Psyllid ID: psy8712


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-
MAAFEEMGVLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIIQIVCETLKEIQAGKGQGKAKAQVISPTWILSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTDEGLCRVGWSTSQAVRDLGTDRFGFGFGGTGKKSNNKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSFNFGATPFKHEPPKDYIAVCNAPKQNVKHSESADVSAGPVKLVNNAPQAIIIEPSRELAEQTFNQIIKFKKFITDPKIRELLIIGGVNVKDQMSVLSSGVDIVVGTPGRMEDLISGGHLSLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKRLQMIVCSATLHDFDVKKMAERLMYFPTWVDLKGEDAVPETVHHVVVKIDPQQDETWGRLRSHIQTDGVHARDNARPGIDISGLPFIINMTLPDDKANYVHRIGRVGRAERMGLAISLVSTVPEKVWYHGEWCATRGRNCSNTQLTDVKGNSQVPIFLLSGTMVNGCCIWFDEKRMLGEIEEHLNVTIQQVDDKLEIPADEFDGKVVYGQKRVNMGSSYENHVTQMEPSVNKLSKLESKAQLIYLKHHQAKQRA
ccccccccccHHHHHHHHHcccccccHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEHHcccHHHcccccccccccccccccccccccccccccccEEEEEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEccccccccccccHHHHHcccccccccccEEEEEEccccccccccccccEEEcccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHHHccccccccEEEEEEccccHHHHHHHHHccccEEEccccHHHHHHHcccEEcccEEEEEEcccccccccccHHHHHHHHHHccccccccccEEEEEEEcccccHHHHHHHHHHccccEEEEEcccccccccEEEEEEEEccccHHHHHHHHccccccEEEEEEccccccccccccEEEEEcccccccccEEEccccccccccccEEEEEEccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccEEEccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccHHHccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccEHEHHHHHHHHHHcccccEEEEEEEEEEcccccccEEEEccEEEEEEEEEccccEEEcccccHcccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccHHHccccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHcccccHHcEEEEEEcHHHHHHHcccHHHHHHHHHHccccccccccEEEEEEEcccccHHHHHHHHHHHccccEEEEcccccccccEEEEEEEccHHHHHHHHHHHHcccccEEEEEccccccccccccEEEEEEEccccccHcEEEEcccccccccEEEEEEEcccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHcccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
maafeemgvlpeIGKAVEEMDWLLPTDVQAEAIplilgggdvlmaaetgsgktgafcLPIIQIVCETLKEIqagkgqgkakaqvisptwilsvwdrdtamaitpeglrcqsreqkewhgcrankgvygrgkyyyeatvtdeglcrvgwsTSQAVRdlgtdrfgfgfggtgkksnnkqfdnygeafgmHDVIGClldldnmtvaftkngqhlGLAFNISqqlknsafyPAVVLKNaemsfnfgatpfkheppkdyiavcnapkqnvkhsesadvsagpvklvnnapqaiiiepsRELAEQTFNQIIKFKKFITDPKIRELLIIGGVNVKDQMSVLssgvdivvgtpgrmedlisgghlslthcrfFVLDEADGLLKQGYGNLIDRMHKqipkitsdgKRLQMIVCSATLHDFDVKKMAERLMYfptwvdlkgedavpetVHHVVVkidpqqdetwgRLRSHiqtdgvhardnarpgidisglpfiinmtlpddkanyvhRIGRVGRAERMGLAISLVSTVpekvwyhgewcatrgrncsntqltdvkgnsqvpIFLLSgtmvngcciwfdEKRMLGEIEEHLNVTIQqvddkleipadefdgkvvygqkrvnmgssyenhvtqmepsvnklSKLESKAQLIYLKHHQAKQRA
maafeemgVLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIIQIVCETLKEIQAGkgqgkakaqvispTWILSVWDRDTAMAITPEGLrcqsreqkewhgcrankgvygrGKYYYEATVTDEGLCRVGWSTSQAVRDLGTDRFGFgfggtgkksnnKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSFNFGATPFKHEPPKDYIAVCNAPKQNVKHSesadvsagpvkLVNNAPQAIIIEPSRELAEQTFNQIIKFkkfitdpkIRELLIIGgvnvkdqmsvLSSGVDIVVGTPGRMEDLISGGHLSLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKRLQMIVCSATLHDFDVKKMAERLMYFPTWVDLKGEDAVPETVHHVVVKidpqqdetwgRLRSHIQtdgvhardnarpgiDISGLPFIINMTLPDDKANYVHRIGRVGRAERMGLAISLVSTVPEKVWYHGEWCATRGRNCSNTQLTDVKGNSQVPIFLLSGTMVNGCCIWFDEKRMLGEIEEHLNVTIQQVDDKLEIPADEFDGKVVYGQKRVNMGSSYENHVTQMEPSVNKLSKLESKAQLIYLKHHQAKQRA
MAAFEEMGVLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIIQIVCETLKEIqagkgqgkakaqVISPTWILSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTDEGLCRVGWSTSQAVrdlgtdrfgfgfggtgKKSNNKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSFNFGATPFKHEPPKDYIAVCNAPKQNVKHSESADVSAGPVKLVNNAPQAIIIEPSRELAEQTFNQIIKFKKFITDPKIRELLIIGGVNVKDQMSVLSSGVDIVVGTPGRMEDLISGGHLSLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKRLQMIVCSATLHDFDVKKMAERLMYFPTWVDLKGEDAVPETVHHVVVKIDPQQDETWGRLRSHIQTDGVHARDNARPGIDISGLPFIINMTLPDDKANYVHRIGRVGRAERMGLAISLVSTVPEKVWYHGEWCATRGRNCSNTQLTDVKGNSQVPIFLLSGTMVNGCCIWFDEKRMLGEIEEHLNVTIQQVDDKLEIPADEFDGKVVYGQKRVNMGSSYENHVTQMEPSVNKLSKLESKAQLIYLKHHQAKQRA
********VLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIIQIVCETLKEIQAGKGQGKAKAQVISPTWILSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTDEGLCRVGWSTSQAVRDLGTDRFGFGFGGTGKKSNNKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSFNFGATPFKHEPPKDYIAVCN******************VKLVNNAPQAIIIEPSRELAEQTFNQIIKFKKFITDPKIRELLIIGGVNVKDQMSVLSSGVDIVVGTPGRMEDLISGGHLSLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKRLQMIVCSATLHDFDVKKMAERLMYFPTWVDLKGEDAVPETVHHVVVKIDPQQDETWGRLRSHIQTDGVHARDNARPGIDISGLPFIINMTLPDDKANYVHRIGRVGRAERMGLAISLVSTVPEKVWYHGEWCATRGRNCSNTQLTDVKGNSQVPIFLLSGTMVNGCCIWFDEKRMLGEIEEHLNVTIQQVDDKLEIPADEFDGKVVYGQKRV*****************************I***********
*AAFEEMGVLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIIQIV*************************ILSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTDEGLCRVGWSTSQAVRDLGTDRFGFGFGGTGKKSNNKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSFNFGATPFKHEPPKDYIAVCNAPKQNVK*******************QAIIIEPSRELAEQTFNQIIKFKKFITDPKIRELLIIGGVNVKDQMSVLSSGVDIVVGTPGRMEDLISGGHLSLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKRLQMIVCSATLHDFDVKKMAERLMYFPTWVDLKGEDAVPETVHHVVVKIDPQQDETWGRLRSHIQTDGVHARDNARPGIDISGLPFIINMTLPDDKANYVHRIGRVGRAERMGLAISLVSTVPEKVWYHGEWCATRGRNCSNTQLTDVKGN*************NGCCIWFDEKRMLGEIEEHLNVTIQQVDDKLEIPADEFDG*******************TQMEPSVNKLSKLESKAQLIYLKHHQA****
MAAFEEMGVLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIIQIVCETLKEIQ***********VISPTWILSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTDEGLCRVGWSTSQAVRDLGTDRFGFGFGGTGKKSNNKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSFNFGATPFKHEPPKDYIAVCNAPKQ**********SAGPVKLVNNAPQAIIIEPSRELAEQTFNQIIKFKKFITDPKIRELLIIGGVNVKDQMSVLSSGVDIVVGTPGRMEDLISGGHLSLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKRLQMIVCSATLHDFDVKKMAERLMYFPTWVDLKGEDAVPETVHHVVVKIDPQQDETWGRLRSHIQTDGVHARDNARPGIDISGLPFIINMTLPDDKANYVHRIGRVGRAERMGLAISLVSTVPEKVWYHGEWCATRGRNCSNTQLTDVKGNSQVPIFLLSGTMVNGCCIWFDEKRMLGEIEEHLNVTIQQVDDKLEIPADEFDGKVVYGQKRVNMGSSYENHVTQMEPSVNKLSKLESKAQLIYLK********
*AAFEEMGVLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIIQIVCETLKEIQAGKGQGKAKAQVISPTWILSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTDEGLCRVGWSTSQAVRDLGTDRFGFGFGGTGKKSNNKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSFNFGATPFKHEPPKDYIAVCNAPKQNVKHSESADVSAGPVKLVNNAPQAIIIEPSRELAEQTFNQIIKFKKFITDPKIRELLIIGGVNVKDQMSVLSSGVDIVVGTPGRMEDLISGGHLSLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKRLQMIVCSATLHDFDVKKMAERLMYFPTWVDLKGEDAVPETVHHVVVKIDPQQDETWGRLRSHIQTDGVHARDNARPGIDISGLPFIINMTLPDDKANYVHRIGRVGRAERMGLAISLVSTVPEKVWYHGEWCATRGRNCSNTQLTDVKGNSQVPIFLLSGTMVNGCCIWFDEKRMLGEIEEHLNVTIQQVDDKLEIPADEFDGKVVYGQKRVNMGSSYENHVTQMEPSVNKLSKLESKAQLIYLKHHQA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAFEEMGVLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIIQIVCETLKEIQAGKGQGKAKAQVISPTWILSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTDEGLCRVGWSTSQAVRDLGTDRFGFGFGGTGKKSNNKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSFNFGATPFKHEPPKDYIAVCNAPKQNVKHSESADVSAGPVKLVNNAPQAIIIEPSRELAEQTFNQIIKFKKFITDPKIRELLIIGGVNVKDQMSVLSSGVDIVVGTPGRMEDLISGGHLSLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKRLQMIVCSATLHDFDVKKMAERLMYFPTWVDLKGEDAVPETVHHVVVKIDPQQDETWGRLRSHIQTDGVHARDNARPGIDISGLPFIINMTLPDDKANYVHRIGRVGRAERMGLAISLVSTVPEKVWYHGEWCATRGRNCSNTQLTDVKGNSQVPIFLLSGTMVNGCCIWFDEKRMLGEIEEHLNVTIQQVDDKLEIPADEFDGKVVYGQKRVNMGSSYENHVTQMEPSVNKLSKLESKAQLIYLKHHQAKQRA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query651
FB|FBgn0015075727 Ddx1 "Dead-box-1" [Drosophila 0.728 0.651 0.648 6.3e-225
UNIPROTKB|Q92499740 DDX1 "ATP-dependent RNA helica 0.725 0.637 0.619 6.1e-183
UNIPROTKB|Q5NVJ8740 DDX1 "ATP-dependent RNA helica 0.725 0.637 0.619 6.1e-183
RGD|619903740 Ddx1 "DEAD (Asp-Glu-Ala-Asp) b 0.721 0.635 0.619 1.3e-182
UNIPROTKB|Q4R7L5740 DDX1 "ATP-dependent RNA helica 0.725 0.637 0.617 1.6e-182
UNIPROTKB|Q0IIK5740 DDX1 "ATP-dependent RNA helica 0.721 0.635 0.616 4.3e-182
MGI|MGI:2144727740 Ddx1 "DEAD (Asp-Glu-Ala-Asp) b 0.725 0.637 0.609 1.8e-181
UNIPROTKB|A2VD92740 ddx1 "ATP-dependent RNA helica 0.726 0.639 0.606 3.8e-181
UNIPROTKB|F6V659740 DDX1 "Uncharacterized protein" 0.725 0.637 0.609 4.9e-181
UNIPROTKB|F1NV49740 DDX1 "ATP-dependent RNA helica 0.725 0.637 0.613 1.6e-180
FB|FBgn0015075 Ddx1 "Dead-box-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1615 (573.6 bits), Expect = 6.3e-225, Sum P(2) = 6.3e-225
 Identities = 310/478 (64%), Positives = 363/478 (75%)

Query:     1 MAAFEEMGVLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPI 60
             M AFEE GVLPE+G A +E+DW LPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPI
Sbjct:     1 MTAFEEFGVLPELGMATDELDWTLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPI 60

Query:    61 IQIVCETLKEIXXXXXXXXXXXX-VISPTWILSVWDRDTAMAITPEGLRCQSREQKEWHG 119
             +QIV ETL+++              ++P W +S +DR  A+A+TP+GLRCQSRE KEWHG
Sbjct:    61 LQIVWETLRDLEEGKAGKGGAIGGAVTP-WTMSFFDRGNALAVTPDGLRCQSREFKEWHG 119

Query:   120 CRANKGVYGRGKYYYEATVTDEGLCRVGWSTSQAVXXXXXXXXXXXXXXXXKKSNNKQFD 179
             CRA  GV G+GK+Y+EATVTDEGLCRVGWST QA                 KKSNN+QFD
Sbjct:   120 CRATTGVRGKGKFYFEATVTDEGLCRVGWSTQQANLDLGTCRMGFGFGGTGKKSNNRQFD 179

Query:   180 NYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSF 239
             +YGEAFG  DVIGCLLDL N  V+FTKNGQ+LG+AF +   L    FYPAVVLKNAEM F
Sbjct:   180 DYGEAFGKADVIGCLLDLKNQEVSFTKNGQNLGVAFRLPDNLAKETFYPAVVLKNAEMQF 239

Query:   240 NFGATPFKHEPPKDYIAVCNAPKQNVKHSESADVSAG-P-VKLVNNAPQAIIIEPSRELA 297
             NFG T FK+ P   ++  C A  ++ K +     +AG P  K   NAPQAII+EPSRELA
Sbjct:   240 NFGKTDFKYAPGNGFVGACQAGPEHSKANPITGPAAGAPSAKPAPNAPQAIIMEPSRELA 299

Query:   298 EQTFNQIIKFKKFITDPKIRELLIIGGVNVKDQMSVLSSGVDIVVGTPGRMEDLISGGHL 357
             EQT+NQI KFK  +++P++R LL+IGGV +++Q + L  G  IVVGTPGR+E++I+ G +
Sbjct:   300 EQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQGTHIVVGTPGRLEEMINSGLV 359

Query:   358 SLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKRLQMIVCSATLHDFDVKKMA 417
              LTHCRFFVLDEAD LLKQGY  LIDR+HKQIPKITSDG+RLQM+VCSATLH F+VKKMA
Sbjct:   360 LLTHCRFFVLDEADALLKQGYTELIDRLHKQIPKITSDGRRLQMVVCSATLHAFEVKKMA 419

Query:   418 ERLMYFPTWVDLKGEDAVPETVHHVVVKIDPQQDETWGRLRSHIQTDGVHARDNARPG 475
             ERLM+FPTWVDLKGEDAVPETVHHVV  +DPQ D TW  LR  I TDGVH RDN  PG
Sbjct:   420 ERLMHFPTWVDLKGEDAVPETVHHVVCLVDPQMDTTWQSLRQPIGTDGVHDRDNVHPG 477


GO:0008026 "ATP-dependent helicase activity" evidence=ISS
GO:0006446 "regulation of translational initiation" evidence=ISS
GO:0042254 "ribosome biogenesis" evidence=ISS
GO:0001700 "embryonic development via the syncytial blastoderm" evidence=IEP
GO:0000245 "spliceosomal complex assembly" evidence=ISS
GO:0004386 "helicase activity" evidence=ISS
GO:0005575 "cellular_component" evidence=ND
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|Q92499 DDX1 "ATP-dependent RNA helicase DDX1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5NVJ8 DDX1 "ATP-dependent RNA helicase DDX1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
RGD|619903 Ddx1 "DEAD (Asp-Glu-Ala-Asp) box helicase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7L5 DDX1 "ATP-dependent RNA helicase DDX1" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IIK5 DDX1 "ATP-dependent RNA helicase DDX1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2144727 Ddx1 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A2VD92 ddx1 "ATP-dependent RNA helicase DDX1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F6V659 DDX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV49 DDX1 "ATP-dependent RNA helicase DDX1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.946
3rd Layer3.6.40.963

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query651
cd12873155 cd12873, SPRY_DDX1, SPRY domain associated with DE 1e-100
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 3e-48
cd12884176 cd12884, SPRY_hnRNP, SPRY domain in heterogeneous 2e-44
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-36
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 4e-32
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 4e-29
smart00449122 smart00449, SPRY, Domain in SPla and the RYanodine 1e-26
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-26
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 7e-26
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 1e-25
cd11709118 cd11709, SPRY, SPRY domain 2e-25
pfam00622125 pfam00622, SPRY, SPRY domain 2e-25
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-23
cd12872149 cd12872, SPRY_Ash2, SPRY domain in Ash2 5e-23
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-20
cd00268203 cd00268, DEADc, DEAD-box helicases 3e-20
cd12885132 cd12885, SPRY_RanBP_like, SPRY domain in Ran bindi 6e-20
cd12882128 cd12882, SPRY_RNF123, SPRY domain at N-terminus of 7e-19
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-15
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-15
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 1e-14
cd12909153 cd12909, SPRY_RanBP9_10, SPRY domain in Ran bindin 2e-14
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 3e-14
cd12878133 cd12878, SPRY2_RyR, SPRY domain 2 (SPRY2) of ryano 7e-14
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 1e-13
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 1e-13
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 3e-13
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 5e-13
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 6e-13
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 7e-12
cd12883121 cd12883, SPRY_RING, SPRY domain at N-terminus of R 7e-12
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-10
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 5e-09
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-08
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-08
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-08
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-08
cd12886128 cd12886, SPRY_like, SPRY domain-like in bacteria 6e-08
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 1e-07
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-07
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 1e-07
cd12876187 cd12876, SPRY_SOCS3, SPRY domain in the suppressor 1e-07
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 5e-07
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 6e-07
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-06
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 1e-05
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-05
COG1205 851 COG1205, COG1205, Distinct helicase family with a 2e-05
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 3e-05
cd12877151 cd12877, SPRY1_RyR, SPRY domain 1 (SPRY1) of ryano 4e-05
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 6e-05
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 1e-04
cd12889172 cd12889, SPRY_PRY_TRIM67_9, PRY/SPRY domain in tri 0.001
cd12906174 cd12906, SPRY_SOCS1-2-4, SPRY domain in the suppre 0.001
cd12875171 cd12875, SPRY_SOCS_Fbox, SPRY domain in Fbxo45 and 0.001
cd12881160 cd12881, SPRY_HERC1, SPRY domain in HERC1 0.002
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 0.003
>gnl|CDD|240453 cd12873, SPRY_DDX1, SPRY domain associated with DEAD box gene DDX1 Back     alignment and domain information
 Score =  302 bits (775), Expect = e-100
 Identities = 106/155 (68%), Positives = 129/155 (83%)

Query: 91  LSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTDEGLCRVGWST 150
           +S +DRD A+AI+P+GL CQSRE+K W GCRA KGV G+GKYYYE TVTDEGLCRVGWST
Sbjct: 1   MSPYDRDAALAISPDGLLCQSREEKGWQGCRATKGVKGKGKYYYEVTVTDEGLCRVGWST 60

Query: 151 SQAVRDLGTDRFGFGFGGTGKKSNNKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQH 210
             A  DLGTD+FGFG+GGTGKKS+ +QF++YGE FG  DVIGCLLDLDN T++F+KNG+ 
Sbjct: 61  EDASLDLGTDKFGFGYGGTGKKSHGRQFEDYGEPFGKGDVIGCLLDLDNGTISFSKNGKD 120

Query: 211 LGLAFNISQQLKNSAFYPAVVLKNAEMSFNFGATP 245
           LG+AF+I  +L+N A +PAV LKNAE+ FNFG  P
Sbjct: 121 LGVAFDIPPKLRNQALFPAVCLKNAEVEFNFGDEP 155


This SPRY domain is associated with the DEAD box gene, DDX1, an RNA-dependent ATPase involved in HIV-1 Rev function and virus replication. It is suggested that DDX1 acts as a cellular cofactor by promoting oligomerization of Rev on the Rev response element (RRE). DDX1 RNA is overexpressed in breast cancer, data showing a strong and independent association between poor prognosis and deregulation of the DEAD box protein DDX1, thus potentially serving as an effective prognostic biomarker for early recurrence in primary breast cancer. DDX1 also interacts with RelA and enhances nuclear factor kappaB-mediated transcription. DEAD-box proteins are associated with all levels of RNA metabolism and function, and have been implicated in translation initiation, transcription, RNA splicing, ribosome assembly, RNA transport, and RNA decay. Length = 155

>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240464 cd12884, SPRY_hnRNP, SPRY domain in heterogeneous nuclear ribonucleoprotein U-like (hnRNP) protein 1 Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|214669 smart00449, SPRY, Domain in SPla and the RYanodine Receptor Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|240451 cd11709, SPRY, SPRY domain Back     alignment and domain information
>gnl|CDD|216029 pfam00622, SPRY, SPRY domain Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|240452 cd12872, SPRY_Ash2, SPRY domain in Ash2 Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|240465 cd12885, SPRY_RanBP_like, SPRY domain in Ran binding proteins, SSH4, HECT E3 and SPRYD3 Back     alignment and domain information
>gnl|CDD|240462 cd12882, SPRY_RNF123, SPRY domain at N-terminus of ring finger protein 123 Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|240489 cd12909, SPRY_RanBP9_10, SPRY domain in Ran binding proteins 9 and 10 Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|240458 cd12878, SPRY2_RyR, SPRY domain 2 (SPRY2) of ryanodine receptor (RyR) Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|240463 cd12883, SPRY_RING, SPRY domain at N-terminus of Really Interesting New Gene (RING) finger domain Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|240466 cd12886, SPRY_like, SPRY domain-like in bacteria Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|240456 cd12876, SPRY_SOCS3, SPRY domain in the suppressor of cytokine signaling 3 (SOCS3) family Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|240457 cd12877, SPRY1_RyR, SPRY domain 1 (SPRY1) of ryanodine receptor (RyR) Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|240469 cd12889, SPRY_PRY_TRIM67_9, PRY/SPRY domain in tripartite motif-containing proteins, TRIM9 and TRIM67 Back     alignment and domain information
>gnl|CDD|240486 cd12906, SPRY_SOCS1-2-4, SPRY domain in the suppressor of cytokine signaling 1, 2, 4 families (SOCS1, SOCS2, SOCS4) Back     alignment and domain information
>gnl|CDD|240455 cd12875, SPRY_SOCS_Fbox, SPRY domain in Fbxo45 and suppressors of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|240461 cd12881, SPRY_HERC1, SPRY domain in HERC1 Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 651
KOG0349|consensus725 100.0
KOG0330|consensus476 100.0
KOG0331|consensus519 100.0
KOG0338|consensus691 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0328|consensus400 100.0
KOG0333|consensus673 100.0
KOG0326|consensus459 100.0
KOG0340|consensus442 100.0
KOG0345|consensus567 100.0
KOG0342|consensus543 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0348|consensus708 100.0
KOG0343|consensus 758 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0346|consensus569 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0347|consensus731 100.0
KOG0335|consensus482 100.0
KOG0336|consensus629 100.0
KOG0341|consensus610 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0337|consensus529 100.0
KOG0327|consensus397 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0339|consensus731 100.0
KOG0332|consensus477 100.0
KOG0334|consensus 997 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0329|consensus387 100.0
KOG4284|consensus 980 100.0
KOG0350|consensus620 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0344|consensus593 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.98
PRK14701 1638 reverse gyrase; Provisional 99.97
PHA02653675 RNA helicase NPH-II; Provisional 99.97
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.97
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.97
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.97
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.96
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.96
COG1205 851 Distinct helicase family with a unique C-terminal 99.95
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.95
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.95
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.94
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.94
KOG0351|consensus 941 99.93
PHA02558501 uvsW UvsW helicase; Provisional 99.93
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.93
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.93
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.93
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.93
KOG0352|consensus 641 99.92
COG1204 766 Superfamily II helicase [General function predicti 99.92
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.92
PRK05580 679 primosome assembly protein PriA; Validated 99.91
COG1202 830 Superfamily II helicase, archaea-specific [General 99.91
PRK13766 773 Hef nuclease; Provisional 99.91
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.9
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.9
KOG0952|consensus 1230 99.88
KOG0353|consensus695 99.86
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.86
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.86
KOG0354|consensus 746 99.85
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.85
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.8
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.8
KOG0947|consensus 1248 99.8
PRK09694878 helicase Cas3; Provisional 99.77
smart00487201 DEXDc DEAD-like helicases superfamily. 99.76
KOG0951|consensus 1674 99.76
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.73
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.73
KOG0948|consensus 1041 99.72
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.72
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.7
PF00622124 SPRY: SPRY domain; InterPro: IPR003877 The SPRY do 99.65
smart00449122 SPRY Domain in SPla and the RYanodine Receptor. Do 99.63
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.62
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.61
PRK04914 956 ATP-dependent helicase HepA; Validated 99.55
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.51
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.45
KOG0950|consensus 1008 99.45
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.41
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.41
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.38
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.35
KOG4150|consensus 1034 99.33
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.26
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.26
KOG0922|consensus 674 99.21
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.19
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.15
KOG2626|consensus544 99.13
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.13
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.11
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.1
KOG0924|consensus 1042 99.09
KOG0949|consensus 1330 99.04
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.01
KOG0923|consensus 902 98.97
KOG0920|consensus 924 98.94
COG4096 875 HsdR Type I site-specific restriction-modification 98.89
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 98.87
PRK05298652 excinuclease ABC subunit B; Provisional 98.83
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 98.81
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.75
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 98.73
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 98.7
KOG0926|consensus 1172 98.68
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.65
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.65
KOG0925|consensus 699 98.63
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.62
KOG2340|consensus698 98.55
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.54
KOG2243|consensus 5019 98.53
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.51
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 98.42
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.36
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.33
KOG1123|consensus776 98.3
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.27
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.24
smart0049082 HELICc helicase superfamily c-terminal domain. 98.23
COG0556663 UvrB Helicase subunit of the DNA excision repair c 98.19
COG4889 1518 Predicted helicase [General function prediction on 98.14
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.09
KOG0951|consensus 1674 98.08
KOG0953|consensus700 97.96
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 97.92
PRK15483 986 type III restriction-modification system StyLTI en 97.77
KOG3953|consensus242 97.72
KOG0385|consensus 971 97.64
PRK14873 665 primosome assembly protein PriA; Provisional 97.64
KOG2242|consensus558 97.63
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 97.55
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.45
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 97.44
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.35
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.3
KOG0952|consensus1230 97.3
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.16
COG0610 962 Type I site-specific restriction-modification syst 97.15
KOG1000|consensus689 97.0
KOG0390|consensus 776 96.87
KOG0387|consensus 923 96.75
COG3587 985 Restriction endonuclease [Defense mechanisms] 96.58
KOG0331|consensus519 96.58
COG1200677 RecG RecG-like helicase [DNA replication, recombin 96.41
KOG0332|consensus477 96.4
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 96.35
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 96.25
KOG0389|consensus 941 96.21
KOG1803|consensus649 96.07
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 96.04
KOG1477|consensus469 95.86
PRK10875615 recD exonuclease V subunit alpha; Provisional 95.78
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 95.74
TIGR00376637 DNA helicase, putative. The gene product may repre 95.73
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 95.73
KOG4030|consensus197 95.69
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 95.64
KOG1132|consensus 945 95.59
PRK13889988 conjugal transfer relaxase TraA; Provisional 95.42
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 95.32
KOG1002|consensus 791 94.4
KOG0384|consensus 1373 94.28
PRK138261102 Dtr system oriT relaxase; Provisional 94.16
KOG1802|consensus935 93.9
KOG4439|consensus 901 93.86
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 93.78
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 93.76
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 93.74
KOG0328|consensus400 93.7
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 93.65
KOG0327|consensus397 93.59
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 93.35
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 93.14
KOG0392|consensus 1549 92.94
KOG0921|consensus 1282 92.81
PF1324576 AAA_19: Part of AAA domain 92.63
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 92.46
KOG1805|consensus1100 92.44
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 92.42
KOG1477|consensus469 92.37
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 92.25
COG11971139 Mfd Transcription-repair coupling factor (superfam 92.06
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 91.84
KOG0335|consensus482 91.45
KOG1001|consensus 674 91.43
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 90.99
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 90.48
PRK06526254 transposase; Provisional 90.37
PRK06893229 DNA replication initiation factor; Validated 90.32
PRK08084235 DNA replication initiation factor; Provisional 90.14
PRK11331459 5-methylcytosine-specific restriction enzyme subun 90.1
KOG0342|consensus543 89.97
KOG0338|consensus691 89.93
PRK05642234 DNA replication initiation factor; Validated 89.1
KOG0391|consensus 1958 88.94
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 88.73
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 88.4
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 88.39
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 87.94
PRK11054684 helD DNA helicase IV; Provisional 87.79
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 87.71
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 87.65
PRK10436462 hypothetical protein; Provisional 87.3
PRK11773721 uvrD DNA-dependent helicase II; Provisional 86.42
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 86.24
PRK13894319 conjugal transfer ATPase TrbB; Provisional 86.21
PRK106891147 transcription-repair coupling factor; Provisional 86.2
PRK08903227 DnaA regulatory inactivator Hda; Validated 85.95
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 85.82
PRK00411394 cdc6 cell division control protein 6; Reviewed 85.71
PRK04296190 thymidine kinase; Provisional 85.63
PTZ001121164 origin recognition complex 1 protein; Provisional 85.6
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 85.47
PRK08181269 transposase; Validated 85.44
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 85.42
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 85.4
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 85.31
PF1324576 AAA_19: Part of AAA domain 85.27
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 85.23
PRK08727233 hypothetical protein; Validated 84.81
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 84.69
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 84.68
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 84.62
PRK14088440 dnaA chromosomal replication initiation protein; P 84.53
KOG0989|consensus346 84.5
KOG0388|consensus 1185 84.41
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 84.16
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 83.86
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 83.77
PHA02533534 17 large terminase protein; Provisional 83.48
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 83.45
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 83.44
PRK13833323 conjugal transfer protein TrbB; Provisional 83.43
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 83.21
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 83.1
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 83.07
smart00382148 AAA ATPases associated with a variety of cellular 82.96
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 82.92
TIGR00362405 DnaA chromosomal replication initiator protein Dna 82.92
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 82.77
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 82.76
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 82.62
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 82.54
PRK13764602 ATPase; Provisional 82.3
PRK09401 1176 reverse gyrase; Reviewed 82.02
PRK14974336 cell division protein FtsY; Provisional 81.94
TIGR02928365 orc1/cdc6 family replication initiation protein. M 81.8
PRK10536262 hypothetical protein; Provisional 81.47
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 81.45
PRK00149450 dnaA chromosomal replication initiation protein; R 81.37
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 81.33
TIGR01073726 pcrA ATP-dependent DNA helicase PcrA. Designed to 81.31
COG4889 1518 Predicted helicase [General function prediction on 81.14
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 81.1
PRK13850670 type IV secretion system protein VirD4; Provisiona 80.61
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 80.57
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 80.44
PRK08116268 hypothetical protein; Validated 80.3
PRK13897606 type IV secretion system component VirD4; Provisio 80.07
>KOG0349|consensus Back     alignment and domain information
Probab=100.00  E-value=1.2e-150  Score=1149.79  Aligned_cols=628  Identities=62%  Similarity=1.054  Sum_probs=594.4

Q ss_pred             CcccccCCCCHHHHHHHHHcCCCCCcHHHHhhHHhHhcCCceEeeecCCCCccceeehhhHHHHHHHHHHhhhcCCCCCC
Q psy8712           1 MAAFEEMGVLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIIQIVCETLKEIQAGKGQGKA   80 (651)
Q Consensus         1 ~~~f~~l~l~~~l~~~l~~~~~~~pt~iQ~~aip~il~g~dvl~~a~TGsGKT~af~lp~l~~~~~~~~~~~~~~~~~~~   80 (651)
                      |+||+|+|+.|||..|.++|+|.+||++|+||||+||+|+||||+|+||||||+||+||+||+|+|++++..+++...+.
T Consensus         1 m~af~e~gv~pel~~a~~e~dw~lptdvqaeaiplilgggdvlmaaetgsgktgaf~lpilqiv~etlrd~~egk~gk~~   80 (725)
T KOG0349|consen    1 MTAFEEFGVLPELGMATDELDWTLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPILQIVWETLRDLEEGKAGKGG   80 (725)
T ss_pred             CcchHhhCcchHhhhhhhhhccccccccccccccEEecCCcEEEEeccCCCCccceehhhHHHHHHHHHhHhhcccCCCc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999998886454


Q ss_pred             ccccccCceeeeccccccccccCCCCcccccccccccccccccccccCCceeEEEEEeccCCceeeccccccccccCCCC
Q psy8712          81 KAQVISPTWILSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTDEGLCRVGWSTSQAVRDLGTD  160 (651)
Q Consensus        81 ~~~~~~p~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~g~~  160 (651)
                      ..-.....|.|+.+||+.++||++||+.||||..++|+|||+|.|+.|+||||||+|++|+|||||||||..+++|+||+
T Consensus        81 ~~~ga~~~w~mn~~Drg~alaI~~dGL~CqSre~KeWhGcRaT~Gl~gkGK~YyEvtitd~GLCRVGWsT~qasLdlGt~  160 (725)
T KOG0349|consen   81 MADGAPREWKMNKQDRGLALAIDEDGLACQSREKKEWHGCRATAGLYGKGKYYYEVTITDKGLCRVGWSTLQASLDLGTG  160 (725)
T ss_pred             ccCCCccccccCccccCceeeEcCCccccchhHHhhhhccccccccccCceEEEEEEeccCceeeechhhcccccccCcc
Confidence            44445556999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcCCCCccCCCcccCccCcccCCCcccccccccCCceeeeeccCcccccccccchhhhhccCcchhhccccccccc
Q psy8712         161 RFGFGFGGTGKKSNNKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSFN  240 (651)
Q Consensus       161 ~~~~~~gg~~~ks~~~~~~~~g~~~~~~d~ig~~~~~~~~~~~~~~ng~~~g~af~~~~~~~~~~~~p~~~~k~~~~~~~  240 (651)
                      ..+||||||||||+|+|||+|||||+.+||||||||+|+++|+|||||+.||.||++|.++.|+.|||||++||+|++||
T Consensus       161 ~~gFGfGGTGkKS~nkqFDdYGe~Ft~~DvIGCyLDld~~~v~fsKNG~~lg~AF~ip~~~kn~~lfPAvvlkNael~fN  240 (725)
T KOG0349|consen  161 LDGFGFGGTGKKSTNKQFDDYGEPFTLNDVIGCYLDLDSRTVWFSKNGEQLGAAFSIPVKYKNSNLFPAVVLKNAELSFN  240 (725)
T ss_pred             ccccccCccCccccccccccccCcccccceeeEEEeccCceEEEecCccccceeEEcChhhcccccchheeeccceEEEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCCCCeEEEecCCCCceeeeeccc--cccCCccccCCCCeEEEEeCCHHHHHHHHHHHHHhhccCCCCCeeE
Q psy8712         241 FGATPFKHEPPKDYIAVCNAPKQNVKHSESAD--VSAGPVKLVNNAPQAIIIEPSRELAEQTFNQIIKFKKFITDPKIRE  318 (651)
Q Consensus       241 f~~~~~~~~~~~~~i~~~~~gsGKT~~~~~a~--~~~~~~~~~~~~p~aLIL~PTreLa~Qi~~~~~~l~~~~~~~~i~v  318 (651)
                      ||.+||++||...+++.++++-+-+.+.+..-  +.....++.++.|+++|+.|+||||+|+++.+++|..++++|.++.
T Consensus       241 FG~~~FKfpPgngFva~s~Ap~e~~~~n~~~g~~a~~~~~k~~pNap~avivepsrelaEqt~N~i~~Fk~h~~np~~r~  320 (725)
T KOG0349|consen  241 FGSQPFKFPPGNGFVAVSDAPNEHSKANVNWGSYAEAPSAKPAPNAPEAVIVEPSRELAEQTHNQIEEFKMHTSNPEVRS  320 (725)
T ss_pred             cCCCccccCCCCceEEeecCCccccccCccccccccCcccccCCCCcceeEecCcHHHHHHHHhhHHHHHhhcCChhhhh
Confidence            99999999999999999999999777765543  5555667789999999999999999999999999999999999999


Q ss_pred             EEEeCCccHHHHHHHhccCCcEEEECchhhHHHHhCCCcccCCcceEeeccchhhhhccchHHHHHHHhcCCCccCCCCc
Q psy8712         319 LLIIGGVNVKDQMSVLSSGVDIVVGTPGRMEDLISGGHLSLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKR  398 (651)
Q Consensus       319 ~~l~Gg~~~~~q~~~L~~~~dIlV~TP~rL~~ll~~~~l~l~~l~~lViDEaD~ll~~gf~~~i~~il~~lp~~~~~~~~  398 (651)
                      .+++||.-...|...++.+.||+||||+|+.+++.++.+.+.++++||+||||.++.+++-+.|.++...+|+..+++.+
T Consensus       321 lLmiggv~~r~Q~~ql~~g~~ivvGtpgRl~~~is~g~~~lt~crFlvlDead~lL~qgy~d~I~r~h~qip~~tsdg~r  400 (725)
T KOG0349|consen  321 LLMIGGVLKRTQCKQLKDGTHIVVGTPGRLLQPISKGLVTLTHCRFLVLDEADLLLGQGYDDKIYRFHGQIPHMTSDGFR  400 (725)
T ss_pred             hhhhhhHHhHHHHHHhhcCceeeecCchhhhhhhhccceeeeeeEEEEecchhhhhhcccHHHHHHHhccchhhhcCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeEEEEeeccChHHHHHHHHHhccCCeEEEccCCCCccCceEEEEEEeCcchHHHHHHH---------------------
Q psy8712         399 LQMIVCSATLHDFDVKKMAERLMYFPTWVDLKGEDAVPETVHHVVVKIDPQQDETWGRL---------------------  457 (651)
Q Consensus       399 ~Q~l~~SATl~~~~v~~l~~~~l~~p~~i~~~~~~~~~~~i~~~~~~~~~~~~~~~~~l---------------------  457 (651)
                      .|.+++|||++..+|..+.+++|..|.|+++.+++..+++++|+++.+++.-+..|..+                     
T Consensus       401 lq~~vCsatlh~feVkk~~ervmhfptwVdLkgeD~vpetvHhvv~lv~p~~d~sw~~lr~~i~td~vh~kdn~~pg~~S  480 (725)
T KOG0349|consen  401 LQSPVCSATLHIFEVKKVGERVMHFPTWVDLKGEDLVPETVHHVVKLVCPSVDGSWCDLRQFIETDKVHTKDNLLPGQVS  480 (725)
T ss_pred             cccceeeeEEeEEEeeehhhhhccCceeEecccccccchhhccceeecCCccCccHHHHhhhhccCCcccccccccccCC
Confidence            99999999999999999999999999999999999999999998887765532222222                     


Q ss_pred             -------------------------------------------------------------------------hhccccc
Q psy8712         458 -------------------------------------------------------------------------RSHIQTD  464 (651)
Q Consensus       458 -------------------------------------------------------------------------~~~~~~~  464 (651)
                                                                                               ++...+.
T Consensus       481 pe~~s~a~kilkgEy~v~ai~~h~mdkaiifcrtk~dcDnLer~~~qkgg~~~scvclhgDrkP~Erk~nle~Fkk~dvk  560 (725)
T KOG0349|consen  481 PENPSSATKILKGEYGVVAIRRHAMDKAIIFCRTKQDCDNLERMMNQKGGKHYSCVCLHGDRKPDERKANLESFKKFDVK  560 (725)
T ss_pred             CCChhhhhHHhcCchhhhhhhhhccCceEEEEeccccchHHHHHHHHcCCccceeEEEecCCChhHHHHHHHhhhhcCeE
Confidence                                                                                     2333445


Q ss_pred             eeeccccccCCCCCCCCCEEEEeCCCCChhhhhhhcCccccCCCceEEEEeeeCCccccccccccccccCCccCCccccc
Q psy8712         465 GVHARDNARPGIDISGLPFIINMTLPDDKANYVHRIGRVGRAERMGLAISLVSTVPEKVWYHGEWCATRGRNCSNTQLTD  544 (651)
Q Consensus       465 ~l~~td~~~rGIDip~v~~VIn~dlP~s~~~YihRiGR~GR~g~~G~ai~lv~~~de~~~~~~~~~~~~~~~~~~~~l~~  544 (651)
                      .+.|||+++|||||.++.++||..+|.+..+|+|||||+||+.+.|.||+|+...+|++|||  .|.+|++.|.|++|.+
T Consensus       561 flictdvaargldi~g~p~~invtlpd~k~nyvhrigrvgraermglaislvat~~ekvwyh--~c~srgr~c~nt~l~e  638 (725)
T KOG0349|consen  561 FLICTDVAARGLDITGLPFMINVTLPDDKTNYVHRIGRVGRAERMGLAISLVATVPEKVWYH--WCKSRGRSCNNTNLTE  638 (725)
T ss_pred             EEEEehhhhccccccCCceEEEEecCcccchhhhhhhccchhhhcceeEEEeeccchheeeh--hhhccCCcccCCcccc
Confidence            56678999999999999999999999999999999999999999999999999999999999  8999999999999999


Q ss_pred             ccCCCCcchhhccccccCCcccchhHHHHHHHHHHHhcCccccccccccCCcccCCCceeecceecccCccchhhHhhhh
Q psy8712         545 VKGNSQVPIFLLSGTMVNGCCIWFDEKRMLGEIEEHLNVTIQQVDDKLEIPADEFDGKVVYGQKRVNMGSSYENHVTQME  624 (651)
Q Consensus       545 ~~~~~~~~~~~~~~~~~~~~~i~~~e~~~l~~Ie~~~~~~i~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~  624 (651)
                      ..|                |+|||+|+.+|.+||+|+|++|.++++++++|+++|+++|+||+++..+++.|++|++.+.
T Consensus       639 ~~g----------------c~iwyne~~llaeve~hln~ti~qv~~~~~vpv~~fdgkv~ygqk~~~~g~~y~~hv~~l~  702 (725)
T KOG0349|consen  639 VRG----------------CCIWYNEPNLLAEVEDHLNITIQQVDKTMDVPVNDFDGKVVYGQKNLRTGSGYEDHVEQLV  702 (725)
T ss_pred             ccc----------------eEEEeCchhHHHHHHHhhcceeeeeCCCCCCcccccCCeEEecccccccCCCccchHHHhh
Confidence            988                9999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhh
Q psy8712         625 PSVNKLSKLESKAQLIYLKHHQ  646 (651)
Q Consensus       625 ~~~~el~~le~~~~~~~~~~~~  646 (651)
                      +.|.+|.+||.+.|..||...+
T Consensus       703 ptv~~l~~le~~sqs~fl~~~~  724 (725)
T KOG0349|consen  703 PTVRKLTELELQSQSLFLKRLK  724 (725)
T ss_pred             hHHHHHHHHHHHHHHHHHHhhc
Confidence            9999999999999999998764



>KOG0330|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00622 SPRY: SPRY domain; InterPro: IPR003877 The SPRY domain is of unknown function Back     alignment and domain information
>smart00449 SPRY Domain in SPla and the RYanodine Receptor Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG2626|consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG2243|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>KOG3953|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG2242|consensus Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1477|consensus Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG4030|consensus Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG1477|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query651
3toj_A213 SET1/ASH2 histone methyltransferase complex subun; 4e-52
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 4e-49
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 3e-18
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 4e-48
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 3e-18
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 2e-46
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 4e-18
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 2e-46
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 3e-18
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 4e-46
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 2e-11
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 3e-44
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 6e-18
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 3e-44
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 1e-14
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 7e-41
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 7e-16
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 4e-40
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 7e-16
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 5e-39
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 2e-18
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 5e-39
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 2e-17
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-36
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 3e-13
2yyo_A171 SPRY domain-containing protein 3; NPPSFA, national 9e-36
3emw_A217 SPRY domain-containing SOCS box protein 2; apoptos 8e-34
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 1e-33
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 9e-20
2afj_A226 Gene rich cluster, C9 gene; beta sandwich, gene re 1e-32
3bor_A237 Human initiation factor 4A-II; translation initiat 2e-32
3bor_A237 Human initiation factor 4A-II; translation initiat 4e-18
2jk9_A212 SPRY domain-containing SOCS box protein 1; transcr 2e-32
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 6e-32
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 1e-18
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-31
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-16
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 2e-31
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 4e-19
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 2e-31
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 3e-18
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 2e-30
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 5e-16
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-10
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 3e-30
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-15
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-10
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 1e-29
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 4e-22
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 2e-29
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 3e-18
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 3e-29
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 2e-18
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 2e-28
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 7e-14
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 1e-09
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 2e-28
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-17
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 7e-28
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 4e-13
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 2e-26
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 2e-13
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 2e-26
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 4e-15
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 5e-25
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 3e-22
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 1e-24
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 3e-17
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 5e-24
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 2e-19
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 9e-16
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 3e-15
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 3e-14
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-13
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 1e-13
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 1e-13
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 2e-11
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 4e-11
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 5e-11
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 9e-07
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 7e-05
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 3e-04
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 3e-04
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3toj_A SET1/ASH2 histone methyltransferase complex subun; transcription, SPRY domain, prote binding, histone methylation, RBBP5, DPY-30, nuclear; 2.07A {Homo sapiens} Length = 213 Back     alignment and structure
 Score =  177 bits (451), Expect = 4e-52
 Identities = 54/207 (26%), Positives = 94/207 (45%), Gaps = 23/207 (11%)

Query: 83  QVISPTWILSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTD-- 140
             +    +L++ DR   + I+ + L      +K +   RA+ GV  +G +Y+E TV +  
Sbjct: 7   ACLYERVLLALHDRAPQLKISDDRLTVVG--EKGYSMVRASHGVR-KGAWYFEITVDEMP 63

Query: 141 -EGLCRVGWSTSQAVRD--LGTDRFGFGF-GGTGKKSNNKQFDNYGEAFGMHDVIGCLLD 196
            +   R+GWS         LG D+F + +    G K +     +Y   +G  DV+G  ++
Sbjct: 64  PDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYIN 123

Query: 197 LDNMTVA--------FTKNGQHLGLAFNISQQLKNSAFYPAVVL-KNAEMSFNFGATPFK 247
           L   T++        F KNG + G+A+   + +    ++PA+ L K+  +S NFG   FK
Sbjct: 124 LPEDTISGRGSSEIIFYKNGVNQGVAY---KDIFEGVYFPAISLYKSCTVSINFGP-CFK 179

Query: 248 HEPP-KDYIAVCNAPKQNVKHSESADV 273
           + P    Y  + +     V     ADV
Sbjct: 180 YPPKDLTYRPMSDMGWGAVVEHTLADV 206


>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2yyo_A SPRY domain-containing protein 3; NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} Length = 171 Back     alignment and structure
>3emw_A SPRY domain-containing SOCS box protein 2; apoptosis nucleus, apoptosis, UBL conjugation pathwayc, CL transcription regulation, transcription, phosphoprotein; 1.80A {Homo sapiens} PDB: 3ek9_A Length = 217 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>2afj_A Gene rich cluster, C9 gene; beta sandwich, gene regulation; NMR {Mus musculus} SCOP: b.29.1.22 Length = 226 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>2jk9_A SPRY domain-containing SOCS box protein 1; transcription regulation, transcription; 1.79A {Homo sapiens} PDB: 3f2o_A 2fnj_A 2v24_A 2ihs_A Length = 212 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query651
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 100.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 100.0
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.98
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.97
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.97
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.97
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.97
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.97
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.97
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.97
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.97
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.96
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.96
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.96
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.96
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.95
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.95
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.95
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.94
3toj_A213 SET1/ASH2 histone methyltransferase complex subun; 99.93
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.93
2yyo_A171 SPRY domain-containing protein 3; NPPSFA, national 99.92
3h1t_A590 Type I site-specific restriction-modification syst 99.92
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.87
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.86
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.86
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.86
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.82
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.81
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.79
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.78
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.69
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.65
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.64
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.63
2jk9_A212 SPRY domain-containing SOCS box protein 1; transcr 99.59
3emw_A217 SPRY domain-containing SOCS box protein 2; apoptos 99.54
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.53
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.53
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.53
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.53
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.53
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.52
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.51
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.5
2afj_A226 Gene rich cluster, C9 gene; beta sandwich, gene re 99.49
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.45
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.45
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.38
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 98.98
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.09
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.73
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 98.17
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.81
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 96.78
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 96.72
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 96.71
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.6
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 96.46
2vok_A188 52 kDa RO protein; polymorphism, immune system, me 94.78
3uv9_A186 TRIM5alpha, tripartite motif-containing protein 5; 93.99
2wl1_A191 Pyrin, marenostrin; amyloidosis, polymorphism, cyt 93.8
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 93.72
2fbe_A201 Predicted: similar to RET finger protein-like 1; d 92.95
3kb5_A193 Tripartite motif-containing protein 72; B30.2, gus 92.82
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 92.33
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 92.21
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 91.69
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 91.68
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 90.95
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 89.62
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 89.59
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 89.5
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 89.15
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 88.25
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 87.66
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 87.29
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 86.11
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 85.9
3bos_A242 Putative DNA replication factor; P-loop containing 84.62
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 83.67
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 83.66
2kjq_A149 DNAA-related protein; solution structure, NESG, st 83.46
2chg_A226 Replication factor C small subunit; DNA-binding pr 83.07
2v1u_A387 Cell division control protein 6 homolog; DNA repli 82.19
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 81.5
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 81.36
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 81.29
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 80.76
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 80.32
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 80.29
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 80.28
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 80.23
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=1.6e-52  Score=461.21  Aligned_cols=302  Identities=29%  Similarity=0.470  Sum_probs=261.3

Q ss_pred             CcccccCCCCHHHHHHHHHcCCCCCcHHHHhhHHhHhcCCceEeeecCCCCccceeehhhHHHHHHHHHHhhhcCCCCCC
Q psy8712           1 MAAFEEMGVLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIIQIVCETLKEIQAGKGQGKA   80 (651)
Q Consensus         1 ~~~f~~l~l~~~l~~~l~~~~~~~pt~iQ~~aip~il~g~dvl~~a~TGsGKT~af~lp~l~~~~~~~~~~~~~~~~~~~   80 (651)
                      +.+|++++|+++++++|.++||..|||+|++|||.++.|+|++++||||||||+||++|+++.+.+..        .   
T Consensus        55 ~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~--------~---  123 (434)
T 2db3_A           55 IQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDP--------H---  123 (434)
T ss_dssp             CCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSC--------C---
T ss_pred             cCChhhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhcc--------c---
Confidence            35799999999999999999999999999999999999999999999999999999999999887610        0   


Q ss_pred             ccccccCceeeeccccccccccCCCCcccccccccccccccccccccCCceeEEEEEeccCCceeeccccccccccCCCC
Q psy8712          81 KAQVISPTWILSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTDEGLCRVGWSTSQAVRDLGTD  160 (651)
Q Consensus        81 ~~~~~~p~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~g~~  160 (651)
                                                                                                      
T Consensus       124 --------------------------------------------------------------------------------  123 (434)
T 2db3_A          124 --------------------------------------------------------------------------------  123 (434)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCCcCCCCccCCCcccCccCcccCCCcccccccccCCceeeeeccCcccccccccchhhhhccCcchhhccccccccc
Q psy8712         161 RFGFGFGGTGKKSNNKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSFN  240 (651)
Q Consensus       161 ~~~~~~gg~~~ks~~~~~~~~g~~~~~~d~ig~~~~~~~~~~~~~~ng~~~g~af~~~~~~~~~~~~p~~~~k~~~~~~~  240 (651)
                                                                                                      
T Consensus       124 --------------------------------------------------------------------------------  123 (434)
T 2db3_A          124 --------------------------------------------------------------------------------  123 (434)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cCCCCCCCCCCCCeEEEecCCCCceeeeeccccccCCccccCCCCeEEEEeCCHHHHHHHHHHHHHhhccCCCCCeeEEE
Q psy8712         241 FGATPFKHEPPKDYIAVCNAPKQNVKHSESADVSAGPVKLVNNAPQAIIIEPSRELAEQTFNQIIKFKKFITDPKIRELL  320 (651)
Q Consensus       241 f~~~~~~~~~~~~~i~~~~~gsGKT~~~~~a~~~~~~~~~~~~~p~aLIL~PTreLa~Qi~~~~~~l~~~~~~~~i~v~~  320 (651)
                                                            .....+|++|||+||||||.|+++.++++.....   +++.+
T Consensus       124 --------------------------------------~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~---~~~~~  162 (434)
T 2db3_A          124 --------------------------------------ELELGRPQVVIVSPTRELAIQIFNEARKFAFESY---LKIGI  162 (434)
T ss_dssp             --------------------------------------CCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSS---CCCCE
T ss_pred             --------------------------------------ccccCCccEEEEecCHHHHHHHHHHHHHHhccCC---cEEEE
Confidence                                                  0012357899999999999999999999987654   88899


Q ss_pred             EeCCccHHHHHHHhccCCcEEEECchhhHHHHhCCCcccCCcceEeeccchhhhhccchHHHHHHHhcCCCccCCCCcee
Q psy8712         321 IIGGVNVKDQMSVLSSGVDIVVGTPGRMEDLISGGHLSLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKRLQ  400 (651)
Q Consensus       321 l~Gg~~~~~q~~~L~~~~dIlV~TP~rL~~ll~~~~l~l~~l~~lViDEaD~ll~~gf~~~i~~il~~lp~~~~~~~~~Q  400 (651)
                      ++||.....+...+.++++|+|+||++|.+++.++.+.++++++|||||||+|++++|.+++..++..+...    .+.|
T Consensus       163 ~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~----~~~q  238 (434)
T 2db3_A          163 VYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMR----PEHQ  238 (434)
T ss_dssp             ECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTSCCCTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSC----SSCE
T ss_pred             EECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCCcccccCCeEEEccHhhhhccCcHHHHHHHHHhcCCC----CCce
Confidence            999999999988899999999999999999999998999999999999999999999999999999886321    1589


Q ss_pred             EEEEeeccChHHHHHHHHHhccCCeEEEccCCCCccCceEEEEEEeCcchHH--------------------------HH
Q psy8712         401 MIVCSATLHDFDVKKMAERLMYFPTWVDLKGEDAVPETVHHVVVKIDPQQDE--------------------------TW  454 (651)
Q Consensus       401 ~l~~SATl~~~~v~~l~~~~l~~p~~i~~~~~~~~~~~i~~~~~~~~~~~~~--------------------------~~  454 (651)
                      +++||||+++ .+..++..++.++..+.+.........+.+.+..++...+.                          ..
T Consensus       239 ~l~~SAT~~~-~~~~~~~~~l~~~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~~l~~~~~~~lVF~~t~~~a~~l~  317 (434)
T 2db3_A          239 TLMFSATFPE-EIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFLA  317 (434)
T ss_dssp             EEEEESCCCH-HHHHHHHTTCSSCEEEEESSTTCCCTTEEEEEEECCGGGHHHHHHHHHHHCCTTEEEECSSHHHHHHHH
T ss_pred             EEEEeccCCH-HHHHHHHHhccCCEEEEeccccccccccceEEEEeCcHHHHHHHHHHHHhCCCCEEEEEeCcHHHHHHH
Confidence            9999999997 99999999999999988887776777777766665443210                          01


Q ss_pred             HHH-------------------------hhccccceeeccccccCCCCCCCCCEEEEeCCCCChhhhhhhcCccccCCCc
Q psy8712         455 GRL-------------------------RSHIQTDGVHARDNARPGIDISGLPFIINMTLPDDKANYVHRIGRVGRAERM  509 (651)
Q Consensus       455 ~~l-------------------------~~~~~~~~l~~td~~~rGIDip~v~~VIn~dlP~s~~~YihRiGR~GR~g~~  509 (651)
                      ..+                         ++..+..++++|+.+++|||+|+|++|||||+|.+.++|+||+|||||+|+.
T Consensus       318 ~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g~~  397 (434)
T 2db3_A          318 SFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNN  397 (434)
T ss_dssp             HHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTTCC
T ss_pred             HHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCCcccCCEEEEECCCCCHHHHHHHhcccccCCCC
Confidence            111                         2333556788999999999999999999999999999999999999999999


Q ss_pred             eEEEEeeeCC
Q psy8712         510 GLAISLVSTV  519 (651)
Q Consensus       510 G~ai~lv~~~  519 (651)
                      |.|++|++++
T Consensus       398 G~a~~~~~~~  407 (434)
T 2db3_A          398 GRATSFFDPE  407 (434)
T ss_dssp             EEEEEEECTT
T ss_pred             CEEEEEEecc
Confidence            9999999863



>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3toj_A SET1/ASH2 histone methyltransferase complex subun; transcription, SPRY domain, prote binding, histone methylation, RBBP5, DPY-30, nuclear; 2.07A {Homo sapiens} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2yyo_A SPRY domain-containing protein 3; NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2jk9_A SPRY domain-containing SOCS box protein 1; transcription regulation, transcription; 1.79A {Homo sapiens} PDB: 3f2o_A 2fnj_A 2v24_A 2ihs_A Back     alignment and structure
>3emw_A SPRY domain-containing SOCS box protein 2; apoptosis nucleus, apoptosis, UBL conjugation pathwayc, CL transcription regulation, transcription, phosphoprotein; 1.80A {Homo sapiens} PDB: 3ek9_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2afj_A Gene rich cluster, C9 gene; beta sandwich, gene regulation; NMR {Mus musculus} SCOP: b.29.1.22 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2vok_A 52 kDa RO protein; polymorphism, immune system, metal-binding, tripartite motif (TRIM) protein, SPRY systemic lupus erythematosus, zinc, B30.2; 1.30A {Mus musculus} PDB: 2vol_B* 2iwg_B* Back     alignment and structure
>3uv9_A TRIM5alpha, tripartite motif-containing protein 5; domain SWAP, antiretroviral, HIV capsid, ligase; 1.55A {Macaca mulatta} Back     alignment and structure
>2wl1_A Pyrin, marenostrin; amyloidosis, polymorphism, cytoskeleton, actin-binding inflammatory response, metal-binding, signaling protein; 1.35A {Homo sapiens} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2fbe_A Predicted: similar to RET finger protein-like 1; dimer, jellyroll beta-sandwich fold, unknown function; 2.52A {Homo sapiens} SCOP: b.29.1.22 Back     alignment and structure
>3kb5_A Tripartite motif-containing protein 72; B30.2, gustavus, SPRY, TRIM21, TRIM72, PRY, high resolution, Mg53; 1.50A {Homo sapiens} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 651
d2fnja1217 b.29.1.22 (A:35-251) LD34464p {Fruit fly (Drosophi 3e-25
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 7e-25
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 1e-08
d2afja1213 b.29.1.22 (A:12-224) SPRY domain-containing SOCS b 2e-23
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-15
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-11
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 1e-14
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 1e-10
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 2e-14
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 6e-11
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 8e-14
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 1e-12
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 9e-14
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-11
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 4e-11
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 3e-10
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 1e-10
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 6e-09
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 4e-10
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 2e-09
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 5e-10
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 3e-05
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 8e-10
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 0.001
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 4e-08
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 4e-04
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 1e-07
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 2e-07
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 4e-07
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 1e-04
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 1e-04
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-04
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 4e-04
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 0.001
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 0.003
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 0.004
>d2fnja1 b.29.1.22 (A:35-251) LD34464p {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 217 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: SPRY domain
domain: LD34464p
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
 Score =  102 bits (254), Expect = 3e-25
 Identities = 33/187 (17%), Positives = 59/187 (31%), Gaps = 28/187 (14%)

Query: 89  WILSVWDRDTAMAITPEGLRCQSRE--QKEWHGCRANKGVYGRGKYYYEATVTDEGL--- 143
              +  DR   + +  +      R    +     R   G+  +G + +E           
Sbjct: 24  HSWNSEDRSLNIFVKEDDKLTFHRHPVAQSTDCIRGKVGL-TKGLHIWEIYWPTRQRGTH 82

Query: 144 CRVGWSTSQAVRD-------LGTDRFG----------FGFGGTGKKSNNKQFDNYGEAFG 186
             VG  T+ A          +G+              +                  EAF 
Sbjct: 83  AVVGVCTADAPLHSVGYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFL 142

Query: 187 MHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAV--VLKNAEMSFNFGAT 244
           + D     LD+D  T++F  + Q+LG+AF   + L+    YP V  V  + E++  +   
Sbjct: 143 VPDKFLVALDMDEGTLSFIVDQQYLGIAF---RGLRGKKLYPIVSAVWGHCEITMRYIGG 199

Query: 245 PFKHEPP 251
                 P
Sbjct: 200 LDPEPLP 206


>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d2afja1 b.29.1.22 (A:12-224) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 213 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query651
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.94
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.93
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.92
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.92
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.84
d2afja1213 SPRY domain-containing SOCS box protein 2 {Mouse ( 99.76
d2fnja1217 LD34464p {Fruit fly (Drosophila melanogaster) [Tax 99.75
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.74
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.73
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.68
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.68
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.65
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.59
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.57
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.55
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.54
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.49
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.49
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.47
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.4
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.25
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.2
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.19
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.1
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.06
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 98.8
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.65
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 98.6
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 98.53
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.38
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.13
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.05
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.03
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 97.83
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 97.45
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 97.19
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.59
d2iwgb1179 52 kDa Ro protein {Human (Homo sapiens) [TaxId: 96 95.65
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.2
d2fbea1188 Similar to Ret finger protein-like 1 {Human (Homo 94.82
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 94.73
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 94.65
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 94.49
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 94.35
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 93.52
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 92.89
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 92.84
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 92.41
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 90.73
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 89.04
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 88.57
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 88.57
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 87.4
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 86.59
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 86.03
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 85.5
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 85.3
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 85.2
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 84.33
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 84.08
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 84.07
d2qy9a2211 GTPase domain of the signal recognition particle r 83.64
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 83.14
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 81.35
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 80.91
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 80.77
d1vmaa2213 GTPase domain of the signal recognition particle r 80.61
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 80.3
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=8.8e-46  Score=368.02  Aligned_cols=205  Identities=30%  Similarity=0.527  Sum_probs=191.7

Q ss_pred             cccccCCCCHHHHHHHHHcCCCCCcHHHHhhHHhHhcCCceEeeecCCCCccceeehhhHHHHHHHHHHhhhcCCCCCCc
Q psy8712           2 AAFEEMGVLPEIGKAVEEMDWLLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIIQIVCETLKEIQAGKGQGKAK   81 (651)
Q Consensus         2 ~~f~~l~l~~~l~~~l~~~~~~~pt~iQ~~aip~il~g~dvl~~a~TGsGKT~af~lp~l~~~~~~~~~~~~~~~~~~~~   81 (651)
                      .+|++|||+|+|+++|.++||..|||||++|||.++.|+||+++||||||||+||++|+++.+..               
T Consensus        17 ~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~---------------   81 (222)
T d2j0sa1          17 PTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDI---------------   81 (222)
T ss_dssp             CSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCT---------------
T ss_pred             CCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccc---------------
Confidence            47999999999999999999999999999999999999999999999999999999999984421               


Q ss_pred             cccccCceeeeccccccccccCCCCcccccccccccccccccccccCCceeEEEEEeccCCceeeccccccccccCCCCC
Q psy8712          82 AQVISPTWILSVWDRDTAMAITPEGLRCQSREQKEWHGCRANKGVYGRGKYYYEATVTDEGLCRVGWSTSQAVRDLGTDR  161 (651)
Q Consensus        82 ~~~~~p~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~g~~~  161 (651)
                                                                                                      
T Consensus        82 --------------------------------------------------------------------------------   81 (222)
T d2j0sa1          82 --------------------------------------------------------------------------------   81 (222)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCcCCCCccCCCcccCccCcccCCCcccccccccCCceeeeeccCcccccccccchhhhhccCcchhhcccccccccc
Q psy8712         162 FGFGFGGTGKKSNNKQFDNYGEAFGMHDVIGCLLDLDNMTVAFTKNGQHLGLAFNISQQLKNSAFYPAVVLKNAEMSFNF  241 (651)
Q Consensus       162 ~~~~~gg~~~ks~~~~~~~~g~~~~~~d~ig~~~~~~~~~~~~~~ng~~~g~af~~~~~~~~~~~~p~~~~k~~~~~~~f  241 (651)
                                                                                                      
T Consensus        82 --------------------------------------------------------------------------------   81 (222)
T d2j0sa1          82 --------------------------------------------------------------------------------   81 (222)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCCCCCCCCCeEEEecCCCCceeeeeccccccCCccccCCCCeEEEEeCCHHHHHHHHHHHHHhhccCCCCCeeEEEE
Q psy8712         242 GATPFKHEPPKDYIAVCNAPKQNVKHSESADVSAGPVKLVNNAPQAIIIEPSRELAEQTFNQIIKFKKFITDPKIRELLI  321 (651)
Q Consensus       242 ~~~~~~~~~~~~~i~~~~~gsGKT~~~~~a~~~~~~~~~~~~~p~aLIL~PTreLa~Qi~~~~~~l~~~~~~~~i~v~~l  321 (651)
                                                             ....|++||++||||||.|+++.++.++++..   +++.++
T Consensus        82 ---------------------------------------~~~~~~~lil~PtreLa~Qi~~~~~~l~~~~~---i~~~~~  119 (222)
T d2j0sa1          82 ---------------------------------------QVRETQALILAPTRELAVQIQKGLLALGDYMN---VQCHAC  119 (222)
T ss_dssp             ---------------------------------------TSCSCCEEEECSSHHHHHHHHHHHHHHTTTTT---CCEEEE
T ss_pred             ---------------------------------------cccCceeEEecchHHHHHHHHHHHHHHhCccc---eeEEEE
Confidence                                                   12346899999999999999999999998765   999999


Q ss_pred             eCCccHHHHHHHhccCCcEEEECchhhHHHHhCCCcccCCcceEeeccchhhhhccchHHHHHHHhcCCCccCCCCceeE
Q psy8712         322 IGGVNVKDQMSVLSSGVDIVVGTPGRMEDLISGGHLSLTHCRFFVLDEADGLLKQGYGNLIDRMHKQIPKITSDGKRLQM  401 (651)
Q Consensus       322 ~Gg~~~~~q~~~L~~~~dIlV~TP~rL~~ll~~~~l~l~~l~~lViDEaD~ll~~gf~~~i~~il~~lp~~~~~~~~~Q~  401 (651)
                      +||.....+...++.++||||+||+|+.+++.++.+.++++++||+||||+|++.+|.+++..|++.+|+      ++|+
T Consensus       120 ~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~l~~lVlDEaD~ll~~~f~~~i~~I~~~l~~------~~Q~  193 (222)
T d2j0sa1         120 IGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPP------ATQV  193 (222)
T ss_dssp             CTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTTCCEEEEETHHHHTSTTTHHHHHHHHTTSCT------TCEE
T ss_pred             eecccchhhHHHhccCCeEEeCCCCcHHhcccccccccccceeeeecchhHhhhcCcHHHHHHHHHhCCC------CCEE
Confidence            9999999999999999999999999999999999999999999999999999999999999999999988      6899


Q ss_pred             EEEeeccChHHHHHHHHHhccCCeEEEcc
Q psy8712         402 IVCSATLHDFDVKKMAERLMYFPTWVDLK  430 (651)
Q Consensus       402 l~~SATl~~~~v~~l~~~~l~~p~~i~~~  430 (651)
                      ++||||+++ ++.+++++++++|..|.+.
T Consensus       194 ilfSAT~~~-~v~~l~~~~l~~Pv~I~V~  221 (222)
T d2j0sa1         194 VLISATLPH-EILEMTNKFMTDPIRILVK  221 (222)
T ss_dssp             EEEESCCCH-HHHTTGGGTCSSCEEECCC
T ss_pred             EEEEEeCCH-HHHHHHHHHCCCCEEEEEe
Confidence            999999997 8999999999999988765



>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2afja1 b.29.1.22 (A:12-224) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnja1 b.29.1.22 (A:35-251) LD34464p {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iwgb1 b.29.1.22 (B:4-182) 52 kDa Ro protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2fbea1 b.29.1.22 (A:1-188) Similar to Ret finger protein-like 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure