, MI processing, heme, iron, metal-binding, nucleus; 1.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 176
d1i5hw_50 b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain 1e-16
d1i5hw_50 b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain 8e-09
d1tk7a145 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) 1e-15
d1tk7a145 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) 1e-08
d2jmfa133 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII 9e-15
d2jmfa133 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII 9e-08
d1jmqa_46 b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens 8e-14
d1jmqa_46 b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens 5e-09
d1pina134 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho 1e-10
d1pina134 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho 3e-05
d2rm0w137 b.72.1.1 (W:1-37) Formin binding protein FBP28 dom 1e-05
d2rm0w137 b.72.1.1 (W:1-37) Formin binding protein FBP28 dom 5e-04
d1o6wa246 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's 5e-05
d1o6wa246 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's 6e-05
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 Back     information, alignment and structure

class: All beta proteins
fold: WW domain-like
superfamily: WW domain
family: WW domain
domain: Ubiquitin ligase NEDD4 WWIII domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 67.5 bits (165), Expect = 1e-16
 Identities = 20/46 (43%), Positives = 29/46 (63%)

Query: 117 PEQATELGNLPPGWEVRQTASGRYYYVDHNNRTTQFTDPRLTPAII 162
           P  + +LG LPPGWE R    GR ++++HN + TQ+ DPR+    I
Sbjct: 3   PVDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRMQNVAI 48
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 45 Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 45 Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 33 Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 33 Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 46 Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 46 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
d2jmfa133 Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr 99.69
d1tk7a145 Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso 99.6
d1i5hw_50 Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n 99.58
d1jmqa_46 Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 99.54
d2jmfa133 Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr 99.39
d1pina134 Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId 99.35
d1jmqa_46 Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 99.25
d1tk7a145 Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso 99.21
d1i5hw_50 Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n 99.19
d1pina134 Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId 98.97
d2rm0w137 Formin binding protein FBP28 domain {Domestic mous 98.85
d1o6wa246 Splicing factor prp40 {Baker's yeast (Saccharomyce 98.74
d1o6wa129 Splicing factor prp40 {Baker's yeast (Saccharomyce 98.68
d1ywia128 Huntingtin-interacting protein HYPA/FBP11 {Human ( 98.65
d2rm0w137 Formin binding protein FBP28 domain {Domestic mous 98.56
d2ho2a133 Amyloid beta A4 precursor protein-binding family B 98.51
d2dk1a138 WW domain-binding protein 4, WBP4 {Human (Homo sap 98.28
d1o6wa129 Splicing factor prp40 {Baker's yeast (Saccharomyce 98.28
d1o6wa246 Splicing factor prp40 {Baker's yeast (Saccharomyce 98.26
d1ywia128 Huntingtin-interacting protein HYPA/FBP11 {Human ( 98.25
d2ho2a133 Amyloid beta A4 precursor protein-binding family B 98.23
d2dk1a138 WW domain-binding protein 4, WBP4 {Human (Homo sap 97.97
d1eg3a338 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 97.64
d1eg3a338 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 96.69
d2ysca126 Amyloid beta A4 precursor protein-binding family B 96.23
d2ysca126 Amyloid beta A4 precursor protein-binding family B 94.39
d1e0na_27 Hypothetical protein Yjq8 (Set2p) {Baker's yeast ( 86.5
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All beta proteins
fold: WW domain-like
superfamily: WW domain
family: WW domain
domain: Ubiquitin ligase NEDD4 WWIII domain
species: fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.69  E-value=7.6e-18  Score=99.25  Aligned_cols=33  Identities=64%  Similarity=1.272  Sum_probs=31.9

Q ss_pred             CCCCCCceEEEcCCCceEEeeCCCCeeeccCCC
Q psy8387         124 GNLPPGWEVRQTASGRYYYVDHNNRTTQFTDPR  156 (176)
Q Consensus       124 ~~LP~GWE~~~d~~Gr~YYiNh~tr~TtWedPr  156 (176)
                      ++||+|||+++|.+|++|||||+|++|+|+|||
T Consensus         1 GpLP~GWe~~~d~~G~~Yyinh~t~~T~w~~PR   33 (33)
T d2jmfa1           1 GPLPPGWEIRYTAAGERFFVDHNTRRTTFEDPR   33 (33)
T ss_dssp             SCCCTTEEEEECTTSCEEEEETTTCCEESSCCC
T ss_pred             CccCCCeeEEECCCCCEEEEECCCCcEecCCCC
Confidence            479999999999999999999999999999997
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ysca1 b.72.1.1 (A:8-33) Amyloid beta A4 precursor protein-binding family B member 3, APBB3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ysca1 b.72.1.1 (A:8-33) Amyloid beta A4 precursor protein-binding family B member 3, APBB3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0na_ b.72.1.1 (A:) Hypothetical protein Yjq8 (Set2p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure