Psyllid ID: psy8389

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MDNKVKKRQRLLATLERKFSGKVLGGGKQNGGTGGSVDANIRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGFSFRKEVF
ccHHHHHHHHHHHHHHHHccccEEcccccccccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHcccccEEEccccc
cccHHHHHHHHHHHHHHHccccEEccccccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHccEEEEEEEHccccHHHHHcccccEEEccccccccccccHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHccEEEEcccc
MDNKVKKRQRLLATLERKfsgkvlgggkqnggtggsvdanIRGKMVVFknhhgasgytnesfcslpedfkmgniGVYCFsltnspyplssqeKRDLITGLktrtnagrpnwDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGFSFRKEVF
MDNKVKKRQRLLATlerkfsgkvlgggkqnggtggsvdANIRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLktrtnagrpnwdRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGFSFRKEVF
MDNKVKKRQRLLATLERKFSgkvlgggkqnggtggSVDANIRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGFSFRKEVF
************************************VDANIRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYP*******DLITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGFSF*****
******************************************GKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGFSFRKEVF
********QRLLATLERKFSGKVLGGGKQNGGTGGSVDANIRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGFSFRKEVF
*DNKVKKRQRLLATLERKFSGKVLGG*******GGSVDANIRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGFSFRKE**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNKVKKRQRLLATLERKFSGKVLGGGKQNGGTGGSVDANIRGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGFSFRKEVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
Q96PH1765 NADPH oxidase 5 OS=Homo s yes N/A 0.442 0.090 0.536 2e-18
P52649484 Cytochrome b-245 heavy ch yes N/A 0.378 0.121 0.433 4e-08
Q9WV87563 NADPH oxidase 1 OS=Rattus yes N/A 0.397 0.110 0.422 5e-08
Q9Y5S8564 NADPH oxidase 1 OS=Homo s no N/A 0.762 0.210 0.3 5e-08
Q8CIZ9591 NADPH oxidase 1 OS=Mus mu yes N/A 0.397 0.104 0.408 6e-08
Q9HBY0568 NADPH oxidase 3 OS=Homo s no N/A 0.416 0.114 0.378 8e-08
Q948U0963 Respiratory burst oxidase N/A N/A 0.397 0.064 0.405 2e-07
O46522570 Cytochrome b-245 heavy ch no N/A 0.391 0.107 0.435 3e-07
Q95L74570 Cytochrome b-245 heavy ch N/A N/A 0.391 0.107 0.435 3e-07
Q9LZU9912 Putative respiratory burs yes N/A 0.397 0.067 0.376 4e-07
>sp|Q96PH1|NOX5_HUMAN NADPH oxidase 5 OS=Homo sapiens GN=NOX5 PE=1 SV=1 Back     alignment and function desciption
 Score = 91.3 bits (225), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/69 (53%), Positives = 54/69 (78%)

Query: 88  LSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQF 147
           L+++EK+D ITGL+TRT  GRP+W +VF+ +  +KKGKV VF+CG P LA++L+  C++F
Sbjct: 697 LANKEKKDSITGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKF 756

Query: 148 GFSFRKEVF 156
           GF F +E F
Sbjct: 757 GFRFFQENF 765
Calcium-dependent NADPH oxidase that generates superoxide. Also functions as a calcium-dependent proton channel and may regulate redox-dependent processes in lymphocytes and spermatozoa. May play a role in cell growth and apoptosis. Isoform v2 and isoform v5 are involved in endothelial generation of reactive oxygen species (ROS), proliferation and angiogenesis and contribute to endothelial response to thrombin.
Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 6EC: .EC: 3EC: .EC: -
>sp|P52649|CY24B_PIG Cytochrome b-245 heavy chain (Fragment) OS=Sus scrofa GN=CYBB PE=2 SV=2 Back     alignment and function description
>sp|Q9WV87|NOX1_RAT NADPH oxidase 1 OS=Rattus norvegicus GN=Nox1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y5S8|NOX1_HUMAN NADPH oxidase 1 OS=Homo sapiens GN=NOX1 PE=1 SV=2 Back     alignment and function description
>sp|Q8CIZ9|NOX1_MOUSE NADPH oxidase 1 OS=Mus musculus GN=Nox1 PE=1 SV=2 Back     alignment and function description
>sp|Q9HBY0|NOX3_HUMAN NADPH oxidase 3 OS=Homo sapiens GN=NOX3 PE=1 SV=1 Back     alignment and function description
>sp|Q948U0|RBOHA_SOLTU Respiratory burst oxidase homolog protein A OS=Solanum tuberosum GN=RBOHA PE=1 SV=1 Back     alignment and function description
>sp|O46522|CY24B_BOVIN Cytochrome b-245 heavy chain OS=Bos taurus GN=CYBB PE=2 SV=1 Back     alignment and function description
>sp|Q95L74|CY24B_BISBI Cytochrome b-245 heavy chain OS=Bison bison GN=CYBB PE=2 SV=1 Back     alignment and function description
>sp|Q9LZU9|RBOHJ_ARATH Putative respiratory burst oxidase homolog protein J OS=Arabidopsis thaliana GN=RBOHJ PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
151427582 732 TPA: predicted NADPH oxidase [Apis melli 0.416 0.088 0.907 9e-31
345485658 1158 PREDICTED: LOW QUALITY PROTEIN: NADPH ox 0.442 0.059 0.855 8e-30
242015786 973 NADPH oxidase, putative [Pediculus human 0.442 0.070 0.869 2e-29
270010804 1108 hypothetical protein TcasGA2_TC013283 [T 0.442 0.062 0.855 5e-29
189239162 1137 PREDICTED: similar to AGAP008072-PA [Tri 0.442 0.060 0.855 5e-29
328781962 1084 PREDICTED: NADPH oxidase 5 [Apis mellife 0.416 0.059 0.907 6e-29
380028229 1098 PREDICTED: LOW QUALITY PROTEIN: NADPH ox 0.416 0.059 0.907 6e-29
328705704 1175 PREDICTED: NADPH oxidase 5-like [Acyrtho 0.442 0.058 0.840 9e-29
350423341 1106 PREDICTED: NADPH oxidase 5-like isoform 0.442 0.062 0.869 3e-28
350423344 1087 PREDICTED: NADPH oxidase 5-like isoform 0.442 0.063 0.869 3e-28
>gi|151427582|tpd|FAA00348.1| TPA: predicted NADPH oxidase [Apis mellifera] Back     alignment and taxonomy information
 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 59/65 (90%), Positives = 62/65 (95%)

Query: 92  EKRDLITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQFGFSF 151
           EKRDLITGLKTRTNAGRPNWD+VFKHL DQKKGKVT+FYCGPPQLARILR KCDQFGF+F
Sbjct: 668 EKRDLITGLKTRTNAGRPNWDKVFKHLQDQKKGKVTIFYCGPPQLARILRYKCDQFGFNF 727

Query: 152 RKEVF 156
           RKE F
Sbjct: 728 RKESF 732

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345485658|ref|XP_003425313.1| PREDICTED: LOW QUALITY PROTEIN: NADPH oxidase 5-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242015786|ref|XP_002428528.1| NADPH oxidase, putative [Pediculus humanus corporis] gi|212513162|gb|EEB15790.1| NADPH oxidase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270010804|gb|EFA07252.1| hypothetical protein TcasGA2_TC013283 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189239162|ref|XP_972375.2| PREDICTED: similar to AGAP008072-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328781962|ref|XP_391999.3| PREDICTED: NADPH oxidase 5 [Apis mellifera] Back     alignment and taxonomy information
>gi|380028229|ref|XP_003697810.1| PREDICTED: LOW QUALITY PROTEIN: NADPH oxidase 5-like [Apis florea] Back     alignment and taxonomy information
>gi|328705704|ref|XP_003242881.1| PREDICTED: NADPH oxidase 5-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|350423341|ref|XP_003493450.1| PREDICTED: NADPH oxidase 5-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350423344|ref|XP_003493451.1| PREDICTED: NADPH oxidase 5-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
FB|FBgn00854281340 Nox "NADPH oxidase" [Drosophil 0.442 0.051 0.782 1.1e-24
UNIPROTKB|F1PQ38765 NOX5 "Uncharacterized protein" 0.442 0.090 0.550 1.3e-16
UNIPROTKB|F1NC63760 NOX5 "Uncharacterized protein" 0.442 0.090 0.521 3.6e-16
UNIPROTKB|A7E3L4755 Nox5 "Uncharacterized protein" 0.442 0.091 0.550 4.5e-16
UNIPROTKB|Q96PH1765 NOX5 "NADPH oxidase 5" [Homo s 0.442 0.090 0.536 4.6e-16
UNIPROTKB|F1NVG4568 NOX3 "Uncharacterized protein" 0.384 0.105 0.442 5.8e-09
RGD|1303190568 Nox3 "NADPH oxidase 3" [Rattus 0.378 0.103 0.383 3.3e-08
UNIPROTKB|Q672K1568 Nox3 "NADPH oxidase 3" [Rattus 0.378 0.103 0.383 3.3e-08
UNIPROTKB|A6NGA6527 NOX1 "NADPH oxidase 1" [Homo s 0.705 0.208 0.317 4.8e-08
UNIPROTKB|F1RXS6468 GP91-PHOX "Uncharacterized pro 0.378 0.126 0.433 5.1e-08
FB|FBgn0085428 Nox "NADPH oxidase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 295 (108.9 bits), Expect = 1.1e-24, P = 1.1e-24
 Identities = 54/69 (78%), Positives = 60/69 (86%)

Query:    88 LSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLDQKKGKVTVFYCGPPQLARILRLKCDQF 147
             L  + KRDLITGLKTRTNAGRPNWD+VFK L  Q+KGKVTVFYCGPPQLA+ LR KCDQ+
Sbjct:  1272 LHEKGKRDLITGLKTRTNAGRPNWDKVFKQLQAQQKGKVTVFYCGPPQLAKTLRYKCDQY 1331

Query:   148 GFSFRKEVF 156
             GF+FRKE F
Sbjct:  1332 GFAFRKECF 1340
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
UNIPROTKB|F1PQ38 NOX5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NC63 NOX5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A7E3L4 Nox5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96PH1 NOX5 "NADPH oxidase 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVG4 NOX3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1303190 Nox3 "NADPH oxidase 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q672K1 Nox3 "NADPH oxidase 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A6NGA6 NOX1 "NADPH oxidase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RXS6 GP91-PHOX "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96PH1NOX5_HUMAN1, ., 6, ., 3, ., -0.53620.44230.0901yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
pfam08030149 pfam08030, NAD_binding_6, Ferric reductase NAD bin 4e-11
>gnl|CDD|203841 pfam08030, NAD_binding_6, Ferric reductase NAD binding domain Back     alignment and domain information 
 Score = 57.0 bits (138), Expect = 4e-11
 Identities = 26/109 (23%), Positives = 43/109 (39%), Gaps = 16/109 (14%)

Query: 47  VFKNHHGASGYTNESFCSLPEDFKMGNIGVYCF-------------SLTNSPYPLSSQEK 93
             ++      + +     L E  ++GNI ++ +             S +       S+  
Sbjct: 40  AVRDLSSLEWFKD-VLNELEELKELGNIEIHIYLTGEYEAEDASDASDSEQISMFDSKNH 98

Query: 94  RDLITGLKTRTNAGRPNWDRVFKHLLDQK-KGKVTVFYCGPPQLARILR 141
            + I+G +   + GRPNW  V K +  Q     + VF CGPP L   LR
Sbjct: 99  -EEISGTRVEFHFGRPNWKEVLKDIAKQHPNNSIGVFCCGPPSLVDELR 146

Length = 149

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
KOG0039|consensus646 99.89
PF08030156 NAD_binding_6: Ferric reductase NAD binding domain 99.74
PLN02844722 oxidoreductase/ferric-chelate reductase 99.08
PLN02631699 ferric-chelate reductase 98.82
PLN02292702 ferric-chelate reductase 98.82
cd06186210 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyz 98.73
cd06184247 flavohem_like_fad_nad_binding FAD_NAD(P)H binding 97.22
cd06215231 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferr 97.01
cd06216243 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferr 96.97
PRK08051232 fre FMN reductase; Validated 96.93
cd06190232 T4MO_e_transfer_like Toluene-4-monoxygenase electr 96.63
cd06185211 PDR_like Phthalate dioxygenase reductase (PDR) is 96.59
PF00175109 NAD_binding_1: Oxidoreductase NAD-binding domain ; 96.59
cd06211238 phenol_2-monooxygenase_like Phenol 2-monooxygenase 96.57
cd06191231 FNR_iron_sulfur_binding Iron-sulfur binding Ferred 96.49
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 96.29
cd06189224 flavin_oxioreductase NAD(P)H dependent flavin oxid 96.26
cd06212232 monooxygenase_like The oxygenase reductase FAD/NAD 96.22
cd06214241 PA_degradation_oxidoreductase_like NAD(P) binding 96.19
cd06197220 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin 96.17
cd06210236 MMO_FAD_NAD_binding Methane monooxygenase (MMO) re 95.96
cd06194222 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding 95.83
COG4097438 Predicted ferric reductase [Inorganic ion transpor 95.64
TIGR02160 352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 95.44
cd06183234 cyt_b5_reduct_like Cytochrome b5 reductase catalyz 95.31
PRK13289399 bifunctional nitric oxide dioxygenase/dihydropteri 95.17
cd06195241 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-c 94.97
cd06198216 FNR_like_3 NAD(P) binding domain of ferredoxin red 94.66
cd06217235 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferr 94.56
cd06188283 NADH_quinone_reductase Na+-translocating NADH:quin 94.33
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 93.99
cd06209228 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenD 93.97
cd06221253 sulfite_reductase_like Anaerobic sulfite reductase 93.72
cd06213227 oxygenase_e_transfer_subunit The oxygenase reducta 93.67
cd06187224 O2ase_reductase_like The oxygenase reductase FAD/N 92.85
PRK11872340 antC anthranilate dioxygenase reductase; Provision 92.84
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 92.48
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electro 91.99
PRK05713312 hypothetical protein; Provisional 91.45
PRK05464409 Na(+)-translocating NADH-quinone reductase subunit 90.71
KOG0534|consensus286 90.68
cd00322223 FNR_like Ferredoxin reductase (FNR), an FAD and NA 90.54
PRK10926248 ferredoxin-NADP reductase; Provisional 90.38
TIGR01941405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 90.16
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 90.14
PRK07609339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 90.03
cd06196218 FNR_like_1 Ferredoxin reductase-like proteins cata 89.79
cd06208286 CYPOR_like_FNR These ferredoxin reductases are rel 89.29
cd06193235 siderophore_interacting Siderophore interacting pr 89.15
PLN03116307 ferredoxin--NADP+ reductase; Provisional 89.08
cd06201289 SiR_like2 Cytochrome p450- like alpha subunits of 88.35
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron 88.26
cd06200245 SiR_like1 Cytochrome p450- like alpha subunits of 88.13
cd06182267 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) 87.35
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 85.6
cd06206384 bifunctional_CYPOR These bifunctional proteins fus 85.5
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 85.1
COG1018266 Hmp Flavodoxin reductases (ferredoxin-NADPH reduct 85.08
COG0543252 UbiB 2-polyprenylphenol hydroxylase and related fl 84.3
PRK08221263 anaerobic sulfite reductase subunit B; Provisional 83.03
PLN03115367 ferredoxin--NADP(+) reductase; Provisional 82.72
PLN02292 702 ferric-chelate reductase 82.18
PTZ00274325 cytochrome b5 reductase; Provisional 82.13
TIGR02911261 sulfite_red_B sulfite reductase, subunit B. Member 81.97
TIGR03224411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p 81.75
PRK05802320 hypothetical protein; Provisional 80.89
cd06207382 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) 80.32
>KOG0039|consensus Back     alignment and domain information 
Probab=99.89  E-value=1.2e-23  Score=194.71  Aligned_cols=117  Identities=32%  Similarity=0.533  Sum_probs=102.9

Q ss_pred             CcceeEEEEE---ecCCcccchhHhhcCccccccC--CcceeEEecccC-----------CCCCCcccCccccccCCccc
Q psy8389          40 NIRGKMVVFK---NHHGASGYTNESFCSLPEDFKM--GNIGVYCFSLTN-----------SPYPLSSQEKRDLITGLKTR  103 (156)
Q Consensus        40 ~~k~kkVyFi---R~~~~feWf~dll~eVe~~d~~--~~IhiylT~~~~-----------~~e~~~~~~~~d~iTgLrs~  103 (156)
                      ..+++++||+   |++++|+||.+++.+|++.+..  .++|+|+|+.-.           .+...+...+.|+.+|+++.
T Consensus       507 ~~~~~~~~F~Wv~~~~~sf~wf~~~l~~v~~~~~~~~~e~~~~~t~~~~~~d~~~~~~~~~~~~~~~~~~~di~~g~~~~  586 (646)
T KOG0039|consen  507 SLKLKKVYFYWVTREQRSFEWFKGLLTEVEEYDSSGVIELHNYVTSSYEEGDARSALIQMVQKLLHAKNGVDIVTGLKVE  586 (646)
T ss_pred             cceecceeEEEEeccccchHHHHHHHHHHHHHHhcCCchhheehhHhHhhhhhhhHHHHHHHhhcccccCccccccceee
Confidence            5799999999   9999999999999999998864  589999996422           12333556778999999999


Q ss_pred             cccCCCChHHHHHHHHhcCC-CeeEEEEeCChhhHHHHHhhcccc------ceeEeccCC
Q psy8389         104 TNAGRPNWDRVFKHLLDQKK-GKVTVFYCGPPQLARILRLKCDQF------GFSFRKEVF  156 (156)
Q Consensus       104 ThfGRPnw~~if~~v~~~~~-~~VGVF~CGP~~L~~~l~~~c~~~------~F~fhkEnF  156 (156)
                      +|+|||||+++|++++..|+ .+||||+||||+|.+++++.|.++      .|.||+|+|
T Consensus       587 ~~~gRPn~~~~~~~~~~~~~~~~vgVf~CGp~~l~~~~~~~~~~~~~~~~~~~~f~~E~F  646 (646)
T KOG0039|consen  587 THFGRPNWKEVFKEIAKSHPNVRVGVFSCGPPGLVKELRKLCNDFSSSTATRFEFHKENF  646 (646)
T ss_pred             eeCCCCCHHHHHHHHHhhCCCceEEEEEeCCHHHHHHHHHHHHhcccccCceeeeeeccC
Confidence            99999999999999999987 579999999999999999999997      399999998

>PF08030 NAD_binding_6: Ferric reductase NAD binding domain; InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins Back     alignment and domain information
>PLN02844 oxidoreductase/ferric-chelate reductase Back     alignment and domain information
>PLN02631 ferric-chelate reductase Back     alignment and domain information
>PLN02292 ferric-chelate reductase Back     alignment and domain information
>cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide Back     alignment and domain information
>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin Back     alignment and domain information
>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>PRK08051 fre FMN reductase; Validated Back     alignment and domain information
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system Back     alignment and domain information
>cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster Back     alignment and domain information
>PF00175 NAD_binding_1: Oxidoreductase NAD-binding domain ; InterPro: IPR001433 Bacterial ferredoxin-NADP+ reductase may be bound to the thylakoid membrane or anchored to the thylakoid-bound phycobilisomes Back     alignment and domain information
>cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol Back     alignment and domain information
>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins Back     alignment and domain information
>cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase Back     alignment and domain information
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin reductase-like proteins Back     alignment and domain information
>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol Back     alignment and domain information
>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain Back     alignment and domain information
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor Back     alignment and domain information
>PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional Back     alignment and domain information
>cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin Back     alignment and domain information
>cd06198 FNR_like_3 NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>KOG0534|consensus Back     alignment and domain information
>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>PRK10926 ferredoxin-NADP reductase; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain Back     alignment and domain information
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family Back     alignment and domain information
>PLN03116 ferredoxin--NADP+ reductase; Provisional Back     alignment and domain information
>cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] Back     alignment and domain information
>COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08221 anaerobic sulfite reductase subunit B; Provisional Back     alignment and domain information
>PLN03115 ferredoxin--NADP(+) reductase; Provisional Back     alignment and domain information
>PLN02292 ferric-chelate reductase Back     alignment and domain information
>PTZ00274 cytochrome b5 reductase; Provisional Back     alignment and domain information
>TIGR02911 sulfite_red_B sulfite reductase, subunit B Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
3a1f_A186 The Crystal Structure Of Nadph Binding Domain Of Gp 2e-08
>pdb|3A1F|A Chain A, The Crystal Structure Of Nadph Binding Domain Of Gp91(Phox) Length = 186 Back     alignment and structure 
Iteration: 1

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
Query: 86  YPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLDQKKG-KVTVFYCGPPQLARIL 140
           + +   E++D+ITGLK +T  GRPNWD  FK +  Q    ++ VF CGP  LA  L
Sbjct: 107 FAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETL 162

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
3a1f_A186 Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi 6e-13
>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Length = 186 Back     alignment and structure
 Score = 62.1 bits (150), Expect = 6e-13
 Identities = 30/77 (38%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 89  SSQEKRDLITGLKTRTNAGRPNWDRVFKHLLDQKKG-KVTVFYCGPPQLARILRLKCDQF 147
              E++D+ITGLK +T  GRPNWD  FK +  Q    ++ VF CGP  LA  L  +    
Sbjct: 110 HHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISN 169

Query: 148 --------GFSFRKEVF 156
                    F F KE F
Sbjct: 170 SESGPRGVHFIFNKENF 186

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
3a1f_A186 Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi 99.62
4g1v_A399 Flavohemoglobin; three domains: globin fold, antip 97.76
1tvc_A250 Methane monooxygenase component C, methane monooxy 97.51
4eh1_A243 Flavohemoprotein; structural genomics, niaid, nati 97.42
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 97.37
1qfj_A232 Protein (flavin reductase); riboflavin, ferredoxin 97.23
3jqq_A316 Ferredoxin NADP reductase; FAD, oxidoreductase; HE 97.19
2r6h_A290 NADH:ubiquinone oxidoreductase, Na translocating, 97.08
2eix_A243 NADH-cytochrome B5 reductase; flavoprotein, FAD-bi 97.04
1cqx_A403 Flavohemoprotein; globin fold, six-stranded antipa 96.72
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 96.44
1gvh_A396 Flavohemoprotein; oxidoreductase, NADP, heme, flav 96.4
3vo2_A310 Putative uncharacterized protein; rossmann fold, o 95.94
3lo8_A311 Ferredoxin--NADP reductase; electron transport, ox 95.67
3lyu_A142 Putative hydrogenase; the C-terminal has AN alpha- 95.43
2cnd_A270 NADH-dependent nitrate reductase; nitrate assimila 95.29
2bmw_A304 Ferredoxin--NADP reductase; oxidoreductase, flavop 95.27
1umk_A275 B5R, NADH-cytochrome B5 reductase; flavoprotein, b 95.08
3lrx_A158 Putative hydrogenase; alpha-beta protein, structur 94.93
4fk8_A271 Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st 94.48
2b5o_A402 FNR, ferredoxin--NADP reductase; complex with FAD, 94.0
2bgi_A272 Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi 93.57
2qdx_A257 Ferredoxin reductase; oxidoreductase; HET: FAD; 1. 93.41
2gpj_A252 Siderophore-interacting protein; structural genomi 92.35
1fdr_A248 Flavodoxin reductase; ferredoxin reductase, flavin 90.9
1fnb_A314 Ferredoxin-NADP+ reductase; oxidoreductase (NADP+( 89.85
1ep3_B262 Dihydroorotate dehydrogenase B (PYRK subunit); het 89.65
4dql_A393 Bifunctional P-450/NADPH-P450 reductase; rossmann 89.25
1f20_A435 Nitric-oxide synthase; nitric-xoide synthase, redu 87.11
2rc5_A314 Ferredoxin-NADP reductase; FAD, oxidoreductase; HE 84.13
1ddg_A374 Sulfite reductase (NADPH) flavoprotein alpha- comp 81.18
>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Back     alignment and structure
Probab=99.62  E-value=1.1e-15  Score=115.40  Aligned_cols=117  Identities=29%  Similarity=0.431  Sum_probs=79.4

Q ss_pred             CcceeEEEEEecCCcccchhHhhcCccccc------cCCcceeEEecccCCCCC---CcccCccccccCCccccccCCCC
Q psy8389          40 NIRGKMVVFKNHHGASGYTNESFCSLPEDF------KMGNIGVYCFSLTNSPYP---LSSQEKRDLITGLKTRTNAGRPN  110 (156)
Q Consensus        40 ~~k~kkVyFiR~~~~feWf~dll~eVe~~d------~~~~IhiylT~~~~~~e~---~~~~~~~d~iTgLrs~ThfGRPn  110 (156)
                      .-++..+|..|+..++.||.+.|.++.+..      ..-.+++|+|........   .....+.+.++++...++.||||
T Consensus        52 ~~~v~l~~~~r~~~~~~w~~~~l~~l~~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~gR~~  131 (186)
T 3a1f_A           52 LKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPN  131 (186)
T ss_dssp             CCEEEEEEEESCTTTTHHHHHHHHHHHHHHHHTTCTTSEEEEEEETTC-----------------------CCEEESCCC
T ss_pred             CcEEEEEEEECCcchHHHHHHHHHHHHHHHhhccCCCeEEEEEEEcCCCCCcccceeeccccccccCCCCccccccCCCC
Confidence            456778888899999999999999887641      123467888843211000   00111235567777788899999


Q ss_pred             hHHHHHHHHhcCC-CeeEEEEeCChhhHHHHHhhcccc--------ceeEeccCC
Q psy8389         111 WDRVFKHLLDQKK-GKVTVFYCGPPQLARILRLKCDQF--------GFSFRKEVF  156 (156)
Q Consensus       111 w~~if~~v~~~~~-~~VGVF~CGP~~L~~~l~~~c~~~--------~F~fhkEnF  156 (156)
                      ++.+++.+....+ ..+.||+|||++|.+.+++++.+.        +|.||+|+|
T Consensus       132 ~~~~~~~~~~~~~~~~~~v~~CGP~~m~~~v~~~l~~~g~~~~~~~~~~~~~E~F  186 (186)
T 3a1f_A          132 WDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF  186 (186)
T ss_dssp             HHHHHHHHHHHSTTCEEEEEEESCHHHHHHHHHHHHHTCCCSTTCCEEEEECCCC
T ss_pred             HHHHHHHHHHhCCCCcEEEEEeCCHHHHHHHHHHHHHhhccCCCCCEEEEEeccC
Confidence            9999999876654 689999999999999999998654        288999998
>4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A* Back     alignment and structure
>1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Back     alignment and structure
>4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Back     alignment and structure
>3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* Back     alignment and structure
>2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} Back     alignment and structure
>2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} Back     alignment and structure
>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Back     alignment and structure
>3vo2_A Putative uncharacterized protein; rossmann fold, oxidoreductase, FAD binding; HET: FAD; 1.39A {Zea mays} PDB: 3vo1_A* 1gaw_A* 1gaq_A* 1qg0_A* 4af6_A* 1qga_A* 1qfz_A* 1qfy_A* 4af7_A* 1sm4_A* 3mhp_A* 1fnb_A* 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 2xnc_A* Back     alignment and structure
>3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* Back     alignment and structure
>3lyu_A Putative hydrogenase; the C-terminal has AN alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.30A {Pyrococcus furiosus} Back     alignment and structure
>2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* Back     alignment and structure
>2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... Back     alignment and structure
>1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* Back     alignment and structure
>3lrx_A Putative hydrogenase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.60A {Pyrococcus furiosus} Back     alignment and structure
>4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* Back     alignment and structure
>2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} Back     alignment and structure
>2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Back     alignment and structure
>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Back     alignment and structure
>2gpj_A Siderophore-interacting protein; structural genomics, joint for structural genomics, JCSG; HET: FAD; 2.20A {Shewanella putrefaciens} Back     alignment and structure
>1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* Back     alignment and structure
>1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A* Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Back     alignment and structure
>4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* Back     alignment and structure
>1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 Back     alignment and structure
>2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* Back     alignment and structure
>1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 156
d2bpa1_426 b.121.5.1 (1:) Microvirus capsid proteins {Bacteri 4e-04

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d1cqxa3142 Flavohemoglobin, C-terminal domain {Alcaligenes eu 97.95
d1tvca2141 Methane monooxygenase component C, MmoC {Methyloco 97.94
d1gvha3143 Flavohemoglobin, C-terminal domain {Escherichia co 97.31
d2piaa2120 Phthalate dioxygenase reductase {Pseudomonas cepac 97.23
d1krha2133 Benzoate dioxygenase reductase {Acinetobacter sp. 96.94
d1umka2147 cytochrome b5 reductase {Human (Homo sapiens) [Tax 96.12
d1fdra2148 Ferredoxin reductase (flavodoxin reductase) {Esche 95.88
d1qfja2135 NAD(P)H:flavin oxidoreductase {Escherichia coli [T 95.84
d2cnda2146 Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} 95.68
d2bmwa2162 Ferredoxin reductase (flavodoxin reductase) {Cyano 95.68
d1a8pa2158 Ferredoxin reductase (flavodoxin reductase) {Azoto 95.27
d1fnda2160 Ferredoxin reductase (flavodoxin reductase) {Spina 94.62
d1jb9a2154 Ferredoxin reductase (flavodoxin reductase) {Maize 93.3
d1f20a2165 Neuronal nitric-oxide synthase FAD/NADP+ domain {R 92.72
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 91.93
d1ja1a3160 NADPH-cytochrome p450 reductase {Rat (Rattus norve 85.24
d1ddga2153 Sulfite reductase flavoprotein {Escherichia coli [ 82.38
>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ferredoxin reductase-like, C-terminal NADP-linked domain
superfamily: Ferredoxin reductase-like, C-terminal NADP-linked domain
family: Flavohemoglobin, C-terminal domain
domain: Flavohemoglobin, C-terminal domain
species: Alcaligenes eutrophus [TaxId: 106590]

Probab=97.95  E-value=1e-05  Score=57.00  Aligned_cols=99  Identities=13%  Similarity=0.116  Sum_probs=57.8

Q ss_pred             ceeEEEEEecCCcccchhHhhcCccccccCCcceeEEecccCCCCCCcccCccccccCCccccccCCCChHHHHHHHHhc
Q psy8389          42 RGKMVVFKNHHGASGYTNESFCSLPEDFKMGNIGVYCFSLTNSPYPLSSQEKRDLITGLKTRTNAGRPNWDRVFKHLLDQ  121 (156)
Q Consensus        42 k~kkVyFiR~~~~feWf~dll~eVe~~d~~~~IhiylT~~~~~~e~~~~~~~~d~iTgLrs~ThfGRPnw~~if~~v~~~  121 (156)
                      ++..+|..|+..+..+..++..-.... ..-.++.++|+...  +.        ..  .....+.++.....+-+.+.  
T Consensus        34 ~i~li~~~r~~~~l~~~~~~~~~~~~~-~~~~~~~~~~~~~~--~~--------~~--~~~~~~~~~~~~~~~~~~~~--   98 (142)
T d1cqxa3          34 QVVFVHGARNSAVHAMRDRLREAAKTY-ENLDLFVFYDQPLP--ED--------VQ--GRDYDYPGLVDVKQIEKSIL--   98 (142)
T ss_dssp             CEEEEEEESCSSSCHHHHHHHHHHHHC-TTEEEEEEESSCCT--TC--------CB--TTTBSEESSCCGGGSHHHHC--
T ss_pred             cEEEEeeccChhhhhhHHHHHHHHHhC-CCeEEEEEEcccCC--cc--------cc--cccccchhhhHHHHHHhhcc--
Confidence            566777779999887765554333322 12234445552111  00        00  00011235666554443332  


Q ss_pred             CCCeeEEEEeCChhhHHHHHhhccccce---eEeccCC
Q psy8389         122 KKGKVTVFYCGPPQLARILRLKCDQFGF---SFRKEVF  156 (156)
Q Consensus       122 ~~~~VGVF~CGP~~L~~~l~~~c~~~~F---~fhkEnF  156 (156)
                       .....||+|||++|.+.+++.+.+..+   .+|.|.|
T Consensus        99 -~~~~~vyiCGp~~m~~~v~~~L~~~G~~~~~i~~E~F  135 (142)
T d1cqxa3          99 -LPDADYYICGPIPFMRMQHDALKNLGIHEARIHYEVF  135 (142)
T ss_dssp             -CTTCEEEEESSHHHHHHHHHHHHHTTCCGGGEEECCC
T ss_pred             -cCCceEEEECChhHHHHHHHHHHHcCCCHHHEEEEec
Confidence             345679999999999999999988754   4788877
>d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} Back     information, alignment and structure
>d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]} Back     information, alignment and structure
>d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1ja1a3 c.25.1.4 (A:519-678) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure