Psyllid ID: psy8705

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MKKKELDSIPVDMNHERECISVHIGQAGVQIGNACWELYCSTYRECISVHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGAGDDSFNTFFSETGADQSCPLSPHPLSTGNLRSCYLSRESLSKLCFVVLSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMACCMLYSV
cccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEcccEEHEEEHHccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccHHHcccccccccccccccccccccccccccccccccHHHHHHHHccccccEEccccccccHHHccccccc
ccccHHcccccccccccccccccccccccEEcccccccccccccEEEEEEEcccccHcccHHHHHHHHHcccccccccccccccccccccccEEEccccccccccccccccccccccEcccccccccccccHHHHHHccccccccccccccccEEcHHHHHHHHccHHHHHHHHccHHcccEccccccccEEEEEEEEEc
mkkkeldsipvdmnherecISVHIGQAGVQIGNACWELYCSTYRECISVHIGQAGVQIGNACWELYclehgiqpdgqmpsdktigagddsfntffsetgadqscplsphplstgnlrscylsreSLSKLCFVVLStnlvpyprihfplatyapviSAEKAYHEQMTVAEITnacfepanqmvkcdprhgkymaCCMLYSV
mkkkeldsipvdmNHERECISVHIGQAGVQIGNACWELYCSTYRECISVHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGAGDDSFNTFFSETGADQSCPLSPHPLSTGNLRSCYLSRESLSKLCFVVLSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMACCMLYSV
MKKKELDSIPVDMNHERECISVHIGQAGVQIGNACWELYCSTYRECISVHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGAGDDSFNTFFSETGADQSCPLSPHPLSTGNLRSCYLSRESLSKLCFVVLSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMACCMLYSV
***************ERECISVHIGQAGVQIGNACWELYCSTYRECISVHIGQAGVQIGNACWELYCLEHGI*****************************************GNLRSCYLSRESLSKLCFVVLSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMACCMLY**
******D***VDMNHER********************LYCSTYRECISVHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGAGDDSFNTFFSETGADQSCPLSPHPLSTGNLRSCYLSRESLSKLCFVVLSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMACCMLYSV
********IPVDMNHERECISVHIGQAGVQIGNACWELYCSTYRECISVHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGAGDDSFNTFFSETGADQSCPLSPHPLSTGNLRSCYLSRESLSKLCFVVLSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMACCMLYSV
******DSIPVDMNHERECISVHIGQAGVQIGNACWELYCSTYRECISVHIGQAGVQIGNACWELYCLEHGIQPDGQMPS******GDDSFNTFFSETGADQSCPLSPHPLSTGNLRSCYLSRESLSKLCFVVLSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMACCMLYSV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKELDSIPVDMNHERECISVHIGQAGVQIGNACWELYCSTYRECISVHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGAGDDSFNTFFSETGADQSCPLSPHPLSTGNLRSCYLSRESLSKLCFVVLSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMACCMLYSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query200 2.2.26 [Sep-21-2011]
Q9BQE3 449 Tubulin alpha-1C chain OS yes N/A 0.325 0.144 0.938 3e-32
P68373 449 Tubulin alpha-1C chain OS yes N/A 0.325 0.144 0.938 3e-32
P68365 449 Tubulin alpha-1C chain OS yes N/A 0.325 0.144 0.938 3e-32
Q6AYZ1 449 Tubulin alpha-1C chain OS no N/A 0.325 0.144 0.938 3e-32
P41383 452 Tubulin alpha-2/alpha-4 c N/A N/A 0.325 0.143 0.938 3e-32
Q32KN8 450 Tubulin alpha-3 chain OS= yes N/A 0.325 0.144 0.938 3e-32
Q68FR8 450 Tubulin alpha-3 chain OS= no N/A 0.325 0.144 0.938 3e-32
P05214 450 Tubulin alpha-3 chain OS= yes N/A 0.325 0.144 0.938 3e-32
Q13748 450 Tubulin alpha-3C/D chain yes N/A 0.325 0.144 0.938 3e-32
Q6PEY2 450 Tubulin alpha-3E chain OS no N/A 0.325 0.144 0.938 4e-32
>sp|Q9BQE3|TBA1C_HUMAN Tubulin alpha-1C chain OS=Homo sapiens GN=TUBA1C PE=1 SV=1 Back     alignment and function desciption
 Score =  138 bits (347), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 61/65 (93%), Positives = 63/65 (96%)

Query: 134 LSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMA 193
             TNLVPYPRIHFPLATYAPVISAEKAYHEQ+TVAEITNACFEPANQMVKCDPRHGKYMA
Sbjct: 255 FQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMA 314

Query: 194 CCMLY 198
           CC+LY
Sbjct: 315 CCLLY 319
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Homo sapiens (taxid: 9606)
>sp|P68373|TBA1C_MOUSE Tubulin alpha-1C chain OS=Mus musculus GN=Tuba1c PE=1 SV=1 Back     alignment and function description
>sp|P68365|TBA1C_CRIGR Tubulin alpha-1C chain OS=Cricetulus griseus GN=TUBA1C PE=2 SV=1 Back     alignment and function description
>sp|Q6AYZ1|TBA1C_RAT Tubulin alpha-1C chain OS=Rattus norvegicus GN=Tuba1c PE=1 SV=1 Back     alignment and function description
>sp|P41383|TBA2_PATVU Tubulin alpha-2/alpha-4 chain OS=Patella vulgata GN=TUB2 PE=2 SV=1 Back     alignment and function description
>sp|Q32KN8|TBA3_BOVIN Tubulin alpha-3 chain OS=Bos taurus GN=TUBA3 PE=2 SV=1 Back     alignment and function description
>sp|Q68FR8|TBA3_RAT Tubulin alpha-3 chain OS=Rattus norvegicus GN=Tuba3a PE=2 SV=1 Back     alignment and function description
>sp|P05214|TBA3_MOUSE Tubulin alpha-3 chain OS=Mus musculus GN=Tuba3a PE=1 SV=1 Back     alignment and function description
>sp|Q13748|TBA3C_HUMAN Tubulin alpha-3C/D chain OS=Homo sapiens GN=TUBA3C PE=1 SV=3 Back     alignment and function description
>sp|Q6PEY2|TBA3E_HUMAN Tubulin alpha-3E chain OS=Homo sapiens GN=TUBA3E PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
18204869 335 TUBA1B protein [Homo sapiens] 0.775 0.462 0.608 3e-61
444724116 370 Tubulin alpha-1 chain [Tupaia chinensis] 0.775 0.418 0.562 1e-57
341890407 326 CBN-MEC-12 protein [Caenorhabditis brenn 0.69 0.423 0.683 3e-57
390476417 335 PREDICTED: tubulin alpha-1C chain-like i 0.765 0.456 0.585 3e-57
21619816 325 TUBA1C protein [Homo sapiens] 0.775 0.476 0.611 1e-56
413933198 321 alpha tubulin4 [Zea mays] 0.775 0.482 0.579 5e-55
341877435268 hypothetical protein CAEBREN_28053 [Caen 0.695 0.518 0.651 6e-53
449677139275 PREDICTED: tubulin alpha-1C chain [Hydra 0.71 0.516 0.677 2e-51
157422920220 Unknown (protein for MGC:173992) [Danio 0.695 0.631 0.624 9e-51
414887266 320 TPA: alpha tubulin6 [Zea mays] 0.775 0.484 0.537 1e-50
>gi|18204869|gb|AAH21564.1| TUBA1B protein [Homo sapiens] Back     alignment and taxonomy information
 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 123/202 (60%), Positives = 137/202 (67%), Gaps = 47/202 (23%)

Query: 44  RECISVHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGAGDDSFNTFFSETGADQS 103
           RECIS+H+GQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIG GDDSFNTFFSETGA + 
Sbjct: 2   RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH 61

Query: 104 CP------LSP---HPLSTGNLRSCYLSRE------------------SLSKLCFVVLS- 135
            P      L P     + TG  R  +   +                  +L++L   ++S 
Sbjct: 62  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTNLNRLISQIVSS 121

Query: 136 -------------------TNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFE 176
                              TNLVPYPRIHFPLATYAPVISAEKAYHEQ++VAEITNACFE
Sbjct: 122 ITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFE 181

Query: 177 PANQMVKCDPRHGKYMACCMLY 198
           PANQMVKCDPRHGKYMACC+LY
Sbjct: 182 PANQMVKCDPRHGKYMACCLLY 203

Source: Homo sapiens

Species: Homo sapiens

Genus: Homo

Family: Hominidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|444724116|gb|ELW64735.1| Tubulin alpha-1 chain [Tupaia chinensis] Back     alignment and taxonomy information
>gi|341890407|gb|EGT46342.1| CBN-MEC-12 protein [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|390476417|ref|XP_003735121.1| PREDICTED: tubulin alpha-1C chain-like isoform 2 [Callithrix jacchus] Back     alignment and taxonomy information
>gi|21619816|gb|AAH33064.1| TUBA1C protein [Homo sapiens] Back     alignment and taxonomy information
>gi|413933198|gb|AFW67749.1| alpha tubulin4 [Zea mays] Back     alignment and taxonomy information
>gi|341877435|gb|EGT33370.1| hypothetical protein CAEBREN_28053 [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|449677139|ref|XP_004208788.1| PREDICTED: tubulin alpha-1C chain [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|157422920|gb|AAI53472.1| Unknown (protein for MGC:173992) [Danio rerio] Back     alignment and taxonomy information
>gi|414887266|tpg|DAA63280.1| TPA: alpha tubulin6 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
ZFIN|ZDB-GENE-040801-77 577 tuba8l3 "tubulin, alpha 8 like 0.315 0.109 0.920 7e-72
UNIPROTKB|F5H5D3 519 TUBA1C "Tubulin alpha-1C chain 0.315 0.121 0.968 3.9e-63
UNIPROTKB|E2RNQ2 511 TUBA1C "Uncharacterized protei 0.315 0.123 0.968 4.5e-63
UNIPROTKB|Q9BQE3 449 TUBA1C "Tubulin alpha-1C chain 0.315 0.140 0.968 1.1e-62
UNIPROTKB|F1SHC1 449 TUBA1C "Uncharacterized protei 0.315 0.140 0.968 1.1e-62
MGI|MGI:1095409 449 Tuba1c "tubulin, alpha 1C" [Mu 0.315 0.140 0.968 1.1e-62
RGD|1307226 449 Tuba1c "tubulin, alpha 1C" [Ra 0.315 0.140 0.968 1.1e-62
UNIPROTKB|F1PE21 450 TUBA3C "Uncharacterized protei 0.315 0.14 0.968 1.1e-62
UNIPROTKB|F2Z4K0 450 TUBA3E "Uncharacterized protei 0.315 0.14 0.968 1.4e-62
UNIPROTKB|F6RP72 449 F6RP72 "Uncharacterized protei 0.315 0.140 0.968 1.4e-62
ZFIN|ZDB-GENE-040801-77 tuba8l3 "tubulin, alpha 8 like 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 334 (122.6 bits), Expect = 7.0e-72, Sum P(3) = 7.0e-72
 Identities = 58/63 (92%), Positives = 63/63 (100%)

Query:   136 TNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMACC 195
             TNLVPYPRIHFPLATYAPVISAEKAYHEQ++VA+ITNACFEP+NQMVKCDPRHGKYMACC
Sbjct:   384 TNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACC 443

Query:   196 MLY 198
             +LY
Sbjct:   444 LLY 446
GO:0043234 "protein complex" evidence=IEA
GO:0051258 "protein polymerization" evidence=IEA
GO:0005200 "structural constituent of cytoskeleton" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005874 "microtubule" evidence=IEA
GO:0006184 "GTP catabolic process" evidence=IEA
GO:0007017 "microtubule-based process" evidence=IEA
GO:0003924 "GTPase activity" evidence=IEA
GO:0021782 "glial cell development" evidence=IMP
GO:0042552 "myelination" evidence=IMP
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005856 "cytoskeleton" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
UNIPROTKB|F5H5D3 TUBA1C "Tubulin alpha-1C chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNQ2 TUBA1C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BQE3 TUBA1C "Tubulin alpha-1C chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SHC1 TUBA1C "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1095409 Tuba1c "tubulin, alpha 1C" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307226 Tuba1c "tubulin, alpha 1C" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PE21 TUBA3C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4K0 TUBA3E "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6RP72 F6RP72 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
cd02186 434 cd02186, alpha_tubulin, The tubulin superfamily in 2e-43
PTZ00335 448 PTZ00335, PTZ00335, tubulin alpha chain; Provision 2e-40
PLN00221 450 PLN00221, PLN00221, tubulin alpha chain; Provision 3e-39
PLN00221 450 PLN00221, PLN00221, tubulin alpha chain; Provision 7e-38
PTZ00335 448 PTZ00335, PTZ00335, tubulin alpha chain; Provision 3e-35
cd02186 434 cd02186, alpha_tubulin, The tubulin superfamily in 4e-34
COG5023 443 COG5023, COG5023, Tubulin [Cytoskeleton] 9e-30
pfam03953126 pfam03953, Tubulin_C, Tubulin C-terminal domain 3e-29
COG5023 443 COG5023, COG5023, Tubulin [Cytoskeleton] 2e-21
cd00286328 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includ 5e-21
cd06059 382 cd06059, Tubulin, The tubulin superfamily includes 9e-18
cd02187 425 cd02187, beta_tubulin, The tubulin superfamily inc 2e-16
PTZ00010 445 PTZ00010, PTZ00010, tubulin beta chain; Provisiona 9e-15
PLN00220 447 PLN00220, PLN00220, tubulin beta chain; Provisiona 2e-14
PTZ00387 465 PTZ00387, PTZ00387, epsilon tubulin; Provisional 1e-13
pfam00091210 pfam00091, Tubulin, Tubulin/FtsZ family, GTPase do 7e-13
cd02190 379 cd02190, epsilon_tubulin, The tubulin superfamily 1e-11
smart00865120 smart00865, Tubulin_C, Tubulin/FtsZ family, C-term 3e-10
cd02188 431 cd02188, gamma_tubulin, Gamma-tubulin is a ubiquit 2e-09
PLN00222 454 PLN00222, PLN00222, tubulin gamma chain; Provision 2e-09
cd02187 425 cd02187, beta_tubulin, The tubulin superfamily inc 4e-09
PTZ00010 445 PTZ00010, PTZ00010, tubulin beta chain; Provisiona 6e-07
cd06059 382 cd06059, Tubulin, The tubulin superfamily includes 2e-05
cd06059 382 cd06059, Tubulin, The tubulin superfamily includes 2e-05
PLN00220 447 PLN00220, PLN00220, tubulin beta chain; Provisiona 3e-05
PTZ00387 465 PTZ00387, PTZ00387, epsilon tubulin; Provisional 1e-04
cd02188 431 cd02188, gamma_tubulin, Gamma-tubulin is a ubiquit 2e-04
cd00286 328 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includ 6e-04
cd00286 328 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includ 0.001
>gnl|CDD|100015 cd02186, alpha_tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information 
 Score =  149 bits (379), Expect = 2e-43
 Identities = 57/65 (87%), Positives = 62/65 (95%)

Query: 134 LSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMA 193
             TNLVPYPRIHFPL +YAP+ISAEKAYHEQ++VAEITNACFEPANQMVKCDPRHGKYMA
Sbjct: 254 FQTNLVPYPRIHFPLVSYAPIISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMA 313

Query: 194 CCMLY 198
           CC+LY
Sbjct: 314 CCLLY 318

The alpha- and beta-tubulins are the major components of microtubules, while gamma-tubulin plays a major role in the nucleation of microtubule assembly. The delta- and epsilon-tubulins are widespread but unlike the alpha, beta, and gamma-tubulins they are not ubiquitous among eukaryotes. The alpha/beta-tubulin heterodimer is the structural subunit of microtubules. The alpha- and beta-tubulins share 40% amino-acid sequence identity, exist in several isotype forms, and undergo a variety of posttranslational modifications. The structures of alpha- and beta-tubulin are basically identical: each monomer is formed by a core of two beta-sheets surrounded by alpha-helices. The monomer structure is very compact, but can be divided into three regions based on function: the amino-terminal nucleotide-binding region, an intermediate taxol-binding region and the carboxy-terminal region which probably constitutes the binding surface for motor proteins. Length = 434
>gnl|CDD|185562 PTZ00335, PTZ00335, tubulin alpha chain; Provisional Back     alignment and domain information
>gnl|CDD|177802 PLN00221, PLN00221, tubulin alpha chain; Provisional Back     alignment and domain information
>gnl|CDD|177802 PLN00221, PLN00221, tubulin alpha chain; Provisional Back     alignment and domain information
>gnl|CDD|185562 PTZ00335, PTZ00335, tubulin alpha chain; Provisional Back     alignment and domain information
>gnl|CDD|100015 cd02186, alpha_tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>gnl|CDD|227356 COG5023, COG5023, Tubulin [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|217812 pfam03953, Tubulin_C, Tubulin C-terminal domain Back     alignment and domain information
>gnl|CDD|227356 COG5023, COG5023, Tubulin [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|100014 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation Back     alignment and domain information
>gnl|CDD|100023 cd06059, Tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>gnl|CDD|100016 cd02187, beta_tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>gnl|CDD|240228 PTZ00010, PTZ00010, tubulin beta chain; Provisional Back     alignment and domain information
>gnl|CDD|215107 PLN00220, PLN00220, tubulin beta chain; Provisional Back     alignment and domain information
>gnl|CDD|240395 PTZ00387, PTZ00387, epsilon tubulin; Provisional Back     alignment and domain information
>gnl|CDD|215710 pfam00091, Tubulin, Tubulin/FtsZ family, GTPase domain Back     alignment and domain information
>gnl|CDD|100019 cd02190, epsilon_tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>gnl|CDD|214868 smart00865, Tubulin_C, Tubulin/FtsZ family, C-terminal domain Back     alignment and domain information
>gnl|CDD|100017 cd02188, gamma_tubulin, Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily Back     alignment and domain information
>gnl|CDD|215108 PLN00222, PLN00222, tubulin gamma chain; Provisional Back     alignment and domain information
>gnl|CDD|100016 cd02187, beta_tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>gnl|CDD|240228 PTZ00010, PTZ00010, tubulin beta chain; Provisional Back     alignment and domain information
>gnl|CDD|100023 cd06059, Tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>gnl|CDD|100023 cd06059, Tubulin, The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>gnl|CDD|215107 PLN00220, PLN00220, tubulin beta chain; Provisional Back     alignment and domain information
>gnl|CDD|240395 PTZ00387, PTZ00387, epsilon tubulin; Provisional Back     alignment and domain information
>gnl|CDD|100017 cd02188, gamma_tubulin, Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily Back     alignment and domain information
>gnl|CDD|100014 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation Back     alignment and domain information
>gnl|CDD|100014 cd00286, Tubulin_FtsZ, Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 200
COG5023 443 Tubulin [Cytoskeleton] 100.0
PLN00221 450 tubulin alpha chain; Provisional 100.0
PTZ00335 448 tubulin alpha chain; Provisional 100.0
cd02188 431 gamma_tubulin Gamma-tubulin is a ubiquitous phylog 100.0
PLN00222 454 tubulin gamma chain; Provisional 100.0
PTZ00010 445 tubulin beta chain; Provisional 100.0
cd02186 434 alpha_tubulin The tubulin superfamily includes fiv 100.0
PLN00220 447 tubulin beta chain; Provisional 100.0
PTZ00387 465 epsilon tubulin; Provisional 100.0
cd02187 425 beta_tubulin The tubulin superfamily includes five 100.0
KOG1376|consensus407 100.0
KOG1374|consensus 448 100.0
cd02189 446 delta_tubulin The tubulin superfamily includes fiv 100.0
cd02190 379 epsilon_tubulin The tubulin superfamily includes f 99.98
cd06059 382 Tubulin The tubulin superfamily includes five dist 99.94
cd00286328 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin 99.85
PF00091216 Tubulin: Tubulin/FtsZ family, GTPase domain; Inter 99.69
KOG1375|consensus 369 99.65
PF03953126 Tubulin_C: Tubulin C-terminal domain; InterPro: IP 99.64
COG5023 443 Tubulin [Cytoskeleton] 99.07
KOG1374|consensus 448 98.65
PLN00222 454 tubulin gamma chain; Provisional 98.65
PLN00221 450 tubulin alpha chain; Provisional 98.64
PTZ00387 465 epsilon tubulin; Provisional 98.6
PTZ00335 448 tubulin alpha chain; Provisional 98.56
PLN00220 447 tubulin beta chain; Provisional 98.44
cd02188 431 gamma_tubulin Gamma-tubulin is a ubiquitous phylog 98.43
PTZ00010 445 tubulin beta chain; Provisional 98.34
cd02186 434 alpha_tubulin The tubulin superfamily includes fiv 98.33
KOG1376|consensus 407 98.25
cd02190 379 epsilon_tubulin The tubulin superfamily includes f 98.23
cd02187 425 beta_tubulin The tubulin superfamily includes five 98.14
cd02189 446 delta_tubulin The tubulin superfamily includes fiv 98.11
PF00091216 Tubulin: Tubulin/FtsZ family, GTPase domain; Inter 97.9
smart00865120 Tubulin_C Tubulin/FtsZ family, C-terminal domain. 97.3
cd06059 382 Tubulin The tubulin superfamily includes five dist 97.26
cd00286 328 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin 96.65
cd06060 493 misato Human Misato shows similarity with Tubulin/ 96.22
PF10644115 Misat_Tub_SegII: Misato Segment II tubulin-like do 94.51
PF10644115 Misat_Tub_SegII: Misato Segment II tubulin-like do 94.04
cd06060 493 misato Human Misato shows similarity with Tubulin/ 90.92
KOG2530|consensus 483 90.26
KOG2530|consensus 483 86.29
smart00864192 Tubulin Tubulin/FtsZ family, GTPase domain. This d 80.97
>COG5023 Tubulin [Cytoskeleton] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-55  Score=384.69  Aligned_cols=156  Identities=45%  Similarity=0.824  Sum_probs=150.4

Q ss_pred             ccceeEEeecCccccchHHHHHHHHhhcCCCCCCCCCCCCCCCCCCCcccccccccCCCCCC------CCCCCCC---cc
Q psy8705          43 YRECISVHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGAGDDSFNTFFSETGADQSC------PLSPHPL---ST  113 (200)
Q Consensus        43 m~EiI~iqvGQcGnQIG~~fWe~l~~Eh~i~~~g~~~~~~~~~~~~~~~~~fF~e~~~~~~v------DlEp~vI---~~  113 (200)
                      |||||+||+||||||||++||++||+||||++||.+.+..+  .+++++++||+|++.+|||      ||||+||   ++
T Consensus         1 mREIItlq~GQcGnQiG~~fWe~~c~EHGI~~~G~~~~~~~--~~~er~~vfF~e~~~~k~vPRaI~vDLEP~vid~v~~   78 (443)
T COG5023           1 MREIITLQVGQCGNQIGNAFWETLCLEHGIGPDGTLLDSSD--EGDERFDVFFYEASDGKFVPRAILVDLEPGVIDQVRN   78 (443)
T ss_pred             CceeEEEecccchhHHHHHHHHHHHHhhCcCCCCCCCCCcc--cccccccceeeecCCCccccceEEEecCcchHhhhcc
Confidence            89999999999999999999999999999999999877655  3568999999999999999      9999999   89


Q ss_pred             CCCccccccccc----ccccCcc---------------------------------------------------------
Q psy8705         114 GNLRSCYLSRES----LSKLCFV---------------------------------------------------------  132 (200)
Q Consensus       114 g~~~~lf~p~n~----~gagNNw---------------------------------------------------------  132 (200)
                      |+|++||+|+|+    +||||||                                                         
T Consensus        79 g~y~~lf~Pen~i~gkegAgNnwA~GhYtvG~e~~ddvmd~IrreAd~cD~LqGF~l~HS~gGGTGSG~GslLLerl~~e  158 (443)
T COG5023          79 GPYGSLFHPENIIFGKEGAGNNWARGHYTVGKEIIDDVMDMIRREADGCDGLQGFLLLHSLGGGTGSGLGSLLLERLREE  158 (443)
T ss_pred             CccccccChhheeeccccccccccccccchhHHHHHHHHHHHHHHhhcCccccceeeeeeccCcCcccHHHHHHHHHHHh
Confidence            999999999999    8999999                                                         


Q ss_pred             --------------------------------------------------------------------------------
Q psy8705         133 --------------------------------------------------------------------------------  132 (200)
Q Consensus       133 --------------------------------------------------------------------------------  132 (200)
                                                                                                      
T Consensus       159 ypkK~~~tfSV~P~p~~Sd~VVePYNsvLt~h~l~ensD~tf~~DNeal~di~~~~L~i~~P~y~~lN~LIs~VmSsvTt  238 (443)
T COG5023         159 YPKKIKLTFSVFPAPKVSDVVVEPYNSVLTLHRLLENSDCTFVVDNEALYDICRRNLRIQNPSYDDLNQLISTVMSSVTT  238 (443)
T ss_pred             cchhheeEEEeccCCccCcceecccHHHHHHHHHHhcCCceEEechHHHHHHHHHhcCCCCCChHHHHHHHHHHHHhhhh
Confidence                                                                                            


Q ss_pred             -------------eeeccccCCCcccccccccccccchhhhhhccccHHhHHHHhcCCCCceeecCCCCCceeeeeeccc
Q psy8705         133 -------------VLSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMACCMLYS  199 (200)
Q Consensus       133 -------------kl~tNLVPfPrLhFl~~S~aPl~~~~~~~~~~~tv~dl~~~lf~~~n~m~~~~p~~gkyla~~~l~R  199 (200)
                                   +|++||||||||||+++||+|+++.....+++.|+.|++++||+|+|+|++|||+.|+||++|++||
T Consensus       239 slRfpG~ln~dl~~~~~nLVP~PrlHF~l~sytP~~s~~~~~~~~~sv~evt~~~f~p~N~mv~~dpr~g~y~~~~~l~r  318 (443)
T COG5023         239 SLRFPGYLNVDLRSIQTNLVPYPRLHFPLVSYTPFTSDGSAAHEKNSVSEVTNQLFDPKNQMVSCDPRKGRYMAVCLLFR  318 (443)
T ss_pred             eeecCccccchHHHHHhcCCCCCcccccccccCcccchhhHHHhcccHHHHHHHHhCcccceeeecCCCCeeeehhHHHh
Confidence                         9999999999999999999999999889999999999999999999999999999999999999999


Q ss_pred             C
Q psy8705         200 V  200 (200)
Q Consensus       200 g  200 (200)
                      |
T Consensus       319 G  319 (443)
T COG5023         319 G  319 (443)
T ss_pred             c
Confidence            8

>PLN00221 tubulin alpha chain; Provisional Back     alignment and domain information
>PTZ00335 tubulin alpha chain; Provisional Back     alignment and domain information
>cd02188 gamma_tubulin Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily Back     alignment and domain information
>PLN00222 tubulin gamma chain; Provisional Back     alignment and domain information
>PTZ00010 tubulin beta chain; Provisional Back     alignment and domain information
>cd02186 alpha_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>PLN00220 tubulin beta chain; Provisional Back     alignment and domain information
>PTZ00387 epsilon tubulin; Provisional Back     alignment and domain information
>cd02187 beta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>KOG1376|consensus Back     alignment and domain information
>KOG1374|consensus Back     alignment and domain information
>cd02189 delta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>cd02190 epsilon_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>cd06059 Tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>cd00286 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation Back     alignment and domain information
>PF00091 Tubulin: Tubulin/FtsZ family, GTPase domain; InterPro: IPR003008 This domain is found in all tubulin chains, as well as the bacterial FtsZ family of proteins Back     alignment and domain information
>KOG1375|consensus Back     alignment and domain information
>PF03953 Tubulin_C: Tubulin C-terminal domain; InterPro: IPR018316 This domain is found in the tubulin alpha, beta and gamma chains, as well as the bacterial FtsZ family of proteins Back     alignment and domain information
>COG5023 Tubulin [Cytoskeleton] Back     alignment and domain information
>KOG1374|consensus Back     alignment and domain information
>PLN00222 tubulin gamma chain; Provisional Back     alignment and domain information
>PLN00221 tubulin alpha chain; Provisional Back     alignment and domain information
>PTZ00387 epsilon tubulin; Provisional Back     alignment and domain information
>PTZ00335 tubulin alpha chain; Provisional Back     alignment and domain information
>PLN00220 tubulin beta chain; Provisional Back     alignment and domain information
>cd02188 gamma_tubulin Gamma-tubulin is a ubiquitous phylogenetically conserved member of tubulin superfamily Back     alignment and domain information
>PTZ00010 tubulin beta chain; Provisional Back     alignment and domain information
>cd02186 alpha_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>KOG1376|consensus Back     alignment and domain information
>cd02190 epsilon_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>cd02187 beta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>cd02189 delta_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>PF00091 Tubulin: Tubulin/FtsZ family, GTPase domain; InterPro: IPR003008 This domain is found in all tubulin chains, as well as the bacterial FtsZ family of proteins Back     alignment and domain information
>smart00865 Tubulin_C Tubulin/FtsZ family, C-terminal domain Back     alignment and domain information
>cd06059 Tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>cd00286 Tubulin_FtsZ Tubulin/FtsZ: Family includes tubulin alpha-, beta-, gamma-, delta-, and epsilon-tubulins as well as FtsZ, all of which are involved in polymer formation Back     alignment and domain information
>cd06060 misato Human Misato shows similarity with Tubulin/FtsZ family of GTPases and is localized to the the outer membrane of mitochondria Back     alignment and domain information
>PF10644 Misat_Tub_SegII: Misato Segment II tubulin-like domain; InterPro: IPR019605 The misato protein contains three distinct, conserved domains, segments I, II and III and is involved in the regulation of mitochondrial distribution and morphology [] Back     alignment and domain information
>PF10644 Misat_Tub_SegII: Misato Segment II tubulin-like domain; InterPro: IPR019605 The misato protein contains three distinct, conserved domains, segments I, II and III and is involved in the regulation of mitochondrial distribution and morphology [] Back     alignment and domain information
>cd06060 misato Human Misato shows similarity with Tubulin/FtsZ family of GTPases and is localized to the the outer membrane of mitochondria Back     alignment and domain information
>KOG2530|consensus Back     alignment and domain information
>KOG2530|consensus Back     alignment and domain information
>smart00864 Tubulin Tubulin/FtsZ family, GTPase domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
1z2b_A 448 Tubulin-Colchicine-Vinblastine: Stathmin-Like Domai 6e-33
3du7_A 449 Tubulin-Colchicine-Phomopsin A: Stathmin-Like Domai 6e-33
3ryc_A 451 Tubulin: Rb3 Stathmin-Like Domain Complex Length = 6e-33
3hkb_A 451 Tubulin: Rb3 Stathmin-Like Domain Complex Length = 6e-33
4i4t_A 450 Crystal Structure Of Tubulin-rb3-ttl-zampanolide Co 6e-33
4drx_A 437 Gtp-Tubulin In Complex With A Darpin Length = 437 7e-33
1sa0_A 451 Tubulin-Colchicine: Stathmin-Like Domain Complex Le 7e-33
1ffx_A 451 Tubulin:stathmin-Like Domain Complex Length = 451 3e-32
2xrp_B 452 Human Doublecortin N-Dc Repeat (1mjd) And Mammalian 6e-32
1jff_A 451 Refined Structure Of Alpha-Beta Tubulin From Zinc-I 6e-32
1tub_A 440 Tubulin Alpha-Beta Dimer, Electron Diffraction Leng 6e-32
4ffb_A 447 A Tog:alphaBETA-Tubulin Complex Structure Reveals C 5e-26
3ryc_B 445 Tubulin: Rb3 Stathmin-Like Domain Complex Length = 5e-12
4f61_B 445 Tubulin:stathmin-Like Domain Complex Length = 445 5e-12
4drx_B 431 Gtp-Tubulin In Complex With A Darpin Length = 431 5e-12
4i4t_B 445 Crystal Structure Of Tubulin-rb3-ttl-zampanolide Co 6e-12
3du7_B 445 Tubulin-Colchicine-Phomopsin A: Stathmin-Like Domai 7e-12
1z2b_B 445 Tubulin-Colchicine-Vinblastine: Stathmin-Like Domai 7e-12
1tub_B 427 Tubulin Alpha-Beta Dimer, Electron Diffraction Leng 7e-12
1ffx_B 445 Tubulin:stathmin-Like Domain Complex Length = 445 7e-12
2xrp_A 445 Human Doublecortin N-Dc Repeat (1mjd) And Mammalian 7e-12
4ffb_B 463 A Tog:alphaBETA-Tubulin Complex Structure Reveals C 1e-10
2bto_A 473 Structure Of Btuba From Prosthecobacter Dejongeii L 1e-07
1z5v_A 474 Crystal Structure Of Human Gamma-Tubulin Bound To G 1e-04
3cb2_A 475 Crystal Structure Of Human Gamma-Tubulin Bound To G 1e-04
2btq_B 426 Structure Of Btubab Heterodimer From Prosthecobacte 2e-04
2btq_B 426 Structure Of Btubab Heterodimer From Prosthecobacte 8e-04
>pdb|1Z2B|A Chain A, Tubulin-Colchicine-Vinblastine: Stathmin-Like Domain Complex Length = 448 Back     alignment and structure 
Iteration: 1

 Score =  136 bits (343), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 63/65 (96%)
Query: 134 LSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMA 193
             TNLVPYPRIHFPLATYAPVISAEKAYHEQ++VAEITNACFEPANQMVKCDPRHGKYMA
Sbjct: 255 FQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMA 314
Query: 194 CCMLY 198
           CC+LY
Sbjct: 315 CCLLY 319
>pdb|3DU7|A Chain A, Tubulin-Colchicine-Phomopsin A: Stathmin-Like Domain Complex Length = 449 Back     alignment and structure
>pdb|3RYC|A Chain A, Tubulin: Rb3 Stathmin-Like Domain Complex Length = 451 Back     alignment and structure
>pdb|3HKB|A Chain A, Tubulin: Rb3 Stathmin-Like Domain Complex Length = 451 Back     alignment and structure
>pdb|4I4T|A Chain A, Crystal Structure Of Tubulin-rb3-ttl-zampanolide Complex Length = 450 Back     alignment and structure
>pdb|4DRX|A Chain A, Gtp-Tubulin In Complex With A Darpin Length = 437 Back     alignment and structure
>pdb|1SA0|A Chain A, Tubulin-Colchicine: Stathmin-Like Domain Complex Length = 451 Back     alignment and structure
>pdb|1FFX|A Chain A, Tubulin:stathmin-Like Domain Complex Length = 451 Back     alignment and structure
>pdb|2XRP|B Chain B, Human Doublecortin N-Dc Repeat (1mjd) And Mammalian Tubulin (1jff And 3hke) Docked Into The 8-Angstrom Cryo-Em Map Of Doublecortin-Stabilised Microtubules Length = 452 Back     alignment and structure
>pdb|1JFF|A Chain A, Refined Structure Of Alpha-Beta Tubulin From Zinc-Induced Sheets Stabilized With Taxol Length = 451 Back     alignment and structure
>pdb|1TUB|A Chain A, Tubulin Alpha-Beta Dimer, Electron Diffraction Length = 440 Back     alignment and structure
>pdb|4FFB|A Chain A, A Tog:alphaBETA-Tubulin Complex Structure Reveals Conformation-Based Mechanisms For A Microtubule Polymerase Length = 447 Back     alignment and structure
>pdb|3RYC|B Chain B, Tubulin: Rb3 Stathmin-Like Domain Complex Length = 445 Back     alignment and structure
>pdb|4F61|B Chain B, Tubulin:stathmin-Like Domain Complex Length = 445 Back     alignment and structure
>pdb|4DRX|B Chain B, Gtp-Tubulin In Complex With A Darpin Length = 431 Back     alignment and structure
>pdb|4I4T|B Chain B, Crystal Structure Of Tubulin-rb3-ttl-zampanolide Complex Length = 445 Back     alignment and structure
>pdb|3DU7|B Chain B, Tubulin-Colchicine-Phomopsin A: Stathmin-Like Domain Complex Length = 445 Back     alignment and structure
>pdb|1Z2B|B Chain B, Tubulin-Colchicine-Vinblastine: Stathmin-Like Domain Complex Length = 445 Back     alignment and structure
>pdb|1TUB|B Chain B, Tubulin Alpha-Beta Dimer, Electron Diffraction Length = 427 Back     alignment and structure
>pdb|1FFX|B Chain B, Tubulin:stathmin-Like Domain Complex Length = 445 Back     alignment and structure
>pdb|2XRP|A Chain A, Human Doublecortin N-Dc Repeat (1mjd) And Mammalian Tubulin (1jff And 3hke) Docked Into The 8-Angstrom Cryo-Em Map Of Doublecortin-Stabilised Microtubules Length = 445 Back     alignment and structure
>pdb|4FFB|B Chain B, A Tog:alphaBETA-Tubulin Complex Structure Reveals Conformation-Based Mechanisms For A Microtubule Polymerase Length = 463 Back     alignment and structure
>pdb|2BTO|A Chain A, Structure Of Btuba From Prosthecobacter Dejongeii Length = 473 Back     alignment and structure
>pdb|1Z5V|A Chain A, Crystal Structure Of Human Gamma-Tubulin Bound To Gtpgammas Length = 474 Back     alignment and structure
>pdb|3CB2|A Chain A, Crystal Structure Of Human Gamma-Tubulin Bound To Gdp Length = 475 Back     alignment and structure
>pdb|2BTQ|B Chain B, Structure Of Btubab Heterodimer From Prosthecobacter Dejongeii Length = 426 Back     alignment and structure
>pdb|2BTQ|B Chain B, Structure Of Btubab Heterodimer From Prosthecobacter Dejongeii Length = 426 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
2btq_B 426 Tubulin btubb; structural protein, cytoskeletal pr 8e-38
2btq_B 426 Tubulin btubb; structural protein, cytoskeletal pr 2e-24
2bto_A 473 Tubulin btuba; bacterial tubulin, polymerization, 2e-37
2bto_A 473 Tubulin btuba; bacterial tubulin, polymerization, 2e-26
3ryc_A 451 Tubulin alpha chain; alpha-tubulin, beta-tubulin, 4e-37
3ryc_A 451 Tubulin alpha chain; alpha-tubulin, beta-tubulin, 1e-28
3ryc_B 445 Tubulin beta chain; alpha-tubulin, beta-tubulin, G 3e-36
3ryc_B 445 Tubulin beta chain; alpha-tubulin, beta-tubulin, G 4e-27
3cb2_A 475 Gamma-1-tubulin, tubulin gamma-1 chain; lattice, m 1e-31
3cb2_A 475 Gamma-1-tubulin, tubulin gamma-1 chain; lattice, m 1e-27
>2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} Length = 426 Back     alignment and structure
 Score =  134 bits (338), Expect = 8e-38
 Identities = 19/65 (29%), Positives = 30/65 (46%)

Query: 134 LSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMA 193
             TNLVP+P  HF  A++AP+  A +    +    ++    F   N     D + G Y+A
Sbjct: 253 FVTNLVPFPGNHFLTASFAPMRGAGQEGQVRTNFPDLARETFAQDNFTAAIDWQQGVYLA 312

Query: 194 CCMLY 198
              L+
Sbjct: 313 ASALF 317
>2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} Length = 426 Back     alignment and structure
>2bto_A Tubulin btuba; bacterial tubulin, polymerization, cytoskeleton, protein COM cytoskeletal protein; HET: GTP; 2.5A {Prosthecobacter dejongeii} SCOP: c.32.1.1 d.79.2.1 PDB: 2btq_A* Length = 473 Back     alignment and structure
>2bto_A Tubulin btuba; bacterial tubulin, polymerization, cytoskeleton, protein COM cytoskeletal protein; HET: GTP; 2.5A {Prosthecobacter dejongeii} SCOP: c.32.1.1 d.79.2.1 PDB: 2btq_A* Length = 473 Back     alignment and structure
>3ryc_A Tubulin alpha chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_A* 3ryh_A* 3ryi_A* 3hke_A* 3hkc_A* 3hkd_A* 3hkb_A* 3n2g_A* 3n2k_A* 1sa0_A* 1sa1_A* 3edl_F* 1ffx_A* 1ia0_A* 2hxf_A* 2hxh_A* 2p4n_A* 1jff_A* 2wbe_A* 3dco_A* ... Length = 451 Back     alignment and structure
>3ryc_A Tubulin alpha chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_A* 3ryh_A* 3ryi_A* 3hke_A* 3hkc_A* 3hkd_A* 3hkb_A* 3n2g_A* 3n2k_A* 1sa0_A* 1sa1_A* 3edl_F* 1ffx_A* 1ia0_A* 2hxf_A* 2hxh_A* 2p4n_A* 1jff_A* 2wbe_A* 3dco_A* ... Length = 451 Back     alignment and structure
>3ryc_B Tubulin beta chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_B* 3ryh_B* 3ryi_B* 3hke_B* 3du7_B* 3e22_B* 3hkc_B* 3hkd_B* 3hkb_B* 3n2g_B* 3n2k_B* 1z2b_B* 2xrp_A* 1tvk_B* 1tub_B* 1jff_B* 1ia0_B* 1ffx_B* 1sa0_B* 1sa1_B* ... Length = 445 Back     alignment and structure
>3ryc_B Tubulin beta chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_B* 3ryh_B* 3ryi_B* 3hke_B* 3du7_B* 3e22_B* 3hkc_B* 3hkd_B* 3hkb_B* 3n2g_B* 3n2k_B* 1z2b_B* 2xrp_A* 1tvk_B* 1tub_B* 1jff_B* 1ia0_B* 1ffx_B* 1sa0_B* 1sa1_B* ... Length = 445 Back     alignment and structure
>3cb2_A Gamma-1-tubulin, tubulin gamma-1 chain; lattice, microtubule, nucleation, GTPase, lateral interaction, structural protein, hydrolase; HET: GDP; 2.30A {Homo sapiens} PDB: 1z5v_A* 1z5w_A* Length = 475 Back     alignment and structure
>3cb2_A Gamma-1-tubulin, tubulin gamma-1 chain; lattice, microtubule, nucleation, GTPase, lateral interaction, structural protein, hydrolase; HET: GDP; 2.30A {Homo sapiens} PDB: 1z5v_A* 1z5w_A* Length = 475 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
3ryc_A 451 Tubulin alpha chain; alpha-tubulin, beta-tubulin, 100.0
3ryc_B 445 Tubulin beta chain; alpha-tubulin, beta-tubulin, G 100.0
3cb2_A 475 Gamma-1-tubulin, tubulin gamma-1 chain; lattice, m 100.0
2btq_B 426 Tubulin btubb; structural protein, cytoskeletal pr 100.0
2bto_A 473 Tubulin btuba; bacterial tubulin, polymerization, 100.0
1w5f_A353 Cell division protein FTSZ; complete proteome, GTP 99.08
1ofu_A320 FTSZ, cell division protein FTSZ; bacterial cell d 99.06
2vaw_A 394 FTSZ, cell division protein FTSZ; bacterial cell d 99.01
2vap_A364 FTSZ, cell division protein FTSZ homolog 1; polyme 98.98
1rq2_A 382 Cell division protein FTSZ; cell cycle, tubulin, G 98.89
3ryc_B 445 Tubulin beta chain; alpha-tubulin, beta-tubulin, G 98.81
3ryc_A 451 Tubulin alpha chain; alpha-tubulin, beta-tubulin, 98.81
2vxy_A 382 FTSZ, cell division protein FTSZ; GTP-binding, nuc 98.75
3cb2_A 475 Gamma-1-tubulin, tubulin gamma-1 chain; lattice, m 98.61
2bto_A 473 Tubulin btuba; bacterial tubulin, polymerization, 98.54
2btq_B 426 Tubulin btubb; structural protein, cytoskeletal pr 98.51
2r75_1338 Cell division protein FTSZ; GTPase, tubulin-like, 98.35
1w5f_A 353 Cell division protein FTSZ; complete proteome, GTP 94.56
3m89_A427 FTSZ/tubulin-related protein; partition, TUBZ, GTP 93.65
1ofu_A 320 FTSZ, cell division protein FTSZ; bacterial cell d 84.54
1rq2_A 382 Cell division protein FTSZ; cell cycle, tubulin, G 83.81
2vaw_A 394 FTSZ, cell division protein FTSZ; bacterial cell d 83.11
>3ryc_A Tubulin alpha chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_A* 3ryh_A* 3ryi_A* 3ut5_A* 4eb6_A* 4f61_A* 4f6r_A* 3hke_A* 3hkc_A* 3hkd_A* 3hkb_A* 3n2g_A* 3n2k_A* 1sa0_A* 1sa1_A* 3edl_F* 1ffx_A* 1ia0_A* 2hxf_A* 2hxh_A* ... Back     alignment and structure
Probab=100.00  E-value=2.7e-53  Score=386.46  Aligned_cols=158  Identities=75%  Similarity=1.267  Sum_probs=146.8

Q ss_pred             ccceeEEeecCccccchHHHHHHHHhhcCCCCCCCCCCCCCCCCCCCcccccccccCCCCCC------CCCCCCC---cc
Q psy8705          43 YRECISVHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGAGDDSFNTFFSETGADQSC------PLSPHPL---ST  113 (200)
Q Consensus        43 m~EiI~iqvGQcGnQIG~~fWe~l~~Eh~i~~~g~~~~~~~~~~~~~~~~~fF~e~~~~~~v------DlEp~vI---~~  113 (200)
                      |||||+||+||||||||++|||++|.||||++||++.++++....++++++||+|+++||||      ||||+||   ++
T Consensus         1 mrEii~iqvGQcGnQIG~~~We~~~~EHgi~~~g~~~~~~~~~~~~~~~~~fF~e~~~gk~vPRavlvDlEp~vid~v~~   80 (451)
T 3ryc_A            1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRT   80 (451)
T ss_dssp             CCCEEEEEEHHHHHHHHHHHHHHHHHHHTCCTTSCCCCC-------CGGGGTEEECTTSCEEESEEEEESSSHHHHHHHH
T ss_pred             CceEEEEeccCchhHHHHHHHHHHHhhcCCCCCCCcCCcccccccccchhhhcccCCCCccccceeeecCCcchhheeee
Confidence            89999999999999999999999999999999999887665434578999999999999998      9999999   89


Q ss_pred             CCCccccccccc----ccccCcc---------------------------------------------------------
Q psy8705         114 GNLRSCYLSRES----LSKLCFV---------------------------------------------------------  132 (200)
Q Consensus       114 g~~~~lf~p~n~----~gagNNw---------------------------------------------------------  132 (200)
                      |+++++|+|+|+    +||||||                                                         
T Consensus        81 g~~~~lf~p~~~i~gk~gAgNNwA~G~yt~G~e~~d~v~d~IRk~~E~cD~lqGF~i~hSlgGGTGSG~gs~lle~L~~e  160 (451)
T 3ryc_A           81 GTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVD  160 (451)
T ss_dssp             STTTTTSCGGGEEECSSCCTTCHHHHHHTSHHHHHHHHHHHHHHHHHTCSSCCEEEEEEESSSHHHHHHHHHHHHHHHHH
T ss_pred             cccccccCHHHeeeccccccCCCCeeecccchHhHHHHHHHHHHHHHcCCCccceEEEeccCCCCCccHHHHHHHHHHHh
Confidence            999999999999    8999999                                                         


Q ss_pred             --------------------------------------------------------------------------------
Q psy8705         133 --------------------------------------------------------------------------------  132 (200)
Q Consensus       133 --------------------------------------------------------------------------------  132 (200)
                                                                                                      
T Consensus       161 y~kk~~~~~~v~P~~~~s~~vvepYNa~Lsl~~L~e~sD~~~~idNeaL~~ic~~~l~i~~p~y~~lN~lIa~~~s~iT~  240 (451)
T 3ryc_A          161 YGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA  240 (451)
T ss_dssp             TTTCEEEEEEEECCTTTCCCTTHHHHHHHHHHHHGGGCSEEEEEEHHHHHHHHHHHHCCSSCCHHHHHHHHHHHHHHHHH
T ss_pred             cCcceEEEEEEecCCCcccccceehHHHHHHHHHHhcccceeEeccHHHHHHHHHhccCCCCCchhhHHHHHhccccccc
Confidence                                                                                            


Q ss_pred             -------------eeeccccCCCcccccccccccccchhhhhhccccHHhHHHHhcCCCCceeecCCCCCceeeeeeccc
Q psy8705         133 -------------VLSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMACCMLYS  199 (200)
Q Consensus       133 -------------kl~tNLVPfPrLhFl~~S~aPl~~~~~~~~~~~tv~dl~~~lf~~~n~m~~~~p~~gkyla~~~l~R  199 (200)
                                   +|.+||||||||||++++|||+++..+..++++++.||++++|+++|+|++|||++|||||||++||
T Consensus       241 slRf~G~lN~Dl~~l~tnLVP~PrlHF~~~s~aPl~s~~~~~~~~~sv~elt~~~f~~~n~m~~~dp~~gky~a~~~~~R  320 (451)
T 3ryc_A          241 SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYR  320 (451)
T ss_dssp             HHHTTCSSSCSHHHHHHHHCSSSSCCCCEEEEECCCBSSSCCCCCCCHHHHHHHTTCGGGBSSCCCGGGSCEEEEEEEEE
T ss_pred             ccccCcccccCHHHHhhccCCCCceeeeccccCccccccccccccCCHHHHHHHHhccccceEecCCCCCchheehhhcc
Confidence                         8999999999999999999999998888899999999999999999999999999999999999999


Q ss_pred             C
Q psy8705         200 V  200 (200)
Q Consensus       200 g  200 (200)
                      |
T Consensus       321 G  321 (451)
T 3ryc_A          321 G  321 (451)
T ss_dssp             E
T ss_pred             c
Confidence            8
>3ryc_B Tubulin beta chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_B* 3ryh_B* 3ryi_B* 3ut5_B* 4eb6_B* 4f6r_B* 4f61_B* 3hke_B* 3du7_B* 3e22_B* 3hkc_B* 3hkd_B* 3hkb_B* 3n2g_B* 3n2k_B* 1z2b_B* 2xrp_A* 4aqv_B* 4aqw_B* 4atu_A* ... Back     alignment and structure
>3cb2_A Gamma-1-tubulin, tubulin gamma-1 chain; lattice, microtubule, nucleation, GTPase, lateral interaction, structural protein, hydrolase; HET: GDP; 2.30A {Homo sapiens} PDB: 1z5v_A* 1z5w_A* Back     alignment and structure
>2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} Back     alignment and structure
>2bto_A Tubulin btuba; bacterial tubulin, polymerization, cytoskeleton, protein COM cytoskeletal protein; HET: GTP; 2.5A {Prosthecobacter dejongeii} SCOP: c.32.1.1 d.79.2.1 PDB: 2btq_A* Back     alignment and structure
>1w5f_A Cell division protein FTSZ; complete proteome, GTP-binding, multigene family, septation, tubulin, filament, Z-ring, GTPase, domain swapped; HET: G2P; 2.0A {Thermotoga maritima} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>1ofu_A FTSZ, cell division protein FTSZ; bacterial cell division inhibitor, SULA protein; HET: GDP; 2.1A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>2vaw_A FTSZ, cell division protein FTSZ; bacterial cell division protein, tubulin homolog, nucleotide-binding, GTPase, septation, cytoplasm; HET: GDP; 2.90A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>2vap_A FTSZ, cell division protein FTSZ homolog 1; polymerization, tubulin homolog, GTPase, septation, cell cycle, GTP-binding; HET: GDP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.32.1.1 d.79.2.1 PDB: 1w59_A 1w58_1* 1w5a_A* 1w5b_A* 1fsz_A* 1w5e_A* Back     alignment and structure
>1rq2_A Cell division protein FTSZ; cell cycle, tubulin, GTPase, signaling protein; HET: CIT; 1.86A {Mycobacterium tuberculosis} SCOP: c.32.1.1 d.79.2.1 PDB: 1rlu_A* 1rq7_A* 2q1y_A* 2q1x_A* Back     alignment and structure
>3ryc_B Tubulin beta chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_B* 3ryh_B* 3ryi_B* 3ut5_B* 4eb6_B* 4f6r_B* 4f61_B* 3hke_B* 3du7_B* 3e22_B* 3hkc_B* 3hkd_B* 3hkb_B* 3n2g_B* 3n2k_B* 1z2b_B* 2xrp_A* 4aqv_B* 4aqw_B* 4atu_A* ... Back     alignment and structure
>3ryc_A Tubulin alpha chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_A* 3ryh_A* 3ryi_A* 3ut5_A* 4eb6_A* 4f61_A* 4f6r_A* 3hke_A* 3hkc_A* 3hkd_A* 3hkb_A* 3n2g_A* 3n2k_A* 1sa0_A* 1sa1_A* 3edl_F* 1ffx_A* 1ia0_A* 2hxf_A* 2hxh_A* ... Back     alignment and structure
>2vxy_A FTSZ, cell division protein FTSZ; GTP-binding, nucleotide-binding, septation, cytoplasm, B.subtilis, cell cycle; HET: CIT; 1.7A {Bacillus subtilis} PDB: 2vam_A* 2rhj_A* 2rhh_A* 2rhl_A* 2rho_A* Back     alignment and structure
>3cb2_A Gamma-1-tubulin, tubulin gamma-1 chain; lattice, microtubule, nucleation, GTPase, lateral interaction, structural protein, hydrolase; HET: GDP; 2.30A {Homo sapiens} PDB: 1z5v_A* 1z5w_A* Back     alignment and structure
>2bto_A Tubulin btuba; bacterial tubulin, polymerization, cytoskeleton, protein COM cytoskeletal protein; HET: GTP; 2.5A {Prosthecobacter dejongeii} SCOP: c.32.1.1 d.79.2.1 PDB: 2btq_A* Back     alignment and structure
>2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} Back     alignment and structure
>2r75_1 Cell division protein FTSZ; GTPase, tubulin-like, inhibitor, cell cycle; HET: 01G; 1.40A {Aquifex aeolicus} PDB: 2r6r_1* Back     alignment and structure
>1w5f_A Cell division protein FTSZ; complete proteome, GTP-binding, multigene family, septation, tubulin, filament, Z-ring, GTPase, domain swapped; HET: G2P; 2.0A {Thermotoga maritima} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>3m89_A FTSZ/tubulin-related protein; partition, TUBZ, GTP-binding, nucleotide-BIND structural protein; HET: GSP; 2.00A {Bacillus thuringiensis} PDB: 3m8k_A 2xka_A* 2xkb_A* Back     alignment and structure
>1ofu_A FTSZ, cell division protein FTSZ; bacterial cell division inhibitor, SULA protein; HET: GDP; 2.1A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure
>1rq2_A Cell division protein FTSZ; cell cycle, tubulin, GTPase, signaling protein; HET: CIT; 1.86A {Mycobacterium tuberculosis} SCOP: c.32.1.1 d.79.2.1 PDB: 1rlu_A* 1rq7_A* 2q1y_A* 2q1x_A* Back     alignment and structure
>2vaw_A FTSZ, cell division protein FTSZ; bacterial cell division protein, tubulin homolog, nucleotide-binding, GTPase, septation, cytoplasm; HET: GDP; 2.90A {Pseudomonas aeruginosa} SCOP: c.32.1.1 d.79.2.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 200
d1tuba2 195 d.79.2.1 (A:246-440) Tubulin alpha-subunit {Pig (S 6e-31
d1tubb2 184 d.79.2.1 (B:246-437) Tubulin beta-subunit {Pig (Su 5e-29
d1tuba1245 c.32.1.1 (A:1-245) Tubulin alpha-subunit {Pig (Sus 5e-29
d2btoa2 180 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosth 3e-28
d1tubb1243 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus 1e-23
d2btoa1244 c.32.1.1 (A:3-246) Tubulin alpha-subunit {Prosthec 2e-21
>d1tuba2 d.79.2.1 (A:246-440) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} Length = 195 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: Tubulin C-terminal domain-like
family: Tubulin, C-terminal domain
domain: Tubulin alpha-subunit
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  109 bits (274), Expect = 6e-31
 Identities = 59/65 (90%), Positives = 62/65 (95%)

Query: 134 LSTNLVPYPRIHFPLATYAPVISAEKAYHEQMTVAEITNACFEPANQMVKCDPRHGKYMA 193
             TNLVPYPR HFPLATYAPVISAEKAYHEQ++VAEITNACFEPANQMVKCDPRHGKYMA
Sbjct: 10  FQTNLVPYPRGHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMA 69

Query: 194 CCMLY 198
           CC+LY
Sbjct: 70  CCLLY 74
>d1tubb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} Length = 184 Back     information, alignment and structure
>d1tuba1 c.32.1.1 (A:1-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} Length = 245 Back     information, alignment and structure
>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} Length = 180 Back     information, alignment and structure
>d1tubb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} Length = 243 Back     information, alignment and structure
>d2btoa1 c.32.1.1 (A:3-246) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} Length = 244 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
d1tuba1245 Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 98 99.95
d1tubb1243 Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 982 99.94
d2btoa1244 Tubulin alpha-subunit {Prosthecobacter dejongeii [ 99.88
d2btoa2 180 Tubulin alpha-subunit {Prosthecobacter dejongeii [ 99.79
d1tuba2 195 Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 98 99.78
d1tubb2 184 Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 982 99.76
d1tuba1245 Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 98 98.84
d1tubb1243 Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 982 98.78
d2btoa1244 Tubulin alpha-subunit {Prosthecobacter dejongeii [ 98.63
>d1tuba1 c.32.1.1 (A:1-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tubulin nucleotide-binding domain-like
superfamily: Tubulin nucleotide-binding domain-like
family: Tubulin, GTPase domain
domain: Tubulin alpha-subunit
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=99.95  E-value=5.5e-29  Score=208.93  Aligned_cols=90  Identities=66%  Similarity=1.104  Sum_probs=83.7

Q ss_pred             ccceeEEeecCccccchHHHHHHHHhhcCCCCCCCCCCCCCCCCCCCcccccccccCCCCCC------CCCCCCC---cc
Q psy8705          43 YRECISVHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGAGDDSFNTFFSETGADQSC------PLSPHPL---ST  113 (200)
Q Consensus        43 m~EiI~iqvGQcGnQIG~~fWe~l~~Eh~i~~~g~~~~~~~~~~~~~~~~~fF~e~~~~~~v------DlEp~vI---~~  113 (200)
                      |||||+|||||||||||.+||+++++||+|++||.+..+......++++++||+|..+++|+      ||||+||   ++
T Consensus         1 MrEII~iqvGQcGnQIG~~~w~~l~~Eh~i~~~g~~~~~~~~~~~~~~~~~fF~e~~~~~~~pRavlvD~E~~vI~~i~~   80 (245)
T d1tuba1           1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRT   80 (245)
T ss_dssp             CCCCCEECCSHHHHHHHHHHHHHHTTTCCTTTCCCCSCCTTSSTTCCCSCCSSCSSSCTTTSCSCCEEESSHHHHHHHSG
T ss_pred             CCcEEEEeccCHHHHHHHHHHHHHHHHhCcCCCCCccCccccccccccchhhhhcccCCccccceeEecCCcceeeeecc
Confidence            99999999999999999999999999999999999877665556778899999999999887      9999999   78


Q ss_pred             CCCccccccccc----ccccCcc
Q psy8705         114 GNLRSCYLSRES----LSKLCFV  132 (200)
Q Consensus       114 g~~~~lf~p~n~----~gagNNw  132 (200)
                      ++++++|+|+++    +||||||
T Consensus        81 ~~~~~~f~~~~~i~~~~gsgNNw  103 (245)
T d1tuba1          81 GTYRQLFHPEQLITGKEDAANNY  103 (245)
T ss_dssp             GGCSCCCCSSSEEECCSCCCCSS
T ss_pred             CcchhccCccccccCCCCcccch
Confidence            889999999999    8999999
>d1tubb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2btoa1 c.32.1.1 (A:3-246) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} Back     information, alignment and structure
>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} Back     information, alignment and structure
>d1tuba2 d.79.2.1 (A:246-440) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tubb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tuba1 c.32.1.1 (A:1-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tubb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2btoa1 c.32.1.1 (A:3-246) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} Back     information, alignment and structure