Psyllid ID: psy8473
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 307 | ||||||
| 23957829 | 735 | mutant e4 ebony [Drosophila melanogaster | 0.475 | 0.198 | 0.362 | 2e-20 | |
| 328702346 | 885 | PREDICTED: bacitracin synthase 3-like [A | 0.205 | 0.071 | 0.676 | 5e-19 | |
| 71534702 | 860 | beta-alanyl conjugating enzyme [Periplan | 0.309 | 0.110 | 0.442 | 2e-17 | |
| 91090408 | 876 | PREDICTED: similar to AMP dependent liga | 0.185 | 0.065 | 0.630 | 3e-17 | |
| 270013381 | 860 | hypothetical protein TcasGA2_TC011976 [T | 0.211 | 0.075 | 0.630 | 3e-17 | |
| 224459184 | 298 | ebony [Tribolium castaneum] | 0.211 | 0.218 | 0.630 | 6e-17 | |
| 307202981 | 870 | Tyrocidine synthetase 3 [Harpegnathos sa | 0.214 | 0.075 | 0.606 | 9e-17 | |
| 110749393 | 860 | PREDICTED: tyrocidine synthase 3 [Apis m | 0.218 | 0.077 | 0.567 | 1e-16 | |
| 342305262 | 879 | ebony [Drosophila melanogaster] gi|34230 | 0.185 | 0.064 | 0.641 | 2e-16 | |
| 126789024 | 879 | ebony [Drosophila melanogaster] | 0.185 | 0.064 | 0.641 | 2e-16 |
| >gi|23957829|gb|AAG28774.3| mutant e4 ebony [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Score = 105 bits (263), Expect = 2e-20, Method: Compositional matrix adjust.
Identities = 74/204 (36%), Positives = 101/204 (49%), Gaps = 58/204 (28%)
Query: 65 YKGRTVLSLPQLRLLSASLSHNNIPGESMLHADNNNEQSNDIAIVLYTSGSTGIPKEYR- 123
++G LS +L S L+ +N+ E ML N++ AIVLYTSGSTG+PK R
Sbjct: 149 FQGTPTLSTTELYAKSLQLAGSNLLSEEMLRGGNDHT-----AIVLYTSGSTGVPKGVRL 203
Query: 124 --------------------------------------RMYKTGDYGRIVD---DIHRCW 142
R K G+ G I ++ +
Sbjct: 204 PHESILQEAYKKQLSLYDNVPIGIPLSNTVVYLLDADYRPVKNGEIGEIFASGLNLAAGY 263
Query: 143 SSG---DRAI--------KYRRMYKTGDYGRIVDDILLYEGRTDSQVKIRGNRVDLSEVE 191
+G +R + KY R+Y+TGDYG + + ++YEGRTDSQVKIRG+RVDLSEVE
Sbjct: 264 VNGRDPERFLENPLAVEKKYARLYRTGDYGSLKNGSIMYEGRTDSQVKIRGHRVDLSEVE 323
Query: 192 AALSKLSEVDKLSVLCYKPGEVDQ 215
+++L VDK VLCY G+VDQ
Sbjct: 324 KNVAELPLVDKAIVLCYHAGQVDQ 347
|
Source: Drosophila melanogaster Species: Drosophila melanogaster Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328702346|ref|XP_001949322.2| PREDICTED: bacitracin synthase 3-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|71534702|emb|CAI26307.1| beta-alanyl conjugating enzyme [Periplaneta americana] | Back alignment and taxonomy information |
|---|
| >gi|91090408|ref|XP_970748.1| PREDICTED: similar to AMP dependent ligase [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270013381|gb|EFA09829.1| hypothetical protein TcasGA2_TC011976 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|224459184|gb|ACN43327.1| ebony [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307202981|gb|EFN82197.1| Tyrocidine synthetase 3 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|110749393|ref|XP_392634.3| PREDICTED: tyrocidine synthase 3 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|342305262|dbj|BAK55684.1| ebony [Drosophila melanogaster] gi|342305264|dbj|BAK55685.1| ebony [Drosophila melanogaster] gi|342305272|dbj|BAK55689.1| ebony [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|126789024|gb|ABO27272.1| ebony [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 307 | ||||||
| FB|FBgn0000527 | 879 | e "ebony" [Drosophila melanoga | 0.214 | 0.075 | 0.636 | 1e-24 | |
| UNIPROTKB|Q4KET0 | 4367 | ofaB "Non-ribosomal peptide sy | 0.231 | 0.016 | 0.432 | 8.2e-09 | |
| UNIPROTKB|Q0VZ70 | 3912 | cmdD "Chondramide synthase cmd | 0.208 | 0.016 | 0.393 | 2.7e-10 | |
| UNIPROTKB|Q4KES9 | 4901 | ofaC "Non-ribosomal peptide sy | 0.224 | 0.014 | 0.416 | 1.2e-06 | |
| ASPGD|ASPL0000061128 | 5935 | AN0016 [Emericella nidulans (t | 0.231 | 0.011 | 0.412 | 3.2e-09 | |
| UNIPROTKB|Q81QP7 | 2385 | dhbF "Nonribosomal peptide syn | 0.247 | 0.031 | 0.392 | 2.5e-06 | |
| TIGR_CMR|BA_2372 | 2385 | BA_2372 "nonribosomal peptide | 0.247 | 0.031 | 0.392 | 2.5e-06 | |
| UNIPROTKB|Q48KC2 | 2151 | PSPPH_1925 "Pyoverdine sidecha | 0.175 | 0.025 | 0.454 | 5.3e-05 | |
| UNIPROTKB|Q48KD6 | 4336 | PSPPH_1911 "Pyoverdine chromop | 0.175 | 0.012 | 0.472 | 0.00077 | |
| UNIPROTKB|Q48KC1 | 2875 | PSPPH_1926 "Pyoverdine sidecha | 0.335 | 0.035 | 0.376 | 1.2e-08 |
| FB|FBgn0000527 e "ebony" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 220 (82.5 bits), Expect = 1.0e-24, Sum P(2) = 1.0e-24
Identities = 42/66 (63%), Positives = 53/66 (80%)
Query: 150 KYRRMYKTGDYGRIVDDILLYEGRTDSQVKIRGNRVDLSEVEAALSKLSEVDKLSVLCYK 209
KY R+Y+TGDYG + + ++YEGRTDSQVKIRG+RVDLSEVE +++L VDK VLCY
Sbjct: 426 KYARLYRTGDYGSLKNGSIMYEGRTDSQVKIRGHRVDLSEVEKNVAELPLVDKAIVLCYH 485
Query: 210 PGEVDQ 215
G+VDQ
Sbjct: 486 AGQVDQ 491
|
|
| UNIPROTKB|Q4KET0 ofaB "Non-ribosomal peptide synthetase OfaB" [Pseudomonas protegens Pf-5 (taxid:220664)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0VZ70 cmdD "Chondramide synthase cmdD" [Chondromyces crocatus (taxid:52)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4KES9 ofaC "Non-ribosomal peptide synthetase OfaC" [Pseudomonas protegens Pf-5 (taxid:220664)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000061128 AN0016 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q81QP7 dhbF "Nonribosomal peptide synthetase DhbF" [Bacillus anthracis (taxid:1392)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_2372 BA_2372 "nonribosomal peptide synthetase DhbF" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q48KC2 PSPPH_1925 "Pyoverdine sidechain peptide synthetase III, L-Thr-L-Ser component" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q48KD6 PSPPH_1911 "Pyoverdine chromophore synthetase" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q48KC1 PSPPH_1926 "Pyoverdine sidechain peptide synthetase IV, D-Asp-L-Ser component" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 307 | |||
| cd05930 | 445 | cd05930, A_NRPS, The adenylation domain of nonribo | 2e-17 | |
| TIGR01733 | 409 | TIGR01733, AA-adenyl-dom, amino acid adenylation d | 6e-16 | |
| cd12117 | 474 | cd12117, A_NRPS_Srf_like, The adenylation domain o | 7e-15 | |
| cd05918 | 447 | cd05918, A_NRPS_SidN3_like, The adenylation (A) do | 1e-14 | |
| cd12114 | 476 | cd12114, A_NRPS_TlmIV_like, The adenylation domain | 3e-14 | |
| cd05945 | 447 | cd05945, DltA, D-alanine:D-alanyl carrier protein | 4e-14 | |
| cd12116 | 438 | cd12116, A_NRPS_Ta1_like, The adenylation domain o | 8e-14 | |
| cd12115 | 449 | cd12115, A_NRPS_Sfm_like, The adenylation domain o | 7e-13 | |
| COG1020 | 642 | COG1020, EntF, Non-ribosomal peptide synthetase mo | 9e-12 | |
| PRK12467 | 3956 | PRK12467, PRK12467, peptide synthase; Provisional | 1e-11 | |
| PRK10252 | 1296 | PRK10252, entF, enterobactin synthase subunit F; P | 4e-11 | |
| pfam00501 | 412 | pfam00501, AMP-binding, AMP-binding enzyme | 5e-11 | |
| cd05930 | 445 | cd05930, A_NRPS, The adenylation domain of nonribo | 4e-10 | |
| PRK04813 | 503 | PRK04813, PRK04813, D-alanine--poly(phosphoribitol | 5e-10 | |
| TIGR01734 | 502 | TIGR01734, D-ala-DACP-lig, D-alanine--poly(phospho | 8e-10 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 1e-09 | |
| TIGR01733 | 409 | TIGR01733, AA-adenyl-dom, amino acid adenylation d | 3e-09 | |
| cd05945 | 447 | cd05945, DltA, D-alanine:D-alanyl carrier protein | 3e-09 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 3e-09 | |
| PRK12467 | 3956 | PRK12467, PRK12467, peptide synthase; Provisional | 7e-09 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 8e-09 | |
| cd12117 | 474 | cd12117, A_NRPS_Srf_like, The adenylation domain o | 1e-08 | |
| cd12116 | 438 | cd12116, A_NRPS_Ta1_like, The adenylation domain o | 1e-08 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 1e-08 | |
| cd05918 | 447 | cd05918, A_NRPS_SidN3_like, The adenylation (A) do | 3e-08 | |
| PRK12467 | 3956 | PRK12467, PRK12467, peptide synthase; Provisional | 4e-08 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 9e-08 | |
| cd12114 | 476 | cd12114, A_NRPS_TlmIV_like, The adenylation domain | 2e-07 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 2e-07 | |
| cd12115 | 449 | cd12115, A_NRPS_Sfm_like, The adenylation domain o | 3e-07 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 3e-07 | |
| PRK12467 | 3956 | PRK12467, PRK12467, peptide synthase; Provisional | 8e-07 | |
| pfam00501 | 412 | pfam00501, AMP-binding, AMP-binding enzyme | 1e-06 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 2e-06 | |
| COG1020 | 642 | COG1020, EntF, Non-ribosomal peptide synthetase mo | 4e-06 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 4e-06 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 5e-06 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 5e-06 | |
| TIGR03443 | 1389 | TIGR03443, alpha_am_amid, L-aminoadipate-semialdeh | 6e-06 | |
| PRK10252 | 1296 | PRK10252, entF, enterobactin synthase subunit F; P | 1e-05 | |
| PRK04813 | 503 | PRK04813, PRK04813, D-alanine--poly(phosphoribitol | 2e-05 | |
| TIGR01734 | 502 | TIGR01734, D-ala-DACP-lig, D-alanine--poly(phospho | 2e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 3e-05 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 6e-05 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 6e-05 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 7e-05 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 7e-05 | |
| PRK12467 | 3956 | PRK12467, PRK12467, peptide synthase; Provisional | 1e-04 | |
| PRK12467 | 3956 | PRK12467, PRK12467, peptide synthase; Provisional | 1e-04 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 1e-04 | |
| cd04433 | 338 | cd04433, AFD_class_I, Adenylate forming domain, Cl | 1e-04 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 1e-04 | |
| cd05922 | 350 | cd05922, FACL_like_6, Uncharacterized subfamily of | 1e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-04 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 2e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 3e-04 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 3e-04 | |
| cd05930 | 445 | cd05930, A_NRPS, The adenylation domain of nonribo | 4e-04 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 4e-04 | |
| cd05906 | 560 | cd05906, A_NRPS_TubE_like, The adenylation domain | 4e-04 | |
| COG0365 | 528 | COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat | 5e-04 | |
| pfam00501 | 412 | pfam00501, AMP-binding, AMP-binding enzyme | 6e-04 | |
| PRK05691 | 4334 | PRK05691, PRK05691, peptide synthase; Validated | 6e-04 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 6e-04 | |
| PRK14552 | 414 | PRK14552, PRK14552, C/D box methylation guide ribo | 7e-04 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 7e-04 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 7e-04 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 7e-04 | |
| COG0365 | 528 | COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat | 7e-04 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 7e-04 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 8e-04 | |
| TIGR01733 | 409 | TIGR01733, AA-adenyl-dom, amino acid adenylation d | 0.001 | |
| PRK12316 | 5163 | PRK12316, PRK12316, peptide synthase; Provisional | 0.001 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 0.001 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 0.001 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 0.001 | |
| COG0318 | 534 | COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ | 0.001 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 0.002 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 0.002 | |
| PTZ00074 | 135 | PTZ00074, PTZ00074, 60S ribosomal protein L34; Pro | 0.002 | |
| pfam10278 | 178 | pfam10278, Med19, Mediator of RNA pol II transcrip | 0.002 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 0.002 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 0.002 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 0.002 | |
| pfam06658 | 142 | pfam06658, DUF1168, Protein of unknown function (D | 0.002 | |
| PLN02387 | 696 | PLN02387, PLN02387, long-chain-fatty-acid-CoA liga | 0.002 | |
| cd05918 | 447 | cd05918, A_NRPS_SidN3_like, The adenylation (A) do | 0.003 | |
| pfam08496 | 154 | pfam08496, Peptidase_S49_N, Peptidase family S49 N | 0.003 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 0.003 | |
| cd05931 | 547 | cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | 0.003 | |
| PRK11778 | 330 | PRK11778, PRK11778, putative inner membrane peptid | 0.004 | |
| PRK04950 | 213 | PRK04950, PRK04950, ProP expression regulator; Pro | 0.004 | |
| pfam11208 | 132 | pfam11208, DUF2992, Protein of unknown function (D | 0.004 |
| >gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
Score = 81.7 bits (203), Expect = 2e-17
Identities = 30/84 (35%), Positives = 46/84 (54%), Gaps = 11/84 (13%)
Query: 153 RMYKTGDYGRIVDD-ILLYEGRTDSQVKIRGNRVDLSEVEAALSKLSEVDKLSVLCYKPG 211
R+Y+TGD R + D L + GR D QVKIRG R++L E+EAAL V + V+ + G
Sbjct: 327 RLYRTGDLARWLPDGNLEFLGRADDQVKIRGYRIELGEIEAALLAHPGVREAVVVAREDG 386
Query: 212 EVDQV----------SEVTSEEIR 225
++ +E+ + E+R
Sbjct: 387 AGEKRLVAYVVPAAGAELDAAELR 410
|
The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester bond to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions. Length = 445 |
| >gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain | Back alignment and domain information |
|---|
| >gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C) | Back alignment and domain information |
|---|
| >gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes | Back alignment and domain information |
|---|
| >gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) | Back alignment and domain information |
|---|
| >gnl|CDD|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|213323 cd12115, A_NRPS_Sfm_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Saframycin A gene cluster from Streptomyces lavendulae | Back alignment and domain information |
|---|
| >gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236668 PRK10252, entF, enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|235313 PRK04813, PRK04813, D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233551 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phosphoribitol) ligase, subunit 1 | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain | Back alignment and domain information |
|---|
| >gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C) | Back alignment and domain information |
|---|
| >gnl|CDD|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213323 cd12115, A_NRPS_Sfm_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Saframycin A gene cluster from Streptomyces lavendulae | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|236668 PRK10252, entF, enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235313 PRK04813, PRK04813, D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233551 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phosphoribitol) ligase, subunit 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents | Back alignment and domain information |
|---|
| >gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain | Back alignment and domain information |
|---|
| >gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185429 PTZ00074, PTZ00074, 60S ribosomal protein L34; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|150884 pfam10278, Med19, Mediator of RNA pol II transcription subunit 19 | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) | Back alignment and domain information |
|---|
| >gnl|CDD|215217 PLN02387, PLN02387, long-chain-fatty-acid-CoA ligase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | Back alignment and domain information |
|---|
| >gnl|CDD|236978 PRK11778, PRK11778, putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221028 pfam11208, DUF2992, Protein of unknown function (DUF2992) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| KOG1176|consensus | 537 | 99.92 | ||
| KOG1256|consensus | 691 | 99.91 | ||
| KOG1177|consensus | 596 | 99.88 | ||
| KOG1180|consensus | 678 | 99.86 | ||
| COG0365 | 528 | Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l | 99.82 | |
| PLN02614 | 666 | long-chain acyl-CoA synthetase | 99.79 | |
| COG0318 | 534 | CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l | 99.78 | |
| PRK05851 | 525 | long-chain-fatty-acid--[acyl-carrier-protein] liga | 99.77 | |
| COG1022 | 613 | FAA1 Long-chain acyl-CoA synthetases (AMP-forming) | 99.77 | |
| PRK07529 | 632 | AMP-binding domain protein; Validated | 99.76 | |
| PRK07769 | 631 | long-chain-fatty-acid--CoA ligase; Validated | 99.76 | |
| PTZ00237 | 647 | acetyl-CoA synthetase; Provisional | 99.76 | |
| PRK06334 | 539 | long chain fatty acid--[acyl-carrier-protein] liga | 99.76 | |
| PLN02861 | 660 | long-chain-fatty-acid-CoA ligase | 99.75 | |
| PTZ00342 | 746 | acyl-CoA synthetase; Provisional | 99.75 | |
| PRK07788 | 549 | acyl-CoA synthetase; Validated | 99.75 | |
| PRK09274 | 552 | peptide synthase; Provisional | 99.75 | |
| PRK00174 | 637 | acetyl-CoA synthetase; Provisional | 99.74 | |
| PRK06060 | 705 | acyl-CoA synthetase; Validated | 99.74 | |
| PLN02654 | 666 | acetate-CoA ligase | 99.74 | |
| PLN02574 | 560 | 4-coumarate--CoA ligase-like | 99.74 | |
| COG1021 | 542 | EntE Peptide arylation enzymes [Secondary metaboli | 99.74 | |
| TIGR02188 | 625 | Ac_CoA_lig_AcsA acetate--CoA ligase. This model de | 99.73 | |
| PLN02860 | 563 | o-succinylbenzoate-CoA ligase | 99.73 | |
| PLN03051 | 499 | acyl-activating enzyme; Provisional | 99.72 | |
| PLN02387 | 696 | long-chain-fatty-acid-CoA ligase family protein | 99.72 | |
| TIGR02316 | 628 | propion_prpE propionate--CoA ligase. This family c | 99.72 | |
| PRK07445 | 452 | O-succinylbenzoic acid--CoA ligase; Reviewed | 99.72 | |
| PRK12476 | 612 | putative fatty-acid--CoA ligase; Provisional | 99.72 | |
| PLN02736 | 651 | long-chain acyl-CoA synthetase | 99.71 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.71 | |
| PRK05677 | 562 | long-chain-fatty-acid--CoA ligase; Validated | 99.71 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 99.71 | |
| PLN02430 | 660 | long-chain-fatty-acid-CoA ligase | 99.71 | |
| PTZ00216 | 700 | acyl-CoA synthetase; Provisional | 99.7 | |
| PLN02246 | 537 | 4-coumarate--CoA ligase | 99.69 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.68 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.68 | |
| PRK03584 | 655 | acetoacetyl-CoA synthetase; Provisional | 99.68 | |
| PRK06145 | 497 | acyl-CoA synthetase; Validated | 99.67 | |
| PRK12492 | 562 | long-chain-fatty-acid--CoA ligase; Provisional | 99.67 | |
| PRK13382 | 537 | acyl-CoA synthetase; Provisional | 99.67 | |
| PRK04319 | 570 | acetyl-CoA synthetase; Provisional | 99.67 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.67 | |
| PRK09088 | 488 | acyl-CoA synthetase; Validated | 99.66 | |
| TIGR01217 | 652 | ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym | 99.66 | |
| PRK10524 | 629 | prpE propionyl-CoA synthetase; Provisional | 99.66 | |
| TIGR03208 | 538 | cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. | 99.66 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.66 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.66 | |
| PRK09192 | 579 | acyl-CoA synthetase; Validated | 99.66 | |
| PRK07638 | 487 | acyl-CoA synthetase; Validated | 99.66 | |
| PRK06839 | 496 | acyl-CoA synthetase; Validated | 99.66 | |
| TIGR01734 | 502 | D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig | 99.66 | |
| PRK13295 | 547 | cyclohexanecarboxylate-CoA ligase; Reviewed | 99.66 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 99.66 | |
| TIGR02275 | 527 | DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot | 99.65 | |
| PLN02330 | 546 | 4-coumarate--CoA ligase-like 1 | 99.65 | |
| PRK07867 | 529 | acyl-CoA synthetase; Validated | 99.65 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 99.65 | |
| PRK05852 | 534 | acyl-CoA synthetase; Validated | 99.65 | |
| PRK13388 | 540 | acyl-CoA synthetase; Provisional | 99.65 | |
| PRK08043 | 718 | bifunctional acyl-[acyl carrier protein] synthetas | 99.64 | |
| PRK08751 | 560 | putative long-chain fatty acyl CoA ligase; Provisi | 99.64 | |
| PRK12582 | 624 | acyl-CoA synthetase; Provisional | 99.64 | |
| PRK12583 | 558 | acyl-CoA synthetase; Provisional | 99.64 | |
| KOG1175|consensus | 626 | 99.64 | ||
| PRK06155 | 542 | crotonobetaine/carnitine-CoA ligase; Provisional | 99.64 | |
| PRK07824 | 358 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.64 | |
| PRK07059 | 557 | Long-chain-fatty-acid--CoA ligase; Validated | 99.63 | |
| PRK13383 | 516 | acyl-CoA synthetase; Provisional | 99.63 | |
| PRK06710 | 563 | long-chain-fatty-acid--CoA ligase; Validated | 99.63 | |
| PRK06164 | 540 | acyl-CoA synthetase; Validated | 99.63 | |
| PRK08315 | 559 | AMP-binding domain protein; Validated | 99.63 | |
| PRK13390 | 501 | acyl-CoA synthetase; Provisional | 99.63 | |
| PRK05605 | 573 | long-chain-fatty-acid--CoA ligase; Validated | 99.63 | |
| PRK08008 | 517 | caiC putative crotonobetaine/carnitine-CoA ligase; | 99.62 | |
| PRK05857 | 540 | acyl-CoA synthetase; Validated | 99.62 | |
| COG0365 | 528 | Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l | 99.62 | |
| PRK09029 | 458 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.62 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 99.62 | |
| PRK08279 | 600 | long-chain-acyl-CoA synthetase; Validated | 99.62 | |
| PRK08314 | 546 | long-chain-fatty-acid--CoA ligase; Validated | 99.62 | |
| PRK08316 | 523 | acyl-CoA synthetase; Validated | 99.61 | |
| PRK07470 | 528 | acyl-CoA synthetase; Validated | 99.61 | |
| PRK07656 | 513 | long-chain-fatty-acid--CoA ligase; Validated | 99.61 | |
| PRK12406 | 509 | long-chain-fatty-acid--CoA ligase; Provisional | 99.61 | |
| KOG1176|consensus | 537 | 99.61 | ||
| PRK04813 | 503 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.61 | |
| PRK07787 | 471 | acyl-CoA synthetase; Validated | 99.6 | |
| PRK07514 | 504 | malonyl-CoA synthase; Validated | 99.6 | |
| PLN03102 | 579 | acyl-activating enzyme; Provisional | 99.6 | |
| PRK05850 | 578 | acyl-CoA synthetase; Validated | 99.59 | |
| PRK08180 | 614 | feruloyl-CoA synthase; Reviewed | 99.59 | |
| PRK03640 | 483 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.59 | |
| TIGR03098 | 515 | ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor | 99.59 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 99.59 | |
| PRK10946 | 536 | entE enterobactin synthase subunit E; Provisional | 99.58 | |
| PRK06178 | 567 | acyl-CoA synthetase; Validated | 99.58 | |
| PRK08974 | 560 | long-chain-fatty-acid--CoA ligase; Validated | 99.58 | |
| PRK07008 | 539 | long-chain-fatty-acid--CoA ligase; Validated | 99.57 | |
| PRK07786 | 542 | long-chain-fatty-acid--CoA ligase; Validated | 99.57 | |
| TIGR03205 | 541 | pimA dicarboxylate--CoA ligase PimA. PimA, a membe | 99.57 | |
| PLN03052 | 728 | acetate--CoA ligase; Provisional | 99.56 | |
| PRK08276 | 502 | long-chain-fatty-acid--CoA ligase; Validated | 99.56 | |
| PRK13391 | 511 | acyl-CoA synthetase; Provisional | 99.55 | |
| PRK06188 | 524 | acyl-CoA synthetase; Validated | 99.54 | |
| TIGR01733 | 408 | AA-adenyl-dom amino acid adenylation domain. This | 99.53 | |
| PRK06087 | 547 | short chain acyl-CoA synthetase; Reviewed | 99.52 | |
| PRK08162 | 545 | acyl-CoA synthetase; Validated | 99.52 | |
| PRK06187 | 521 | long-chain-fatty-acid--CoA ligase; Validated | 99.51 | |
| PRK05620 | 576 | long-chain-fatty-acid--CoA ligase; Validated | 99.51 | |
| PRK07798 | 533 | acyl-CoA synthetase; Validated | 99.5 | |
| PRK07768 | 545 | long-chain-fatty-acid--CoA ligase; Validated | 99.5 | |
| PRK06018 | 542 | putative acyl-CoA synthetase; Provisional | 99.49 | |
| TIGR02262 | 508 | benz_CoA_lig benzoate-CoA ligase family. Character | 99.48 | |
| PLN02479 | 567 | acetate-CoA ligase | 99.47 | |
| PRK08308 | 414 | acyl-CoA synthetase; Validated | 99.43 | |
| PLN02387 | 696 | long-chain-fatty-acid-CoA ligase family protein | 99.43 | |
| TIGR01923 | 436 | menE O-succinylbenzoate-CoA ligase. This model rep | 99.42 | |
| PLN02736 | 651 | long-chain acyl-CoA synthetase | 99.41 | |
| COG0318 | 534 | CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l | 99.39 | |
| PRK07529 | 632 | AMP-binding domain protein; Validated | 99.37 | |
| PLN02654 | 666 | acetate-CoA ligase | 99.36 | |
| KOG1175|consensus | 626 | 99.34 | ||
| TIGR01217 | 652 | ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym | 99.32 | |
| TIGR02316 | 628 | propion_prpE propionate--CoA ligase. This family c | 99.32 | |
| PRK06060 | 705 | acyl-CoA synthetase; Validated | 99.31 | |
| PTZ00342 | 746 | acyl-CoA synthetase; Provisional | 99.3 | |
| PF00501 | 417 | AMP-binding: AMP-binding enzyme; InterPro: IPR0008 | 99.3 | |
| PLN02614 | 666 | long-chain acyl-CoA synthetase | 99.29 | |
| PRK03584 | 655 | acetoacetyl-CoA synthetase; Provisional | 99.29 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 99.27 | |
| PRK07445 | 452 | O-succinylbenzoic acid--CoA ligase; Reviewed | 99.26 | |
| PRK06334 | 539 | long chain fatty acid--[acyl-carrier-protein] liga | 99.25 | |
| TIGR02188 | 625 | Ac_CoA_lig_AcsA acetate--CoA ligase. This model de | 99.24 | |
| PLN02861 | 660 | long-chain-fatty-acid-CoA ligase | 99.23 | |
| PRK07788 | 549 | acyl-CoA synthetase; Validated | 99.23 | |
| PTZ00237 | 647 | acetyl-CoA synthetase; Provisional | 99.23 | |
| PRK00174 | 637 | acetyl-CoA synthetase; Provisional | 99.22 | |
| PLN02430 | 660 | long-chain-fatty-acid-CoA ligase | 99.2 | |
| PLN03052 | 728 | acetate--CoA ligase; Provisional | 99.2 | |
| COG1022 | 613 | FAA1 Long-chain acyl-CoA synthetases (AMP-forming) | 99.17 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 99.17 | |
| PRK13382 | 537 | acyl-CoA synthetase; Provisional | 99.17 | |
| KOG1179|consensus | 649 | 99.15 | ||
| PLN02574 | 560 | 4-coumarate--CoA ligase-like | 99.15 | |
| PLN02860 | 563 | o-succinylbenzoate-CoA ligase | 99.15 | |
| PRK04319 | 570 | acetyl-CoA synthetase; Provisional | 99.14 | |
| PRK09274 | 552 | peptide synthase; Provisional | 99.12 | |
| PRK07638 | 487 | acyl-CoA synthetase; Validated | 99.09 | |
| PRK13295 | 547 | cyclohexanecarboxylate-CoA ligase; Reviewed | 99.08 | |
| PRK08043 | 718 | bifunctional acyl-[acyl carrier protein] synthetas | 99.08 | |
| PRK07824 | 358 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.08 | |
| PTZ00216 | 700 | acyl-CoA synthetase; Provisional | 99.07 | |
| PRK08279 | 600 | long-chain-acyl-CoA synthetase; Validated | 99.03 | |
| COG1021 | 542 | EntE Peptide arylation enzymes [Secondary metaboli | 99.02 | |
| PRK05677 | 562 | long-chain-fatty-acid--CoA ligase; Validated | 99.01 | |
| PRK08314 | 546 | long-chain-fatty-acid--CoA ligase; Validated | 98.99 | |
| PRK10946 | 536 | entE enterobactin synthase subunit E; Provisional | 98.98 | |
| PLN02246 | 537 | 4-coumarate--CoA ligase | 98.97 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 98.97 | |
| PRK05852 | 534 | acyl-CoA synthetase; Validated | 98.96 | |
| PRK07867 | 529 | acyl-CoA synthetase; Validated | 98.96 | |
| TIGR03208 | 538 | cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. | 98.95 | |
| PLN02330 | 546 | 4-coumarate--CoA ligase-like 1 | 98.94 | |
| PRK06155 | 542 | crotonobetaine/carnitine-CoA ligase; Provisional | 98.94 | |
| PRK05857 | 540 | acyl-CoA synthetase; Validated | 98.93 | |
| PRK09029 | 458 | O-succinylbenzoic acid--CoA ligase; Provisional | 98.93 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 98.92 | |
| TIGR02275 | 527 | DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot | 98.91 | |
| PRK06839 | 496 | acyl-CoA synthetase; Validated | 98.91 | |
| PRK13383 | 516 | acyl-CoA synthetase; Provisional | 98.9 | |
| TIGR02155 | 422 | PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet | 98.9 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 98.9 | |
| KOG1177|consensus | 596 | 98.89 | ||
| PRK07514 | 504 | malonyl-CoA synthase; Validated | 98.88 | |
| TIGR02372 | 386 | 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv | 98.88 | |
| COG1020 | 642 | EntF Non-ribosomal peptide synthetase modules and | 98.87 | |
| PRK09088 | 488 | acyl-CoA synthetase; Validated | 98.87 | |
| PRK12492 | 562 | long-chain-fatty-acid--CoA ligase; Provisional | 98.87 | |
| PRK06145 | 497 | acyl-CoA synthetase; Validated | 98.86 | |
| PRK13391 | 511 | acyl-CoA synthetase; Provisional | 98.86 | |
| PRK08008 | 517 | caiC putative crotonobetaine/carnitine-CoA ligase; | 98.85 | |
| PRK07470 | 528 | acyl-CoA synthetase; Validated | 98.85 | |
| PRK07656 | 513 | long-chain-fatty-acid--CoA ligase; Validated | 98.84 | |
| PRK06178 | 567 | acyl-CoA synthetase; Validated | 98.83 | |
| PRK12583 | 558 | acyl-CoA synthetase; Provisional | 98.82 | |
| PRK06188 | 524 | acyl-CoA synthetase; Validated | 98.82 | |
| TIGR01734 | 502 | D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig | 98.8 | |
| PRK12406 | 509 | long-chain-fatty-acid--CoA ligase; Provisional | 98.79 | |
| PRK07008 | 539 | long-chain-fatty-acid--CoA ligase; Validated | 98.79 | |
| PRK07787 | 471 | acyl-CoA synthetase; Validated | 98.78 | |
| PRK05605 | 573 | long-chain-fatty-acid--CoA ligase; Validated | 98.77 | |
| PRK08315 | 559 | AMP-binding domain protein; Validated | 98.77 | |
| PRK07059 | 557 | Long-chain-fatty-acid--CoA ligase; Validated | 98.77 | |
| TIGR03098 | 515 | ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor | 98.76 | |
| PRK08316 | 523 | acyl-CoA synthetase; Validated | 98.74 | |
| PRK08180 | 614 | feruloyl-CoA synthase; Reviewed | 98.74 | |
| PRK04813 | 503 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 98.71 | |
| PRK07786 | 542 | long-chain-fatty-acid--CoA ligase; Validated | 98.7 | |
| PRK03640 | 483 | O-succinylbenzoic acid--CoA ligase; Provisional | 98.7 | |
| PRK06187 | 521 | long-chain-fatty-acid--CoA ligase; Validated | 98.68 | |
| PRK06087 | 547 | short chain acyl-CoA synthetase; Reviewed | 98.67 | |
| PLN03051 | 499 | acyl-activating enzyme; Provisional | 98.62 | |
| PRK08974 | 560 | long-chain-fatty-acid--CoA ligase; Validated | 98.59 | |
| KOG1179|consensus | 649 | 98.55 | ||
| PRK07769 | 631 | long-chain-fatty-acid--CoA ligase; Validated | 98.53 | |
| TIGR01733 | 408 | AA-adenyl-dom amino acid adenylation domain. This | 98.53 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 98.48 | |
| PRK05851 | 525 | long-chain-fatty-acid--[acyl-carrier-protein] liga | 98.47 | |
| PTZ00297 | 1452 | pantothenate kinase; Provisional | 98.38 | |
| KOG1178|consensus | 1032 | 98.36 | ||
| PRK13390 | 501 | acyl-CoA synthetase; Provisional | 98.3 | |
| PRK12476 | 612 | putative fatty-acid--CoA ligase; Provisional | 98.29 | |
| PRK10524 | 629 | prpE propionyl-CoA synthetase; Provisional | 98.27 | |
| PRK05620 | 576 | long-chain-fatty-acid--CoA ligase; Validated | 98.13 | |
| PRK09192 | 579 | acyl-CoA synthetase; Validated | 98.1 | |
| TIGR03335 | 445 | F390_ftsA coenzyme F390 synthetase. This enzyme, c | 98.09 | |
| TIGR02372 | 386 | 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv | 98.06 | |
| PLN03102 | 579 | acyl-activating enzyme; Provisional | 98.04 | |
| PTZ00297 | 1452 | pantothenate kinase; Provisional | 98.02 | |
| PRK05850 | 578 | acyl-CoA synthetase; Validated | 98.0 | |
| PRK06164 | 540 | acyl-CoA synthetase; Validated | 97.99 | |
| PRK13388 | 540 | acyl-CoA synthetase; Provisional | 97.93 | |
| PRK08308 | 414 | acyl-CoA synthetase; Validated | 97.9 | |
| PRK06710 | 563 | long-chain-fatty-acid--CoA ligase; Validated | 97.89 | |
| PRK06018 | 542 | putative acyl-CoA synthetase; Provisional | 97.86 | |
| COG1541 | 438 | PaaK Coenzyme F390 synthetase [Coenzyme metabolism | 97.86 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 97.85 | |
| PRK08751 | 560 | putative long-chain fatty acyl CoA ligase; Provisi | 97.83 | |
| PRK08162 | 545 | acyl-CoA synthetase; Validated | 97.76 | |
| PRK08276 | 502 | long-chain-fatty-acid--CoA ligase; Validated | 97.76 | |
| TIGR03205 | 541 | pimA dicarboxylate--CoA ligase PimA. PimA, a membe | 97.75 | |
| PLN02479 | 567 | acetate-CoA ligase | 97.74 | |
| PRK07798 | 533 | acyl-CoA synthetase; Validated | 97.66 | |
| PRK12582 | 624 | acyl-CoA synthetase; Provisional | 97.61 | |
| TIGR01923 | 436 | menE O-succinylbenzoate-CoA ligase. This model rep | 97.56 | |
| PRK07768 | 545 | long-chain-fatty-acid--CoA ligase; Validated | 97.53 | |
| TIGR02262 | 508 | benz_CoA_lig benzoate-CoA ligase family. Character | 97.49 | |
| TIGR02155 | 422 | PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet | 96.52 | |
| KOG1178|consensus | 1032 | 96.09 | ||
| KOG3628|consensus | 1363 | 95.89 | ||
| KOG1180|consensus | 678 | 94.78 | ||
| KOG1256|consensus | 691 | 94.7 | ||
| PF13193 | 73 | AMP-binding_C: AMP-binding enzyme C-terminal domai | 94.26 | |
| COG1020 | 642 | EntF Non-ribosomal peptide synthetase modules and | 94.22 | |
| PF13193 | 73 | AMP-binding_C: AMP-binding enzyme C-terminal domai | 92.89 | |
| PF00501 | 417 | AMP-binding: AMP-binding enzyme; InterPro: IPR0008 | 91.8 | |
| TIGR03335 | 445 | F390_ftsA coenzyme F390 synthetase. This enzyme, c | 89.13 | |
| COG1541 | 438 | PaaK Coenzyme F390 synthetase [Coenzyme metabolism | 84.47 |
| >KOG1176|consensus | Back alignment and domain information |
|---|
Probab=99.92 E-value=6.2e-25 Score=208.07 Aligned_cols=154 Identities=18% Similarity=0.225 Sum_probs=132.5
Q ss_pred CCCCcccCCCCCcccccceEEEEe----CCCCcccccc-cce--------ecCCcceEEEEEe---eeccccCCcc----
Q psy8473 88 IPGESMLHADNNNEQSNDIAIVLY----TSGSTGIPKE-YRR--------MYKTGDYGRIVDD---IHRCWSSGDR---- 147 (307)
Q Consensus 88 ~~~~~~~~~yg~te~~~~~a~~~~----tsGttG~Pkg-~~~--------~~~~g~~Gel~v~---v~~gy~~~~~---- 147 (307)
+|...+.++||+||++...+.... .+||.|++.. ... .++++..||||++ ++.||+++|+
T Consensus 323 l~~~~v~q~YGmTE~~~~~~~~~~~~e~k~~svG~~~~g~~~~v~~e~g~~l~~~~~GEI~vrg~~imkGY~~NpeaT~~ 402 (537)
T KOG1176|consen 323 LPNVTVIQGYGMTEAGGLITSNDWGPERKPGSVGRLLPGVRVKVLDETGVSLGPNQTGEICVRGPQVMKGYLKNPEATKE 402 (537)
T ss_pred CCCceEEEeeccccccCceeecCCCccCcccccCccccceEEEeeCCCCCCCCCCCceEEEEECcccchhhcCChHHHHh
Confidence 667778999999999866555543 3799999884 222 5778889999999 9999999998
Q ss_pred ccccccEEeecCeEEE-ECCeEEEeeecCCeEEECCeeechhHHHHHHhcCCCcceEEEEEeeCCCcceEEEEeeecccC
Q psy8473 148 AIKYRRMYKTGDYGRI-VDDILLYEGRTDSQVKIRGNRVDLSEVEAALSKLSEVDKLSVLCYKPGEVDQVSEVTSEEIRG 226 (307)
Q Consensus 148 ~~~~~~~~~tGD~g~~-~~g~l~~~GR~~~~i~~~G~~v~~~eiE~~l~~~p~V~~~~v~~~~~~~~~~~~~~~~~~~~~ 226 (307)
..+.++||+|||+|++ +||+|++++|.+|+||.+|+.|+|.|||++|..||.|.|++|++.||+.+++..
T Consensus 403 ~~~~~GW~~TGDiGy~D~DG~l~IvdR~KdlIk~~G~qv~P~EiE~vL~~hP~V~eaaVvgipDe~~Ge~p--------- 473 (537)
T KOG1176|consen 403 AFDDDGWFHTGDLGYFDEDGYLYIVDRSKDLIKYGGEQVSPAEIEAVLLTHPDVLEAAVVGIPDEVWGETP--------- 473 (537)
T ss_pred hcccCCccccCceEEEcCCCeEEEecchhhheeeCCEEeCHHHHHHHHHhCCCccEEEEEcccccccCCcc---------
Confidence 3334599999999999 599999999999999999999999999999999999999999999999988877
Q ss_pred cccccccccccccccccCCcccchhhHHHHHccc
Q psy8473 227 VDDILLYEGRTDSQVKIRGNRVDLSEVEAALSKI 260 (307)
Q Consensus 227 ~dg~~~~~gR~dd~ik~~G~~i~~~eIe~~L~~~ 260 (307)
.+|+.|++ |..+...||.++++++
T Consensus 474 ----~A~VV~k~------g~~lte~di~~~v~k~ 497 (537)
T KOG1176|consen 474 ----AAFVVLKK------GSTLTEKDIIEYVRKK 497 (537)
T ss_pred ----eEEEEecC------CCcCCHHHHHHHHHhh
Confidence 55664433 8899999999999988
|
|
| >KOG1256|consensus | Back alignment and domain information |
|---|
| >KOG1177|consensus | Back alignment and domain information |
|---|
| >KOG1180|consensus | Back alignment and domain information |
|---|
| >COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02614 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK07529 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PRK07769 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PTZ00237 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PLN02861 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PTZ00342 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07788 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK09274 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00174 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06060 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PLN02654 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PLN02574 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase | Back alignment and domain information |
|---|
| >PLN02860 o-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >PLN03051 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02387 long-chain-fatty-acid-CoA ligase family protein | Back alignment and domain information |
|---|
| >TIGR02316 propion_prpE propionate--CoA ligase | Back alignment and domain information |
|---|
| >PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PRK12476 putative fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PLN02736 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK05677 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PLN02430 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PTZ00216 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02246 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK03584 acetoacetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06145 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12492 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK13382 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK04319 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK09088 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase | Back alignment and domain information |
|---|
| >PRK10524 prpE propionyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK09192 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07638 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06839 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 | Back alignment and domain information |
|---|
| >PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >PLN02330 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >PRK07867 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05852 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13388 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK08751 putative long-chain fatty acyl CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK12582 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12583 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG1175|consensus | Back alignment and domain information |
|---|
| >PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK07059 Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK13383 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06710 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06164 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08315 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PRK13390 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05605 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK05857 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK08279 long-chain-acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08314 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK08316 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07470 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07656 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK12406 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >KOG1176|consensus | Back alignment and domain information |
|---|
| >PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK07787 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07514 malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >PLN03102 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK05850 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08180 feruloyl-CoA synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10946 entE enterobactin synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >PRK06178 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08974 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07008 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07786 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR03205 pimA dicarboxylate--CoA ligase PimA | Back alignment and domain information |
|---|
| >PLN03052 acetate--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08276 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK13391 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06188 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR01733 AA-adenyl-dom amino acid adenylation domain | Back alignment and domain information |
|---|
| >PRK06087 short chain acyl-CoA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK08162 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06187 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK05620 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07798 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07768 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06018 putative acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02262 benz_CoA_lig benzoate-CoA ligase family | Back alignment and domain information |
|---|
| >PLN02479 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK08308 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PLN02387 long-chain-fatty-acid-CoA ligase family protein | Back alignment and domain information |
|---|
| >TIGR01923 menE O-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >PLN02736 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK07529 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PLN02654 acetate-CoA ligase | Back alignment and domain information |
|---|
| >KOG1175|consensus | Back alignment and domain information |
|---|
| >TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase | Back alignment and domain information |
|---|
| >TIGR02316 propion_prpE propionate--CoA ligase | Back alignment and domain information |
|---|
| >PRK06060 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PTZ00342 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] | Back alignment and domain information |
|---|
| >PLN02614 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >PRK03584 acetoacetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase | Back alignment and domain information |
|---|
| >PLN02861 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PRK07788 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PTZ00237 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00174 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02430 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PLN03052 acetate--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK13382 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG1179|consensus | Back alignment and domain information |
|---|
| >PLN02574 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >PLN02860 o-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >PRK04319 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09274 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07638 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PTZ00216 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08279 long-chain-acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK05677 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK08314 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK10946 entE enterobactin synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >PLN02246 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05852 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07867 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase | Back alignment and domain information |
|---|
| >PLN02330 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK05857 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >PRK06839 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13383 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >KOG1177|consensus | Back alignment and domain information |
|---|
| >PRK07514 malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family | Back alignment and domain information |
|---|
| >COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK09088 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12492 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK06145 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13391 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07470 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07656 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06178 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12583 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06188 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 | Back alignment and domain information |
|---|
| >PRK12406 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK07008 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07787 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05605 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK08315 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PRK07059 Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK08316 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08180 feruloyl-CoA synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK07786 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK06187 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06087 short chain acyl-CoA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN03051 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK08974 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >KOG1179|consensus | Back alignment and domain information |
|---|
| >PRK07769 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR01733 AA-adenyl-dom amino acid adenylation domain | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PTZ00297 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1178|consensus | Back alignment and domain information |
|---|
| >PRK13390 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12476 putative fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK10524 prpE propionyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05620 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK09192 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR03335 F390_ftsA coenzyme F390 synthetase | Back alignment and domain information |
|---|
| >TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family | Back alignment and domain information |
|---|
| >PLN03102 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PTZ00297 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05850 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06164 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13388 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08308 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06710 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06018 putative acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08751 putative long-chain fatty acyl CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08162 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08276 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR03205 pimA dicarboxylate--CoA ligase PimA | Back alignment and domain information |
|---|
| >PLN02479 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK07798 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12582 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01923 menE O-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >PRK07768 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR02262 benz_CoA_lig benzoate-CoA ligase family | Back alignment and domain information |
|---|
| >TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase | Back alignment and domain information |
|---|
| >KOG1178|consensus | Back alignment and domain information |
|---|
| >KOG3628|consensus | Back alignment and domain information |
|---|
| >KOG1180|consensus | Back alignment and domain information |
|---|
| >KOG1256|consensus | Back alignment and domain information |
|---|
| >PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B | Back alignment and domain information |
|---|
| >COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B | Back alignment and domain information |
|---|
| >PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] | Back alignment and domain information |
|---|
| >TIGR03335 F390_ftsA coenzyme F390 synthetase | Back alignment and domain information |
|---|
| >COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 307 | ||||
| 3fcc_A | 512 | Crystal Structure Of Dlta Protein In Complex With A | 4e-07 | ||
| 3dhv_A | 512 | Crystal Structure Of Dlta Protein In Complex With D | 4e-07 | ||
| 4gr5_A | 570 | Crystal Structure Of Slgn1deltaasub In Complex With | 9e-07 | ||
| 4gr5_A | 570 | Crystal Structure Of Slgn1deltaasub In Complex With | 8e-04 | ||
| 3ite_A | 562 | The Third Adenylation Domain Of The Fungal Sidn Non | 1e-06 | ||
| 3ite_A | 562 | The Third Adenylation Domain Of The Fungal Sidn Non | 9e-04 | ||
| 1amu_A | 563 | Phenylalanine Activating Domain Of Gramicidin Synth | 2e-06 | ||
| 2vsq_A | 1304 | Structure Of Surfactin A Synthetase C (Srfa-C), A N | 5e-05 | ||
| 3e7w_A | 511 | Crystal Structure Of Dlta: Implications For The Rea | 5e-05 | ||
| 3vnq_A | 544 | Co-crystal Structure Of Nrps Adenylation Protein Cy | 9e-05 | ||
| 3l8c_A | 521 | Structure Of Probable D-Alanine--Poly(Phosphoribito | 6e-04 |
| >pdb|3FCC|A Chain A, Crystal Structure Of Dlta Protein In Complex With Atp And Magnesium Length = 512 | Back alignment and structure |
|
| >pdb|3DHV|A Chain A, Crystal Structure Of Dlta Protein In Complex With D-Alanine Adenylate Length = 512 | Back alignment and structure |
| >pdb|4GR5|A Chain A, Crystal Structure Of Slgn1deltaasub In Complex With Ampcpp Length = 570 | Back alignment and structure |
| >pdb|4GR5|A Chain A, Crystal Structure Of Slgn1deltaasub In Complex With Ampcpp Length = 570 | Back alignment and structure |
| >pdb|3ITE|A Chain A, The Third Adenylation Domain Of The Fungal Sidn Non- Ribosomal Peptide Synthetase Length = 562 | Back alignment and structure |
| >pdb|3ITE|A Chain A, The Third Adenylation Domain Of The Fungal Sidn Non- Ribosomal Peptide Synthetase Length = 562 | Back alignment and structure |
| >pdb|1AMU|A Chain A, Phenylalanine Activating Domain Of Gramicidin Synthetase 1 In A Complex With Amp And Phenylalanine Length = 563 | Back alignment and structure |
| >pdb|2VSQ|A Chain A, Structure Of Surfactin A Synthetase C (Srfa-C), A Nonribosomal Peptide Synthetase Termination Module Length = 1304 | Back alignment and structure |
| >pdb|3E7W|A Chain A, Crystal Structure Of Dlta: Implications For The Reaction Mechanism Of Non-Ribosomal Peptide Synthetase (Nrps) Adenylation Domains Length = 511 | Back alignment and structure |
| >pdb|3VNQ|A Chain A, Co-crystal Structure Of Nrps Adenylation Protein Cytc1 With Atp From Streptomyces Length = 544 | Back alignment and structure |
| >pdb|3L8C|A Chain A, Structure Of Probable D-Alanine--Poly(Phosphoribitol) Ligase Subunit-1 From Streptococcus Pyogenes Length = 521 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 307 | |||
| 4dg8_A | 620 | PA1221; ANL superfamily, adenylation domain, pepti | 9e-15 | |
| 4dg8_A | 620 | PA1221; ANL superfamily, adenylation domain, pepti | 8e-09 | |
| 3l8c_A | 521 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 1e-14 | |
| 3l8c_A | 521 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 2e-08 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 3e-14 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 4e-08 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 6e-04 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 4e-14 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 2e-08 | |
| 3e7w_A | 511 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 1e-13 | |
| 3e7w_A | 511 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 2e-08 | |
| 3fce_A | 512 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 2e-13 | |
| 3fce_A | 512 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 2e-08 | |
| 1amu_A | 563 | GRSA, gramicidin synthetase 1; peptide synthetase, | 3e-13 | |
| 1amu_A | 563 | GRSA, gramicidin synthetase 1; peptide synthetase, | 3e-08 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 2e-04 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 3e-04 | |
| 3t5a_A | 480 | Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C | 6e-04 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 6e-04 |
| >4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Length = 620 | Back alignment and structure |
|---|
Score = 73.7 bits (182), Expect = 9e-15
Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
Query: 153 RMYKTGDYGRIVDD-ILLYEGRTDSQVKIRGNRVDLSEVEAALSKLSEV 200
R Y+TGD R + L + GR D QVK+ G R+DL +E + +
Sbjct: 396 RAYRTGDRARYDEQGRLRFIGRGDGQVKLNGYRLDLPALEQRFRRQPGI 444
|
| >4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Length = 620 | Back alignment and structure |
|---|
| >3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Length = 521 | Back alignment and structure |
|---|
| >3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Length = 521 | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Length = 562 | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Length = 562 | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Length = 562 | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Length = 1304 | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Length = 1304 | Back alignment and structure |
|---|
| >3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Length = 511 | Back alignment and structure |
|---|
| >3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Length = 511 | Back alignment and structure |
|---|
| >3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Length = 512 | Back alignment and structure |
|---|
| >3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Length = 512 | Back alignment and structure |
|---|
| >1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Length = 563 | Back alignment and structure |
|---|
| >1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Length = 563 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Length = 480 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| 4fuq_A | 503 | Malonyl COA synthetase; ANL superfamily, methylma | 99.87 | |
| 3ni2_A | 536 | 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy | 99.86 | |
| 1mdb_A | 539 | 2,3-dihydroxybenzoate-AMP ligase; adenylation doma | 99.85 | |
| 4dg8_A | 620 | PA1221; ANL superfamily, adenylation domain, pepti | 99.85 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 99.84 | |
| 2d1s_A | 548 | Luciferase, luciferin 4-monooxygenase; alpha/beta, | 99.83 | |
| 3e7w_A | 511 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.83 | |
| 4gr5_A | 570 | Non-ribosomal peptide synthetase; MBTH-like domain | 99.83 | |
| 3r44_A | 517 | Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s | 99.82 | |
| 3o83_A | 544 | Peptide arylation enzyme; ligase, adenylation of 2 | 99.82 | |
| 3fce_A | 512 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.82 | |
| 1t5h_X | 504 | 4-chlorobenzoyl COA ligase; adenylate-forming coen | 99.82 | |
| 3g7s_A | 549 | Long-chain-fatty-acid--COA ligase (FADD-1); protei | 99.81 | |
| 3rix_A | 550 | Luciferase, luciferin 4-monooxygenase; oxidoreduct | 99.81 | |
| 3etc_A | 580 | AMP-binding protein; adenylate-forming acyl-COA sy | 99.81 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 99.81 | |
| 3l8c_A | 521 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.81 | |
| 1amu_A | 563 | GRSA, gramicidin synthetase 1; peptide synthetase, | 99.8 | |
| 1pg4_A | 652 | Acetyl-COA synthetase; AMP-forming, adenylate-form | 99.8 | |
| 3nyq_A | 505 | Malonyl-COA ligase; A/B topology ababa sandwich be | 99.8 | |
| 3gqw_A | 576 | Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen | 99.8 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 99.79 | |
| 3ivr_A | 509 | Putative long-chain-fatty-acid COA ligase; structu | 99.78 | |
| 1v25_A | 541 | Long-chain-fatty-acid-COA synthetase; ligase, stru | 99.77 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 99.77 | |
| 3c5e_A | 570 | Acyl-coenzyme A synthetase ACSM2A, mitochondrial; | 99.76 | |
| 4gs5_A | 358 | Acyl-COA synthetase (AMP-forming)/AMP-acid ligase | 99.75 | |
| 3kxw_A | 590 | Saframycin MX1 synthetase B; fatty acid AMP ligase | 99.75 | |
| 3ipl_A | 501 | 2-succinylbenzoate--COA ligase; structural genomic | 99.75 | |
| 1ry2_A | 663 | Acetyl-coenzyme A synthetase 1, acyl-activating en | 99.73 | |
| 2v7b_A | 529 | Benzoate-coenzyme A ligase; benzoate oxidation, be | 99.71 | |
| 4dg8_A | 620 | PA1221; ANL superfamily, adenylation domain, pepti | 99.52 | |
| 3etc_A | 580 | AMP-binding protein; adenylate-forming acyl-COA sy | 99.52 | |
| 3qov_A | 436 | Phenylacetate-coenzyme A ligase; acetyl-COA synthe | 99.51 | |
| 3g7s_A | 549 | Long-chain-fatty-acid--COA ligase (FADD-1); protei | 99.5 | |
| 3rix_A | 550 | Luciferase, luciferin 4-monooxygenase; oxidoreduct | 99.5 | |
| 3ni2_A | 536 | 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy | 99.47 | |
| 4gr5_A | 570 | Non-ribosomal peptide synthetase; MBTH-like domain | 99.45 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 99.45 | |
| 1amu_A | 563 | GRSA, gramicidin synthetase 1; peptide synthetase, | 99.44 | |
| 2y27_A | 437 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.44 | |
| 3e7w_A | 511 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.44 | |
| 3fce_A | 512 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.43 | |
| 2y4o_A | 443 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.43 | |
| 3r44_A | 517 | Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s | 99.43 | |
| 3l8c_A | 521 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.42 | |
| 1pg4_A | 652 | Acetyl-COA synthetase; AMP-forming, adenylate-form | 99.42 | |
| 2d1s_A | 548 | Luciferase, luciferin 4-monooxygenase; alpha/beta, | 99.39 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 99.38 | |
| 3nyq_A | 505 | Malonyl-COA ligase; A/B topology ababa sandwich be | 99.36 | |
| 3c5e_A | 570 | Acyl-coenzyme A synthetase ACSM2A, mitochondrial; | 99.35 | |
| 3ivr_A | 509 | Putative long-chain-fatty-acid COA ligase; structu | 99.35 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 99.34 | |
| 1ry2_A | 663 | Acetyl-coenzyme A synthetase 1, acyl-activating en | 99.34 | |
| 2v7b_A | 529 | Benzoate-coenzyme A ligase; benzoate oxidation, be | 99.34 | |
| 1t5h_X | 504 | 4-chlorobenzoyl COA ligase; adenylate-forming coen | 99.32 | |
| 3ipl_A | 501 | 2-succinylbenzoate--COA ligase; structural genomic | 99.32 | |
| 3t5a_A | 480 | Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C | 99.29 | |
| 1v25_A | 541 | Long-chain-fatty-acid-COA synthetase; ligase, stru | 99.26 | |
| 3gqw_A | 576 | Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen | 99.21 | |
| 3kxw_A | 590 | Saframycin MX1 synthetase B; fatty acid AMP ligase | 99.21 | |
| 3qov_A | 436 | Phenylacetate-coenzyme A ligase; acetyl-COA synthe | 99.17 | |
| 4fuq_A | 503 | Malonyl COA synthetase; ANL superfamily, methylma | 98.7 | |
| 1mdb_A | 539 | 2,3-dihydroxybenzoate-AMP ligase; adenylation doma | 98.63 | |
| 3o83_A | 544 | Peptide arylation enzyme; ligase, adenylation of 2 | 98.6 | |
| 3lax_A | 109 | Phenylacetate-coenzyme A ligase; structural genomi | 98.53 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 98.48 | |
| 3lax_A | 109 | Phenylacetate-coenzyme A ligase; structural genomi | 98.23 | |
| 3gxs_A | 109 | Phenylacetate-coenzyme A ligase; APC62324.1, struc | 98.19 | |
| 3gxs_A | 109 | Phenylacetate-coenzyme A ligase; APC62324.1, struc | 98.09 | |
| 2y27_A | 437 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 98.06 | |
| 4gs5_A | 358 | Acyl-COA synthetase (AMP-forming)/AMP-acid ligase | 97.99 | |
| 2y4o_A | 443 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 97.99 | |
| 3hgu_A | 369 | EHPF; phenazine, antibiotic, biosynthetic protein; | 97.25 | |
| 3t5a_A | 480 | Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C | 96.22 | |
| 3hgu_A | 369 | EHPF; phenazine, antibiotic, biosynthetic protein; | 94.89 | |
| 4b2g_A | 609 | GH3-1 auxin conjugating enzyme; signaling protein, | 94.76 | |
| 4eql_A | 581 | 4-substituted benzoates-glutamate ligase GH3.12; f | 94.31 | |
| 4epl_A | 581 | Jasmonic acid-amido synthetase JAR1; ANL adenylati | 93.3 |
| >4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* | Back alignment and structure |
|---|
Probab=99.87 E-value=7.6e-22 Score=187.61 Aligned_cols=117 Identities=20% Similarity=0.248 Sum_probs=96.1
Q ss_pred ecCCcceEEEEEe---eeccccCCcc----ccccccEEeecCeEEE-ECCeEEEeeecCCeEEECCeeechhHHHHHHhc
Q psy8473 125 MYKTGDYGRIVDD---IHRCWSSGDR----AIKYRRMYKTGDYGRI-VDDILLYEGRTDSQVKIRGNRVDLSEVEAALSK 196 (307)
Q Consensus 125 ~~~~g~~Gel~v~---v~~gy~~~~~----~~~~~~~~~tGD~g~~-~~g~l~~~GR~~~~i~~~G~~v~~~eiE~~l~~ 196 (307)
+++.|..|||+++ ++.|||++++ ....++||+|||+|++ ++|+++++||.||+||++|++|+|.|||+.+.+
T Consensus 341 ~~~~g~~GEl~v~g~~v~~GY~~~~~~t~~~f~~~g~~~TGDl~~~~~dG~l~~~GR~dd~ik~~G~~v~p~eIE~~l~~ 420 (503)
T 4fuq_A 341 ELPRGDIGMIEVKGPNVFKGYWRMPEKTKSEFRDDGFFITGDLGKIDERGYVHILGRGKDLVITGGFNVYPKEIESEIDA 420 (503)
T ss_dssp BCCTTCCEEEEEESTTSCCCBTTCHHHHHHTBCTTSCEEEEEEEEECTTCEEEECCSSTTCEEETTEEECHHHHHHHHHT
T ss_pred CCcCCCceEEEEECCchhhhhcCChhhhHhhhCCCCCeEcceeEEEcCCCcEEEEecCCCEEEECCEEECHHHHHHHHHh
Confidence 4567788999999 9999999988 3334789999999999 599999999999999999999999999999999
Q ss_pred CCCcceEEEEEeeCCCcceEEEEeeecccCcccccccccccccccccCCcccchhhHHHHHccc
Q psy8473 197 LSEVDKLSVLCYKPGEVDQVSEVTSEEIRGVDDILLYEGRTDSQVKIRGNRVDLSEVEAALSKI 260 (307)
Q Consensus 197 ~p~V~~~~v~~~~~~~~~~~~~~~~~~~~~~dg~~~~~gR~dd~ik~~G~~i~~~eIe~~L~~~ 260 (307)
+|+|.+++|++.+++..+..+.. ++ +...|..++..++.+.|+++
T Consensus 421 ~p~V~~a~vv~~~~~~~~~~~~a-------------~v------~~~~~~~~~~~~l~~~l~~~ 465 (503)
T 4fuq_A 421 MPGVVESAVIGVPHADFGEGVTA-------------VV------VRDKGATIDEAQVLHGLDGQ 465 (503)
T ss_dssp STTEEEEEEEEEEETTTEEEEEE-------------EE------EECTTCCCCHHHHHHHHBTT
T ss_pred CCCeeEEEEEEeEchhcCceeEE-------------EE------EeCCCCCCCHHHHHHHHHhh
Confidence 99999999999988776655522 22 11224456677888888765
|
| >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* | Back alignment and structure |
|---|
| >1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A | Back alignment and structure |
|---|
| >4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* | Back alignment and structure |
|---|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* | Back alignment and structure |
|---|
| >3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* | Back alignment and structure |
|---|
| >4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A | Back alignment and structure |
|---|
| >3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A | Back alignment and structure |
|---|
| >3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* | Back alignment and structure |
|---|
| >3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* | Back alignment and structure |
|---|
| >1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* | Back alignment and structure |
|---|
| >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} | Back alignment and structure |
|---|
| >3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A | Back alignment and structure |
|---|
| >3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* | Back alignment and structure |
|---|
| >1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* | Back alignment and structure |
|---|
| >3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 | Back alignment and structure |
|---|
| >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} | Back alignment and structure |
|---|
| >3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* | Back alignment and structure |
|---|
| >4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* | Back alignment and structure |
|---|
| >3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* | Back alignment and structure |
|---|
| >3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* | Back alignment and structure |
|---|
| >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} | Back alignment and structure |
|---|
| >3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A | Back alignment and structure |
|---|
| >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* | Back alignment and structure |
|---|
| >4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* | Back alignment and structure |
|---|
| >3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* | Back alignment and structure |
|---|
| >3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* | Back alignment and structure |
|---|
| >2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A | Back alignment and structure |
|---|
| >3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* | Back alignment and structure |
|---|
| >1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* | Back alignment and structure |
|---|
| >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* | Back alignment and structure |
|---|
| >3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* | Back alignment and structure |
|---|
| >3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} | Back alignment and structure |
|---|
| >1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* | Back alignment and structure |
|---|
| >3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A | Back alignment and structure |
|---|
| >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* | Back alignment and structure |
|---|
| >3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* | Back alignment and structure |
|---|
| >3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* | Back alignment and structure |
|---|
| >4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* | Back alignment and structure |
|---|
| >1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A | Back alignment and structure |
|---|
| >3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* | Back alignment and structure |
|---|
| >3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* | Back alignment and structure |
|---|
| >4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* | Back alignment and structure |
|---|
| >3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A | Back alignment and structure |
|---|
| >3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* | Back alignment and structure |
|---|
| >4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} | Back alignment and structure |
|---|
| >4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* | Back alignment and structure |
|---|
| >4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 307 | ||||
| d1amua_ | 514 | e.23.1.1 (A:) Phenylalanine activating domain of g | 6e-11 | |
| d1amua_ | 514 | e.23.1.1 (A:) Phenylalanine activating domain of g | 2e-06 | |
| d1lcia_ | 541 | e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali | 5e-10 | |
| d1lcia_ | 541 | e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali | 3e-05 | |
| d1pg4a_ | 643 | e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en | 1e-09 | |
| d1pg4a_ | 643 | e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en | 4e-04 | |
| d1pg4a_ | 643 | e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en | 0.001 | |
| d1ry2a_ | 640 | e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast | 2e-09 | |
| d1ry2a_ | 640 | e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast | 2e-04 | |
| d1v25a_ | 534 | e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 | 4e-09 | |
| d1v25a_ | 534 | e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 | 9e-05 | |
| d3cw9a1 | 503 | e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc | 5e-07 | |
| d3cw9a1 | 503 | e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc | 4e-05 | |
| d1mdba_ | 536 | e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B | 1e-06 | |
| d1mdba_ | 536 | e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B | 1e-05 |
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Phenylalanine activating domain of gramicidin synthetase 1 species: Bacillus brevis [TaxId: 1393]
Score = 60.7 bits (146), Expect = 6e-11
Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 9/99 (9%)
Query: 136 DDIHRCWSSGDRAIKYRRMYKTGDYGRIVDD-ILLYEGRTDSQVKIRGNRVDLSEVEAAL 194
++ + + ++YKTGD R + D + Y GR D+QVKIRG+RV+L EVE+ L
Sbjct: 374 PELTSQKFVDNPFVPGEKLYKTGDQARWLSDGNIEYLGRIDNQVKIRGHRVELEEVESIL 433
Query: 195 SKLSEVDKLSVLCYKPGEVDQV--------SEVTSEEIR 225
K + + +V +K + + E++R
Sbjct: 434 LKHMYISETAVSVHKDHQEQPYLCAYFVSEKHIPLEQLR 472
|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 | Back information, alignment and structure |
|---|
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 | Back information, alignment and structure |
|---|
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 | Back information, alignment and structure |
|---|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 | Back information, alignment and structure |
|---|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 | Back information, alignment and structure |
|---|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 | Back information, alignment and structure |
|---|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 | Back information, alignment and structure |
|---|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 307 | |||
| d1lcia_ | 541 | Luciferase {Firefly (Photinus pyralis) [TaxId: 705 | 99.86 | |
| d1amua_ | 514 | Phenylalanine activating domain of gramicidin synt | 99.82 | |
| d1pg4a_ | 643 | Acetyl-CoA synthetase {Salmonella enterica [TaxId: | 99.8 | |
| d1mdba_ | 536 | Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil | 99.8 | |
| d3cw9a1 | 503 | 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId | 99.75 | |
| d1v25a_ | 534 | Long chain fatty acid-CoA ligase TT0168 {Thermus t | 99.73 | |
| d1ry2a_ | 640 | Acetyl-CoA synthetase {Baker's yeast (Saccharomyce | 99.73 | |
| d1pg4a_ | 643 | Acetyl-CoA synthetase {Salmonella enterica [TaxId: | 99.49 | |
| d1ry2a_ | 640 | Acetyl-CoA synthetase {Baker's yeast (Saccharomyce | 99.43 | |
| d1v25a_ | 534 | Long chain fatty acid-CoA ligase TT0168 {Thermus t | 99.2 | |
| d1amua_ | 514 | Phenylalanine activating domain of gramicidin synt | 98.54 | |
| d1lcia_ | 541 | Luciferase {Firefly (Photinus pyralis) [TaxId: 705 | 98.46 | |
| d3cw9a1 | 503 | 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId | 98.46 | |
| d1mdba_ | 536 | Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil | 98.33 |
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Luciferase species: Firefly (Photinus pyralis) [TaxId: 7054]
Probab=99.86 E-value=9.5e-22 Score=185.08 Aligned_cols=116 Identities=16% Similarity=0.196 Sum_probs=90.8
Q ss_pred cCCcceEEEEEe---eeccccCCcc----ccccccEEeecCeEEE-ECCeEEEeeecCCeEEECCeeechhHHHHHHhcC
Q psy8473 126 YKTGDYGRIVDD---IHRCWSSGDR----AIKYRRMYKTGDYGRI-VDDILLYEGRTDSQVKIRGNRVDLSEVEAALSKL 197 (307)
Q Consensus 126 ~~~g~~Gel~v~---v~~gy~~~~~----~~~~~~~~~tGD~g~~-~~g~l~~~GR~~~~i~~~G~~v~~~eiE~~l~~~ 197 (307)
++.|..|||+++ ++.||+++++ ....++||+|||+|++ ++|.+++.||.+|+||++|++|+|.+||+.+.++
T Consensus 379 ~~~g~~Gel~v~g~~~~~gY~~~~~~~~~~~~~~~~~~TGDl~~~~~~G~~~~~GR~~d~i~~~G~~v~~~~IE~~l~~~ 458 (541)
T d1lcia_ 379 LGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQH 458 (541)
T ss_dssp CCTTCCEEEEEESTTSCSEETTBHHHHHHHBCTTSCEEEEEEEEECTTCCEEEC-----CEEETTEEECHHHHHHHHHTS
T ss_pred CCCCCeEEEEEccCccCCeeCCChhhhhhcccCCccccCCCeeEEcCCeEEEEeeeecCEEEECCEEECHHHHHHHHHhC
Confidence 456778999999 9999999876 3456889999999999 5899999999999999999999999999999999
Q ss_pred CCcceEEEEEeeCCCcceEEEEeeecccCcccccccccccccccccCCcccchhhHHHHHccc
Q psy8473 198 SEVDKLSVLCYKPGEVDQVSEVTSEEIRGVDDILLYEGRTDSQVKIRGNRVDLSEVEAALSKI 260 (307)
Q Consensus 198 p~V~~~~v~~~~~~~~~~~~~~~~~~~~~~dg~~~~~gR~dd~ik~~G~~i~~~eIe~~L~~~ 260 (307)
|.|.++++++.+++..++.+.+. + +...|..+...+|.+.++++
T Consensus 459 p~V~~~~v~~~~~~~~g~~~~a~-------------v------~~~~~~~~~~~~l~~~~~~~ 502 (541)
T d1lcia_ 459 PNIFDAGVAGLPDDDAGELPAAV-------------V------VLEHGKTMTEKEIVDYVASQ 502 (541)
T ss_dssp TTEEEEEEEEEEETTTEEEEEEE-------------E------EECTTCCCCHHHHHHHHHHH
T ss_pred CCccEEEEEEEECCCCCEEEEEE-------------E------EECCCCCCCHHHHHHHHHHh
Confidence 99999999999887776665222 2 11234456677888887764
|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} | Back information, alignment and structure |
|---|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} | Back information, alignment and structure |
|---|
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|