Psyllid ID: psy860


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGSAIRFSPFQAAQNSLLMTNIMHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYSGGNKRKLSTAMALIGDRDDGFQKLPFSSQNLYNTT
ccHHHHHHcccccccHHHHHccccccccccEEEEEcccccccccHHHHHHHHHHcccccccccEEEEcccccccHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccEEEEccccccccccccc
cccEEEcccccccccHHHHHHHHcccccccHHcHHEEEccccccccccHHHHHcccccccccEEEEcccccHccHHHHHHHHHHccccccHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHcHcccccccHHHHHHHHHHcccccEEEEccccccccccccc
mhlfqylsgigycpqfngineHLTAQEMLECFSAlrgipgvksgpIIDYWIDLLGsairfspfqaAQNSLLMTNIMHLFQYLsgigycpqfngineHLTAQEMLECFSAlrgipgvksgpiIDYWIDLLGLTeyrhrvsgrysggnkrkLSTAMALIgdrddgfqklpfssqnlyntt
MHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGSAIRFSPFQAAQNSLLMTNIMHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRvsgrysggnkrkLSTAMALIGDrddgfqklpfssqnlyntt
MHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGSAIRFSPFQAAQNSLLMTNIMHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYSGGNKRKLSTAMALIGDRDDGFQKLPFSSQNLYNTT
**LFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGSAIRFSPFQAAQNSLLMTNIMHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYS***********ALI*********************
*HLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGSAIRFSPFQAAQNSLLMTNIMHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYSGGNKRKLSTAMALIGDRDDGFQKLPFSSQNLYN**
MHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGSAIRFSPFQAAQNSLLMTNIMHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYSGGNKRKLSTAMALIGDRDDGFQKLPFSSQNLYNTT
MHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGSAIRFSPFQAAQNSLLMTNIMHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYSGGNKRKLSTAMALIGDRDDGFQKLPFSSQ******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGSAIRFSPFQAAQNSLLMTNIMHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYSGGNKRKLSTAMALIGDRDDGFQKLPFSSQNLYNTT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query178 2.2.26 [Sep-21-2011]
O95477 2261 ATP-binding cassette sub- yes N/A 0.494 0.038 0.510 1e-17
P41233 2261 ATP-binding cassette sub- yes N/A 0.494 0.038 0.5 7e-17
P41234 2434 ATP-binding cassette sub- no N/A 0.455 0.033 0.481 2e-16
P78363 2273 Retinal-specific ATP-bind no N/A 0.685 0.053 0.403 4e-16
Q9ESR9 2434 ATP-binding cassette sub- no N/A 0.455 0.033 0.469 3e-15
O35600 2310 Retinal-specific ATP-bind no N/A 0.685 0.052 0.379 6e-15
Q9BZC7 2435 ATP-binding cassette sub- no N/A 0.471 0.034 0.440 2e-14
Q8IZY2 2146 ATP-binding cassette sub- no N/A 0.421 0.034 0.493 1e-13
Q7TNJ2 2170 ATP-binding cassette sub- no N/A 0.421 0.034 0.493 2e-13
Q91V24 2159 ATP-binding cassette sub- no N/A 0.421 0.034 0.493 2e-13
>sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 64/92 (69%), Gaps = 4/92 (4%)

Query: 67   QNSLLMTNIMHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWI 126
            +NS+L +NI  + Q    +GYCPQF+ I E LT +E +E F+ LRG+P  + G + ++ I
Sbjct: 1974 KNSIL-SNIHEVHQ---NMGYCPQFDAITELLTGREHVEFFALLRGVPEKEVGKVGEWAI 2029

Query: 127  DLLGLTEYRHRVSGRYSGGNKRKLSTAMALIG 158
              LGL +Y  + +G YSGGNKRKLSTAMALIG
Sbjct: 2030 RKLGLVKYGEKYAGNYSGGNKRKLSTAMALIG 2061




cAMP-dependent and sulfonylurea-sensitive anion transporter. Key gatekeeper influencing intracellular cholesterol transport.
Homo sapiens (taxid: 9606)
>sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 Back     alignment and function description
>sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 Back     alignment and function description
>sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 Back     alignment and function description
>sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 Back     alignment and function description
>sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 Back     alignment and function description
>sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 Back     alignment and function description
>sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 Back     alignment and function description
>sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 Back     alignment and function description
>sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
328705811 1747 PREDICTED: ATP-binding cassette sub-fami 0.511 0.052 0.571 2e-21
328722868 670 PREDICTED: ATP-binding cassette sub-fami 0.511 0.135 0.560 3e-20
380798443 1135 ATP-binding cassette sub-family A member 0.494 0.077 0.510 1e-16
432927363 2281 PREDICTED: retinal-specific ATP-binding 0.477 0.037 0.488 3e-16
391342738 1726 PREDICTED: ATP-binding cassette sub-fami 0.449 0.046 0.5 5e-16
395823965 2261 PREDICTED: ATP-binding cassette sub-fami 0.494 0.038 0.510 5e-16
334333485 2255 PREDICTED: ATP-binding cassette sub-fami 0.494 0.039 0.510 6e-16
355666205 667 ATP-binding cassette, sub-family A , mem 0.494 0.131 0.5 6e-16
291382853 2261 PREDICTED: ATP-binding cassette, sub-fam 0.494 0.038 0.510 6e-16
355567561 2261 ATP-binding cassette transporter 1 [Maca 0.494 0.038 0.510 7e-16
>gi|328705811|ref|XP_001947916.2| PREDICTED: ATP-binding cassette sub-family A member 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 62/91 (68%)

Query: 80   QYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVS 139
            QY+S IGYCPQF+ IN+ LT +E L   + LRGI    +   +D WI LLGL EY+ RV 
Sbjct: 1496 QYVSLIGYCPQFDAINDQLTGRETLRLMAILRGISPTNTKKHVDKWIKLLGLEEYKDRVC 1555

Query: 140  GRYSGGNKRKLSTAMALIGDRDDGFQKLPFS 170
            G+YSGGNKRKL+TAMALIGD    F   P S
Sbjct: 1556 GKYSGGNKRKLNTAMALIGDPPVVFLDEPTS 1586




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328722868|ref|XP_001949822.2| PREDICTED: ATP-binding cassette sub-family A member 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|380798443|gb|AFE71097.1| ATP-binding cassette sub-family A member 1, partial [Macaca mulatta] Back     alignment and taxonomy information
>gi|432927363|ref|XP_004080989.1| PREDICTED: retinal-specific ATP-binding cassette transporter-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|391342738|ref|XP_003745672.1| PREDICTED: ATP-binding cassette sub-family A member 1-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|395823965|ref|XP_003785245.1| PREDICTED: ATP-binding cassette sub-family A member 1 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|334333485|ref|XP_001368140.2| PREDICTED: ATP-binding cassette sub-family A member 1 [Monodelphis domestica] Back     alignment and taxonomy information
>gi|355666205|gb|AER93459.1| ATP-binding cassette, sub-family A , member 1 [Mustela putorius furo] Back     alignment and taxonomy information
>gi|291382853|ref|XP_002708179.1| PREDICTED: ATP-binding cassette, sub-family A member 1-like [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|355567561|gb|EHH23902.1| ATP-binding cassette transporter 1 [Macaca mulatta] gi|355753139|gb|EHH57185.1| ATP-binding cassette transporter 1 [Macaca fascicularis] gi|383409531|gb|AFH27979.1| ATP-binding cassette sub-family A member 1 [Macaca mulatta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query178
ZFIN|ZDB-GENE-050517-4 2350 abca4b "ATP-binding cassette, 0.679 0.051 0.415 3.8e-19
UNIPROTKB|O95477 2261 ABCA1 "ATP-binding cassette su 0.679 0.053 0.446 4.3e-19
ZFIN|ZDB-GENE-050517-3 2277 abca4a "ATP-binding cassette, 0.679 0.053 0.407 4.5e-19
UNIPROTKB|E1C619 2225 E1C619 "Uncharacterized protei 0.488 0.039 0.494 6.8e-19
UNIPROTKB|E1C2W8 2255 E1C2W8 "Uncharacterized protei 0.488 0.038 0.494 7.1e-19
UNIPROTKB|F1S539 2278 ABCA4 "Uncharacterized protein 0.685 0.053 0.403 7.2e-19
UNIPROTKB|F1N8D7 2277 ABCA4 "Uncharacterized protein 0.679 0.053 0.4 7.2e-19
RGD|631344 2201 Abca1 "ATP-binding cassette, s 0.679 0.054 0.430 8.4e-19
UNIPROTKB|F1LNL3 2258 Abca1 "Protein Abca1" [Rattus 0.679 0.053 0.430 8.9e-19
UNIPROTKB|F1LRX9 2258 Abca1 "Protein Abca1" [Rattus 0.679 0.053 0.430 8.9e-19
ZFIN|ZDB-GENE-050517-4 abca4b "ATP-binding cassette, sub-family A (ABC1), member 4b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 213 (80.0 bits), Expect = 3.8e-19, Sum P(2) = 3.8e-19
 Identities = 54/130 (41%), Positives = 77/130 (59%)

Query:    30 ECFSALRGIPGVKSGPIIDYWIDLLGSA-IRFSPFQAAQNSLLMTNIMHLFQYLSGIGYC 88
             ECF  L G+ G  +G    + + L G   +       A  S+L +NI+ + Q    +GYC
Sbjct:  2031 ECFGLL-GVNG--AGKTTTFKM-LTGDTDVTSGELSVAGYSIL-SNILDVHQ---NMGYC 2082

Query:    89 PQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYSGGNKR 148
             PQF+ I+E LT +E L  ++ LRGIP  +   + ++ I  LGL+EY    +G YSGGNKR
Sbjct:  2083 PQFDAIDELLTGREHLYLYARLRGIPESEISRVAEWGIQKLGLSEYAGNCAGTYSGGNKR 2142

Query:   149 KLSTAMALIG 158
             KLSTA+A+IG
Sbjct:  2143 KLSTAIAMIG 2152


GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|O95477 ABCA1 "ATP-binding cassette sub-family A member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050517-3 abca4a "ATP-binding cassette, sub-family A (ABC1), member 4a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C619 E1C619 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2W8 E1C2W8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S539 ABCA4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8D7 ABCA4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|631344 Abca1 "ATP-binding cassette, subfamily A (ABC1), member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LNL3 Abca1 "Protein Abca1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRX9 Abca1 "Protein Abca1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O95477ABCA1_HUMANNo assigned EC number0.51080.49430.0389yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 6e-24
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 3e-20
COG1131 293 COG1131, CcmA, ABC-type multidrug transport system 3e-17
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 1e-13
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 3e-12
TIGR01188 302 TIGR01188, drrA, daunorubicin resistance ABC trans 7e-10
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 4e-07
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 5e-07
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 2e-06
pfam00005119 pfam00005, ABC_tran, ABC transporter 4e-06
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 5e-06
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 5e-06
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 6e-06
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 7e-06
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 3e-05
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 7e-05
COG4152 300 COG4152, COG4152, ABC-type uncharacterized transpo 1e-04
TIGR03522 301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 2e-04
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 3e-04
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 4e-04
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 4e-04
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 5e-04
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 0.001
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 0.001
PRK13536 340 PRK13536, PRK13536, nodulation factor exporter sub 0.002
cd03234226 cd03234, ABCG_White, White pigment protein homolog 0.002
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 0.003
PRK13537 306 PRK13537, PRK13537, nodulation ABC transporter Nod 0.004
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
 Score = 93.0 bits (232), Expect = 6e-24
 Identities = 32/89 (35%), Positives = 53/89 (59%), Gaps = 3/89 (3%)

Query: 71  LMTNIMHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLG 130
           + T+     Q    +GYCPQF+ + + LT +E L  ++ L+G+P  +    ++  + +LG
Sbjct: 66  IRTDRKAARQS---LGYCPQFDALFDELTVREHLRFYARLKGLPKSEIKEEVELLLRVLG 122

Query: 131 LTEYRHRVSGRYSGGNKRKLSTAMALIGD 159
           LT+  ++ +   SGG KRKLS A+ALIG 
Sbjct: 123 LTDKANKRARTLSGGMKRKLSLAIALIGG 151


The ABCA subfamily mediates the transport of a variety of lipid compounds. Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages. Length = 220

>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 178
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 100.0
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
PRK13537 306 nodulation ABC transporter NodI; Provisional 100.0
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 100.0
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 100.0
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 100.0
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 100.0
PRK13536 340 nodulation factor exporter subunit NodI; Provision 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG4152 300 ABC-type uncharacterized transport system, ATPase 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
COG4161242 ArtP ABC-type arginine transport system, ATPase co 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK10261 623 glutathione transporter ATP-binding protein; Provi 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK10261 623 glutathione transporter ATP-binding protein; Provi 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
COG0444 316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 100.0
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
COG1123 539 ATPase components of various ABC-type transport sy 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
KOG0058|consensus716 100.0
PLN03211 659 ABC transporter G-25; Provisional 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
KOG0055|consensus 1228 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
PRK10938 490 putative molybdenum transport ATP-binding protein 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
PRK10535 648 macrolide transporter ATP-binding /permease protei 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.98
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.98
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.98
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.98
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.98
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.98
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.98
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.98
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.98
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.98
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.98
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.98
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.98
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.98
COG4988559 CydD ABC-type transport system involved in cytochr 99.97
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.97
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.97
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.97
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.97
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.97
PRK10938490 putative molybdenum transport ATP-binding protein 99.97
cd03246173 ABCC_Protease_Secretion This family represents the 99.97
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.97
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.97
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.97
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.97
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.97
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.97
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.97
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.97
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.97
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.97
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.97
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.97
COG4172534 ABC-type uncharacterized transport system, duplica 99.97
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.97
KOG0059|consensus 885 99.97
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.97
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.97
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.97
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.97
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.97
KOG0057|consensus591 99.97
PRK13409590 putative ATPase RIL; Provisional 99.97
KOG0055|consensus1228 99.97
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.97
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.97
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.97
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.97
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.97
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.97
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.97
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.97
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 99.97
PLN032321495 ABC transporter C family member; Provisional 99.97
PLN03130 1622 ABC transporter C family member; Provisional 99.97
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.97
PLN03140 1470 ABC transporter G family member; Provisional 99.97
PRK11147 635 ABC transporter ATPase component; Reviewed 99.97
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.97
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.97
KOG0061|consensus 613 99.97
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.97
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.96
PTZ002431560 ABC transporter; Provisional 99.96
COG4133209 CcmA ABC-type transport system involved in cytochr 99.96
COG4172 534 ABC-type uncharacterized transport system, duplica 99.96
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.96
COG4136213 ABC-type uncharacterized transport system, ATPase 99.96
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.96
COG4987573 CydC ABC-type transport system involved in cytochr 99.96
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.96
PRK13409 590 putative ATPase RIL; Provisional 99.96
PLN03140 1470 ABC transporter G family member; Provisional 99.96
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.96
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.96
PLN03073718 ABC transporter F family; Provisional 99.96
COG4586 325 ABC-type uncharacterized transport system, ATPase 99.96
PRK11147 635 ABC transporter ATPase component; Reviewed 99.96
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.95
COG0488 530 Uup ATPase components of ABC transporters with dup 99.95
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.95
KOG0056|consensus790 99.95
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.95
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.95
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.94
PLN03232 1495 ABC transporter C family member; Provisional 99.94
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.94
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.94
PLN03130 1622 ABC transporter C family member; Provisional 99.94
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.94
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.94
PTZ00243 1560 ABC transporter; Provisional 99.94
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.93
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.93
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.93
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.92
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.92
COG0488530 Uup ATPase components of ABC transporters with dup 99.92
PLN03073 718 ABC transporter F family; Provisional 99.92
KOG0054|consensus1381 99.91
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.91
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.89
KOG0065|consensus 1391 99.89
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.89
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.88
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.88
KOG0054|consensus 1381 99.88
KOG0927|consensus614 99.86
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.86
COG4178604 ABC-type uncharacterized transport system, permeas 99.83
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.82
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.81
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.81
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.8
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.78
COG4170 330 SapD ABC-type antimicrobial peptide transport syst 99.78
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.77
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.77
KOG0066|consensus807 99.76
KOG0062|consensus 582 99.76
KOG0927|consensus 614 99.76
KOG0062|consensus582 99.74
KOG0060|consensus659 99.71
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.7
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.69
KOG0065|consensus 1391 99.68
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.68
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.67
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.56
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.52
KOG0064|consensus728 99.51
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 99.49
KOG0066|consensus 807 99.48
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 99.46
KOG0063|consensus592 99.44
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.43
KOG2355|consensus 291 99.4
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.4
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.39
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.39
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.35
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.35
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.34
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.32
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.29
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 99.27
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.14
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.1
KOG0063|consensus 592 98.96
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 98.94
PHA02562562 46 endonuclease subunit; Provisional 98.9
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 98.9
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 98.89
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 98.88
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 98.81
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 98.79
PRK102461047 exonuclease subunit SbcC; Provisional 98.77
TIGR006061311 rad50 rad50. This family is based on the phylogeno 98.75
TIGR00634563 recN DNA repair protein RecN. All proteins in this 98.75
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 98.74
PRK01156895 chromosome segregation protein; Provisional 98.74
PRK10869553 recombination and repair protein; Provisional 98.68
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 98.66
PRK03918880 chromosome segregation protein; Provisional 98.65
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 98.62
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 98.48
PRK00064361 recF recombination protein F; Reviewed 98.48
TIGR026801353 conserved hypothetical protein TIGR02680. Members 98.44
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 98.43
TIGR00611365 recf recF protein. All proteins in this family for 98.42
PF1355890 SbcCD_C: Putative exonuclease SbcCD, C subunit; PD 98.39
PRK00409 782 recombination and DNA strand exchange inhibitor pr 98.36
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 98.34
PRK14079349 recF recombination protein F; Provisional 98.29
cd01128249 rho_factor Transcription termination factor rho is 98.26
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 98.16
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 98.14
PRK02224880 chromosome segregation protein; Provisional 98.07
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.01
PRK06315 442 type III secretion system ATPase; Provisional 97.99
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 97.93
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 97.89
PRK13695174 putative NTPase; Provisional 97.72
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 97.68
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.64
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 97.6
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 97.59
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.57
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 97.45
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 97.43
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 97.39
smart00382148 AAA ATPases associated with a variety of cellular 97.29
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.23
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 97.14
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.06
PRK06067234 flagellar accessory protein FlaH; Validated 97.05
PRK09825176 idnK D-gluconate kinase; Provisional 96.95
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.93
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 96.88
PRK08149 428 ATP synthase SpaL; Validated 96.84
cd01136 326 ATPase_flagellum-secretory_path_III Flagellum-spec 96.65
PRK07594 433 type III secretion system ATPase SsaN; Validated 96.49
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 96.48
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 96.44
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. 96.44
PRK01889356 GTPase RsgA; Reviewed 96.37
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 96.33
COG3910233 Predicted ATPase [General function prediction only 96.33
cd01125 239 repA Hexameric Replicative Helicase RepA. RepA is 96.31
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.29
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 96.26
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 96.26
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 96.22
PRK09270229 nucleoside triphosphate hydrolase domain-containin 96.2
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 96.17
PRK09099 441 type III secretion system ATPase; Provisional 96.16
PRK10416318 signal recognition particle-docking protein FtsY; 96.11
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 96.1
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 96.01
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 95.96
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 95.94
PRK00098298 GTPase RsgA; Reviewed 95.82
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 95.78
PRK09862 506 putative ATP-dependent protease; Provisional 95.72
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 95.6
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 95.51
PLN02318 656 phosphoribulokinase/uridine kinase 95.36
PRK11545163 gntK gluconate kinase 1; Provisional 95.35
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 95.3
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 95.29
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 95.23
PRK00454196 engB GTP-binding protein YsxC; Reviewed 95.16
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=2.8e-51  Score=316.37  Aligned_cols=159  Identities=16%  Similarity=0.154  Sum_probs=148.0

Q ss_pred             hhccCccccccchhhhccHHHHHHHhhhhhCCCCCCccchHHHHHHHhhhhhccCCcccccccccccccc---cHHhhcc
Q psy860            7 LSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGSAIRFSPFQAAQNSLLMTNIM---HLFQYLS   83 (178)
Q Consensus         7 ~~~~~~~~~~~~v~~~~~~g~~~~~~~~i~G~~g~gk~~~~~~~itll~~~~~~~~~~~g~i~~~g~~~~---~~~~~~~   83 (178)
                      .+.+|...+|++||++|.+||    ..+|+||||||||       |+++|++++.+|++|.|+++|.++.   +..++|+
T Consensus         9 ~K~fg~~~VLkgi~l~v~~Ge----vv~iiGpSGSGKS-------TlLRclN~LE~~~~G~I~i~g~~~~~~~~~~~~R~   77 (240)
T COG1126           9 SKSFGDKEVLKGISLSVEKGE----VVVIIGPSGSGKS-------TLLRCLNGLEEPDSGSITVDGEDVGDKKDILKLRR   77 (240)
T ss_pred             eEEeCCeEEecCcceeEcCCC----EEEEECCCCCCHH-------HHHHHHHCCcCCCCceEEECCEeccchhhHHHHHH
Confidence            456788899999999999999    7779999999999       9999999999999999999998764   5678899


Q ss_pred             ceEEecCCCCCCCCCCHHHHHHHHH-HhcCCCCCChhHHHHHHHHHcCCCccccCcCCCCChHHHHHHHHHHHHhCCCCe
Q psy860           84 GIGYCPQFNGINEHLTAQEMLECFS-ALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYSGGNKRKLSTAMALIGDRDD  162 (178)
Q Consensus        84 ~ig~v~Q~~~l~~~ltv~e~l~~~~-~~~~~~~~~~~~~~~~~l~~~~L~~~~~~~~~~LSgGqkQRv~IAraL~~~P~~  162 (178)
                      .+|+|||+.++||++||.||+.... ...+.++.++++++.++|+++||.+.++.+|.+|||||||||+|||||+++|++
T Consensus        78 ~vGmVFQ~fnLFPHlTvleNv~lap~~v~~~~k~eA~~~A~~lL~~VGL~~ka~~yP~qLSGGQqQRVAIARALaM~P~v  157 (240)
T COG1126          78 KVGMVFQQFNLFPHLTVLENVTLAPVKVKKLSKAEAREKALELLEKVGLADKADAYPAQLSGGQQQRVAIARALAMDPKV  157 (240)
T ss_pred             hcCeecccccccccchHHHHHHhhhHHHcCCCHHHHHHHHHHHHHHcCchhhhhhCccccCcHHHHHHHHHHHHcCCCCE
Confidence            9999999999999999999999865 456788888899999999999999999999999999999999999999999999


Q ss_pred             EEeeCCCCCCCCCC
Q psy860          163 GFQKLPFSSQNLYN  176 (178)
Q Consensus       163 lllDEPt~gLD~~~  176 (178)
                      ++||||||+|||..
T Consensus       158 mLFDEPTSALDPEl  171 (240)
T COG1126         158 MLFDEPTSALDPEL  171 (240)
T ss_pred             EeecCCcccCCHHH
Confidence            99999999999974



>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>KOG0059|consensus Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0061|consensus Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>KOG0062|consensus Back     alignment and domain information
>KOG0060|consensus Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0064|consensus Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>KOG0066|consensus Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>KOG0063|consensus Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>KOG2355|consensus Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>KOG0063|consensus Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query178
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 8e-18
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 1e-05
1sgw_A214 Putative ABC transporter; structural genomics, P p 1e-15
1sgw_A214 Putative ABC transporter; structural genomics, P p 5e-05
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score = 77.2 bits (191), Expect = 8e-18
 Identities = 18/75 (24%), Positives = 30/75 (40%)

Query: 85  IGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYSG 144
           I Y P+  G   ++   E L   +        +   +++   ++ GL E        YS 
Sbjct: 90  ISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSK 149

Query: 145 GNKRKLSTAMALIGD 159
           G  RKL  A AL+ +
Sbjct: 150 GMVRKLLIARALMVN 164


>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 100.0
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 100.0
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 100.0
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 100.0
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 100.0
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 100.0
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 100.0
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 100.0
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 100.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 100.0
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 100.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 100.0
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 100.0
1sgw_A214 Putative ABC transporter; structural genomics, P p 100.0
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
1g6h_A257 High-affinity branched-chain amino acid transport 100.0
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 100.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 100.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 100.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 100.0
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 100.0
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 100.0
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 100.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 100.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 100.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 100.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 100.0
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 100.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 100.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 100.0
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 100.0
2ghi_A260 Transport protein; multidrug resistance protein, M 100.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 100.0
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 100.0
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 100.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 100.0
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 100.0
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 100.0
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.98
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.97
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.97
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.97
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.97
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.97
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.97
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.97
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.97
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.97
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.96
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.95
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.95
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.94
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.94
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.93
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.91
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.89
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.88
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.88
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.88
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.88
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 99.87
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.84
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.84
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.84
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.82
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.81
2og2_A359 Putative signal recognition particle receptor; nuc 99.8
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.79
1e69_A322 Chromosome segregation SMC protein; structural mai 99.79
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.77
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.75
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.74
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.74
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.69
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.67
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.64
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 99.63
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.61
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.58
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 99.57
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.56
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.52
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.51
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 99.5
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 99.49
2eyu_A 261 Twitching motility protein PILT; pilus retraction 99.48
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.48
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 99.45
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.45
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.44
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.43
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 99.43
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 99.42
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.41
3kta_B173 Chromosome segregation protein SMC; structural mai 99.4
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.39
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.38
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.36
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.35
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 99.35
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 99.33
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.31
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 99.31
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.31
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.25
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 99.24
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.23
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.23
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.22
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.2
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.2
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 99.18
1p9r_A418 General secretion pathway protein E; bacterial typ 99.18
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 99.17
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 99.15
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 99.14
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.11
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.1
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.1
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 99.09
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.06
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.05
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 99.04
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.03
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 99.03
2ewv_A 372 Twitching motility protein PILT; pilus retraction 99.02
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.02
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.02
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.93
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.93
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.88
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 98.87
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.84
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 98.77
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 98.73
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 98.72
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.68
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.56
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.48
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.48
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.48
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.48
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 98.41
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.39
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.34
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.28
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.26
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 98.17
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.05
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.03
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.92
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.91
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.77
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 97.72
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 97.71
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.68
2r6a_A 454 DNAB helicase, replicative helicase; replication, 97.66
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.51
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.5
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.48
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.45
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.38
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.34
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 97.32
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.23
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.2
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.13
3kta_A182 Chromosome segregation protein SMC; structural mai 96.86
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 96.85
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.85
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 96.77
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 96.76
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.76
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.71
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.62
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 96.36
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 96.15
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.66
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 95.44
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.43
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 95.34
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 95.31
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.6
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 94.37
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.33
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 94.11
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 94.01
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.83
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 93.8
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 93.75
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 93.48
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 93.37
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.96
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 92.84
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 92.66
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 91.83
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 91.34
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 91.04
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 90.95
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 90.89
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 90.74
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 90.65
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 89.85
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.82
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 89.77
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 89.58
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 89.23
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 89.18
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 87.97
3ice_A 422 Transcription termination factor RHO; transcriptio 87.27
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 87.26
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 86.82
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 86.04
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 85.97
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 85.31
2eyu_A261 Twitching motility protein PILT; pilus retraction 85.19
1b9m_A 265 Protein (mode); DNA-binding, gene regulation, wing 85.15
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 85.08
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 83.3
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 83.03
2ewv_A372 Twitching motility protein PILT; pilus retraction 82.53
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 81.7
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 81.28
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 80.79
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 80.3
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
Probab=100.00  E-value=2e-45  Score=307.48  Aligned_cols=163  Identities=16%  Similarity=0.130  Sum_probs=145.0

Q ss_pred             hhhhhccCccccccchhhhccHHHHHHHhhhhhCCCCCCccchHHHHHHHhhhhhccCCcccccccccccccccH-----
Q psy860            4 FQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGSAIRFSPFQAAQNSLLMTNIMHL-----   78 (178)
Q Consensus         4 ~~~~~~~~~~~~~~~v~~~~~~g~~~~~~~~i~G~~g~gk~~~~~~~itll~~~~~~~~~~~g~i~~~g~~~~~~-----   78 (178)
                      +.|..+.+..++|+||||+|++||    +.+|+|+||||||       ||+++++|+.+|++|+|.++|+++...     
T Consensus        32 ~~y~~~~~~~~aL~~vsl~i~~Ge----i~~IiGpnGaGKS-------TLlr~i~GL~~p~~G~I~i~G~~i~~~~~~~~  100 (366)
T 3tui_C           32 KVFHQGTRTIQALNNVSLHVPAGQ----IYGVIGASGAGKS-------TLIRCVNLLERPTEGSVLVDGQELTTLSESEL  100 (366)
T ss_dssp             EEEECSSSEEEEEEEEEEEECTTC----EEEEECCTTSSHH-------HHHHHHHTSSCCSEEEEEETTEECSSCCHHHH
T ss_pred             EEeCCCCCCeEEEEeeEEEEcCCC----EEEEEcCCCchHH-------HHHHHHhcCCCCCceEEEECCEECCcCCHHHH
Confidence            345443334579999999999999    8889999999999       999999999999999999999988642     


Q ss_pred             HhhccceEEecCCCCCCCCCCHHHHHHHHHHhcCCCCCChhHHHHHHHHHcCCCccccCcCCCCChHHHHHHHHHHHHhC
Q psy860           79 FQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYSGGNKRKLSTAMALIG  158 (178)
Q Consensus        79 ~~~~~~ig~v~Q~~~l~~~ltv~e~l~~~~~~~~~~~~~~~~~~~~~l~~~~L~~~~~~~~~~LSgGqkQRv~IAraL~~  158 (178)
                      .+.|++||||||++.+++.+||+||+.++....+.+..+.++++.++++.+||.+..++++.+|||||||||+|||||++
T Consensus       101 ~~~r~~Ig~v~Q~~~l~~~~TV~env~~~~~~~~~~~~~~~~~v~~lL~~vgL~~~~~~~~~~LSGGqkQRVaIArAL~~  180 (366)
T 3tui_C          101 TKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALAS  180 (366)
T ss_dssp             HHHHTTEEEECSSCCCCTTSCHHHHHHHHHHHSCCCHHHHHHHHHHHHHHHTCGGGTTCCTTTSCHHHHHHHHHHHHTTT
T ss_pred             HHHhCcEEEEeCCCccCCCCCHHHHHHHHHHhcCCCHHHHHHHHHHHHHHcCCchHhcCChhhCCHHHHHHHHHHHHHhc
Confidence            34577899999999999999999999998777666555667789999999999999999999999999999999999999


Q ss_pred             CCCeEEeeCCCCCCCCCCC
Q psy860          159 DRDDGFQKLPFSSQNLYNT  177 (178)
Q Consensus       159 ~P~~lllDEPt~gLD~~~~  177 (178)
                      +|++||||||||||||.++
T Consensus       181 ~P~lLLlDEPTs~LD~~~~  199 (366)
T 3tui_C          181 NPKVLLCDQATSALDPATT  199 (366)
T ss_dssp             CCSEEEEESTTTTSCHHHH
T ss_pred             CCCEEEEECCCccCCHHHH
Confidence            9999999999999999753



>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1b9m_A Protein (mode); DNA-binding, gene regulation, winged helix turn helix, molybdate, OB fold, transcription; 1.75A {Escherichia coli} SCOP: a.4.5.8 b.40.6.2 b.40.6.2 PDB: 1b9n_A 1o7l_A 1h9s_A 1h9r_A 1h9s_B Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 178
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 1e-12
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 1e-09
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 1e-08
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 3e-08
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 2e-07
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 3e-07
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 4e-05
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 7e-05
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
 Score = 61.7 bits (150), Expect = 1e-12
 Identities = 19/101 (18%), Positives = 44/101 (43%)

Query: 73  TNIMHLFQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLT 132
            ++ +L      I    Q   +  H+T  E +     ++  P  +    + +  +LL + 
Sbjct: 68  RDVTYLPPKDRNISMVFQSYAVWPHMTVYENIAFPLKIKKFPKDEIDKRVRWAAELLQIE 127

Query: 133 EYRHRVSGRYSGGNKRKLSTAMALIGDRDDGFQKLPFSSQN 173
           E  +R   + SGG +++++ A A++ + D      P S+ +
Sbjct: 128 ELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLD 168


>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query178
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.06
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.87
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.65
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 97.85
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.59
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 93.63
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.19
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 90.37
d1j8yf2211 GTPase domain of the signal sequence recognition p 90.35
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.65
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 85.28
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 85.2
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 83.24
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 82.82
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 81.49
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 81.27
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 81.22
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Methionine import ATP-binding protein MetN
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=2.1e-50  Score=318.43  Aligned_cols=163  Identities=16%  Similarity=0.128  Sum_probs=149.8

Q ss_pred             hhhhhccCccccccchhhhccHHHHHHHhhhhhCCCCCCccchHHHHHHHhhhhhccCCccccccccccccccc-----H
Q psy860            4 FQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGSAIRFSPFQAAQNSLLMTNIMH-----L   78 (178)
Q Consensus         4 ~~~~~~~~~~~~~~~v~~~~~~g~~~~~~~~i~G~~g~gk~~~~~~~itll~~~~~~~~~~~g~i~~~g~~~~~-----~   78 (178)
                      ++|..+.+...||+||||+|++||    +.+|+|+||||||       ||++++.|+.+|++|+|.++|+++..     .
T Consensus         9 k~y~~~~~~~~al~~vsl~i~~Ge----~~~iiG~sGsGKS-------TLl~~i~Gl~~p~sG~I~~~g~~i~~~~~~~~   77 (240)
T d3dhwc1           9 KVFHQGTRTIQALNNVSLHVPAGQ----IYGVIGASGAGKS-------TLIRCVNLLERPTEGSVLVDGQELTTLSESEL   77 (240)
T ss_dssp             EEEECSSCEEEEEEEEEEEECSSC----EEEEEESTTSSHH-------HHHHHHTTSSCCSEEEEEETTEEECTTCHHHH
T ss_pred             EEeCCCCeeEEEeeceeEEEcCCC----EEEEECCCCCCHH-------HHHHHHcCCccccCCceEEcCeEeeeCChhhh
Confidence            457666555689999999999999    8899999999999       99999999999999999999999854     2


Q ss_pred             HhhccceEEecCCCCCCCCCCHHHHHHHHHHhcCCCCCChhHHHHHHHHHcCCCccccCcCCCCChHHHHHHHHHHHHhC
Q psy860           79 FQYLSGIGYCPQFNGINEHLTAQEMLECFSALRGIPGVKSGPIIDYWIDLLGLTEYRHRVSGRYSGGNKRKLSTAMALIG  158 (178)
Q Consensus        79 ~~~~~~ig~v~Q~~~l~~~ltv~e~l~~~~~~~~~~~~~~~~~~~~~l~~~~L~~~~~~~~~~LSgGqkQRv~IAraL~~  158 (178)
                      .++|++||||||++++++.+||+||+.++....+.+.++.++++.++++.+||++..++++.+|||||||||+|||||+.
T Consensus        78 ~~~rr~ig~VfQ~~~l~~~~tv~eni~~~l~~~~~~~~~~~~~v~~~L~~vgL~~~~~~~~~~LSGG~~QRvaiAraL~~  157 (240)
T d3dhwc1          78 TKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALAS  157 (240)
T ss_dssp             HHHHHHEEECCSSCCCCTTSBHHHHHHHHHHTTTCCTTHHHHHHHHHHHHHSTTTTTSSCBSCCCHHHHHHHHHHHHHHT
T ss_pred             hhhhccccccccccccCCCccHHHHHHHHHHHcCCCHHHHHHHHHHHHHHcCCchhhhCChhhCCHHHHHHHHHhhhhcc
Confidence            35667899999999999999999999999888888888888899999999999999999999999999999999999999


Q ss_pred             CCCeEEeeCCCCCCCCCCC
Q psy860          159 DRDDGFQKLPFSSQNLYNT  177 (178)
Q Consensus       159 ~P~~lllDEPt~gLD~~~~  177 (178)
                      +|++|||||||+||||.++
T Consensus       158 ~P~lLllDEPt~~LD~~~~  176 (240)
T d3dhwc1         158 NPKVLLCDEATSALDPATT  176 (240)
T ss_dssp             CCSEEEEESGGGSSCHHHH
T ss_pred             CCCeEEeccccccCCHHHh
Confidence            9999999999999999754



>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure