Psyllid ID: psy8763


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-
MGLLSVQSDNKNKSRLIPSSSGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVSEQPECDWIMVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFDAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTNGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTVKKLLSSERGSFIINESDGEGLTPLHIASKEGFHYSVSIFQVTYVWCSYC
ccHHHHHccccHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccHHHHccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHHccHHHHHHHHHcccccccc
cHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccccEccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccHHHccccccccccHHHHHHHcccHHHHHHHHHcccccccc
mgllsvqsdnknksrlipsssgvntrilNNKKQAVLHLATELNKVPILLILLQYKDMIDIlqggehgrTALHIAAIYDFDECARILVseqpecdwimVKDFGASLkracsngyypihdaaknasSKTMEVFLQFGESIGCSREEMISLFDaegnlplhsavhggdFKAVELCLKSGakistqqfdlstpvhlaCSQGALDIVRLMFnlqpseklvclnstdaqkmtplhcaamfdRCDVVQYLIDegadlnvldkekrsplllaasrggwktngvntriLNNKKQAVLHLATELNKVPILLILLQYKDMIDIlqggehgrTALHIAAIYDFDECARILVKDFGASLKracsngyypihdaaknasSKTMEVFLQFGESIGCSREEMISLFAAegnlplhsavhggdFKAVELCLKSGakistqqfdlstpvhlaCSQGALDIVRLMFnlqpseklvclnstdaqkmtplhcaamfdRCDVVQYLIDegadlnvldkekrsplllaasrgGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINlgacinlknnsnesplhLAARYGRYNTVKKLLSSergsfiinesdgegltplhiaskegfhYSVSIFQVTYVWCSYC
mgllsvqsdnknksrlipsssgvntrILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVSEQPECDWIMVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFDAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEgadlnvldkekRSPLLlaasrggwktngvnTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEgadlnvldkEKRSPLllaasrggwktvLTLVRNKANillkdinrrnILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTVKKLLSSERGSFIINESDGEGLTPLHIASKEGFHYSVSIFQVTYVWCSYC
MGLLSVQSDNKNKSRLIPSSSGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVSEQPECDWIMVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFDAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTNGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTVKKLLSSERGSFIINESDGEGLTPLHIASKEGFHYSVSIFQVTYVWCSYC
*************************RILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVSEQPECDWIMVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFDAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTNGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTVKKLLSSERGSFIINESDGEGLTPLHIASKEGFHYSVSIFQVTYVWCSY*
MGLLSVQSDNKNKSRLIPSSSGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVSEQPECDWIMVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFDAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTNGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTVKKLLSSERGSFIINESDGEGLTPLHIASKEGFHYSVSIFQVTYVWCSYC
MGLLSVQSDNKNKSRLIPSSSGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVSEQPECDWIMVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFDAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTNGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTVKKLLSSERGSFIINESDGEGLTPLHIASKEGFHYSVSIFQVTYVWCSYC
MGLLSVQSDNKNKSRLIPSSSGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVSEQPECDWIMVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFDAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTNGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTVKKLLSSERGSFIINESDGEGLTPLHIASKEGFHYSVSIFQVTYVWC**C
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLLSVQSDNKNKSRLIPSSSGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVSEQPECDWIMVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFDAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTNGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTVKKLLSSERGSFIINESDGEGLTPLHIASKEGFHYSVSIFQVTYVWCSYC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query641 2.2.26 [Sep-21-2011]
Q7Z020 1296 Transient receptor potent yes N/A 0.719 0.355 0.539 1e-148
Q8BLA8 1125 Transient receptor potent yes N/A 0.698 0.398 0.323 7e-59
Q6RI86 1125 Transient receptor potent yes N/A 0.698 0.398 0.315 2e-56
O75762 1119 Transient receptor potent yes N/A 0.624 0.357 0.325 2e-54
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.892 0.291 0.260 6e-41
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.881 0.300 0.255 2e-39
Q02357 1862 Ankyrin-1 OS=Mus musculus no N/A 0.858 0.295 0.264 9e-38
Q12955 4377 Ankyrin-3 OS=Homo sapiens no N/A 0.890 0.130 0.258 9e-38
Q502K3 1071 Serine/threonine-protein no N/A 0.736 0.440 0.267 7e-33
Q5ZLC81073 Serine/threonine-protein no N/A 0.783 0.467 0.278 1e-32
>sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=3 Back     alignment and function desciption
 Score =  526 bits (1356), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 283/525 (53%), Positives = 353/525 (67%), Gaps = 64/525 (12%)

Query: 139 GCSRE-EMISLFDAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPV--HL-AC 194
           GC+RE EM ++  A  NLP                 K  A+I         P+  +L A 
Sbjct: 123 GCAREPEMTAM--APLNLP-----------------KKWARILRMSSTPKIPIVDYLEAA 163

Query: 195 SQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLD 254
             G LD  + +F    S     +   DA+  T  H AA  +R ++++Y+ D+  D N  D
Sbjct: 164 ESGNLDDFKRLFMADNSR----IALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKD 219

Query: 255 KEKRSPLLLAASRGGWK------TNGVNTRILNNKKQAVLHLATELNKVPILLILLQYKD 308
               +PL +A     +       +  V+T +LN KKQA +HLATELNKV  L ++ QY++
Sbjct: 220 NAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRN 279

Query: 309 MIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKT 368
           +IDI QGGEHGRTALH+AAIYD +ECARIL+ +F A  ++ C+NGYYPIH+AAKNASSKT
Sbjct: 280 VIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKT 339

Query: 369 MEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLS 428
           MEVF Q+GE  GC+REEMIS + +EGN+PLHSAVHGGD KAVELCLKSGAKISTQQ DLS
Sbjct: 340 MEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLS 399

Query: 429 TPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEG 488
           TPVHLAC+QGA+DIV+LMF +QP EK +CL+ TD QKMTPLHCA+MFD  D+V YL+ EG
Sbjct: 400 TPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEG 459

Query: 489 ADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKE 548
           AD+N LDKE RSPLLLAASR GWKTV  L+R  A I +KD   RN+LH +++N GG + +
Sbjct: 460 ADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMN-GGRLTD 518

Query: 549 FAEEVA--------AVFLG----------------------ENLINLGACINLKNNSNES 578
           FAE+VA         + L                       ENLI LGACINLKNN+NES
Sbjct: 519 FAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNES 578

Query: 579 PLHLAARYGRYNTVKKLLSSERGSFIINESDGEGLTPLHIASKEG 623
           PLH AARYGRYNTV++LL SE+GSFIINESDG G+TPLHI+S++G
Sbjct: 579 PLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQG 623




Essential for thermotaxis by sensing environmental temperature. Receptor-activated non-selective cation channel involved in detection of sensations such as temperature. Involved in heat nociception by being activated by warm temperature of about 24-29 degrees Celsius.
Drosophila melanogaster (taxid: 7227)
>sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 Back     alignment and function description
>sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 Back     alignment and function description
>sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=2 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query641
270004805 1317 hypothetical protein TcasGA2_TC002449 [T 0.658 0.320 0.589 1e-152
242023855 1175 conserved hypothetical protein [Pediculu 0.605 0.330 0.625 1e-149
170032246 1345 conserved hypothetical protein [Culex qu 0.627 0.298 0.601 1e-147
442631143 1197 transient receptor potential A1, isoform 0.719 0.385 0.539 1e-147
358681383 1251 TRPA1(A) isoform [Drosophila melanogaste 0.664 0.340 0.573 1e-147
195428457 1237 GK17464 [Drosophila willistoni] gi|19415 0.627 0.324 0.602 1e-147
442631145 1196 transient receptor potential A1, isoform 0.719 0.385 0.539 1e-147
238054359 1296 RecName: Full=Transient receptor potenti 0.719 0.355 0.539 1e-147
442631139 1232 transient receptor potential A1, isoform 0.664 0.345 0.573 1e-146
442631147 1195 transient receptor potential A1, isoform 0.664 0.356 0.573 1e-146
>gi|270004805|gb|EFA01253.1| hypothetical protein TcasGA2_TC002449 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  544 bits (1401), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 273/463 (58%), Positives = 339/463 (73%), Gaps = 41/463 (8%)

Query: 197 GALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKE 256
           G L+  + ++   P+     L+  D++  T  H AA  +R  ++Q+++ +G DLN  D  
Sbjct: 208 GNLETFQRLYFADPTR----LSIKDSRGRTAAHQAAAKNRITILQFILSQGGDLNNQDNA 263

Query: 257 KRSPLLLAASRGGWKT------NGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMI 310
             +PL +A               GV T ILN+KKQA +HL TELNKV +L ++ ++KD I
Sbjct: 264 GNTPLHVAVEHESLDAVDFLLQAGVKTNILNDKKQAAIHLVTELNKVSVLEVMGKHKDKI 323

Query: 311 DILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTME 370
           DILQGGEHGRTALHIAAIYD +ECARIL+  F A  +R C+NGYYPIH+AAKNASSKT+E
Sbjct: 324 DILQGGEHGRTALHIAAIYDHEECARILISVFDACPRRPCNNGYYPIHEAAKNASSKTLE 383

Query: 371 VFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTP 430
           +FLQ+GES GC+REEMIS + +EGN+PLHSAVHGGD KAVELCL+SGAKISTQQ DLSTP
Sbjct: 384 IFLQWGESRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLRSGAKISTQQHDLSTP 443

Query: 431 VHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGAD 490
           VHLAC+QGA DIV+LMF +QP EKL CL S D QKMTPLHCAAMFD  ++V++LI+EGAD
Sbjct: 444 VHLACAQGATDIVKLMFKMQPEEKLPCLASCDVQKMTPLHCAAMFDHPEIVEFLINEGAD 503

Query: 491 LNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFA 550
           +N +DKEKRSPLLLAA RGGW+TV  L+R  A+I +KD+NRRN+LHL+V+N GG +++FA
Sbjct: 504 INPMDKEKRSPLLLAALRGGWRTVHVLIRLGADINVKDVNRRNVLHLVVMN-GGRLEQFA 562

Query: 551 EEVAA------------------------------VFLGENLINLGACINLKNNSNESPL 580
            EV+                               +   ENLI LGA INLKNN+NESPL
Sbjct: 563 SEVSKAKSQTSLLQLLNEKDINGCSPLHYASREGHIRSLENLIRLGATINLKNNNNESPL 622

Query: 581 HLAARYGRYNTVKKLLSSERGSFIINESDGEGLTPLHIASKEG 623
           H AARYGRYNTV++LL SE+G+FIINESDGEGLTPLHIASK+G
Sbjct: 623 HFAARYGRYNTVRQLLDSEKGTFIINESDGEGLTPLHIASKQG 665




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242023855|ref|XP_002432346.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212517769|gb|EEB19608.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|170032246|ref|XP_001843993.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167872109|gb|EDS35492.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|442631143|ref|NP_648263.5| transient receptor potential A1, isoform I [Drosophila melanogaster] gi|32351041|gb|AAP76197.1| ANKTM1 [Drosophila melanogaster] gi|440215511|gb|AAF50356.5| transient receptor potential A1, isoform I [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|358681383|gb|AEU17952.1| TRPA1(A) isoform [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195428457|ref|XP_002062289.1| GK17464 [Drosophila willistoni] gi|194158374|gb|EDW73275.1| GK17464 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|442631145|ref|NP_001097554.4| transient receptor potential A1, isoform J [Drosophila melanogaster] gi|358681256|gb|AEU17863.1| TRPA1 isoform B [Drosophila melanogaster] gi|440215512|gb|ABW08500.4| transient receptor potential A1, isoform J [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|238054359|sp|Q7Z020.3|TRPA1_DROME RecName: Full=Transient receptor potential cation channel subfamily A member 1; Short=dTRPA1; AltName: Full=Ankyrin-like with transmembrane domains protein 1; Short=dANKTM1 Back     alignment and taxonomy information
>gi|442631139|ref|NP_001261600.1| transient receptor potential A1, isoform G [Drosophila melanogaster] gi|356892152|gb|AET41695.1| TRPA1 isoform D [Drosophila melanogaster] gi|440215509|gb|AGB94295.1| transient receptor potential A1, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442631147|ref|NP_001261602.1| transient receptor potential A1, isoform K [Drosophila melanogaster] gi|440215513|gb|AGB94297.1| transient receptor potential A1, isoform K [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query641
FB|FBgn0035934 1296 TrpA1 "Transient receptor pote 0.663 0.327 0.533 1.5e-115
ZFIN|ZDB-GENE-050105-6 1126 trpa1a "transient receptor pot 0.611 0.348 0.347 1.8e-50
UNIPROTKB|E1C7Y7 1074 TRPA1 "Uncharacterized protein 0.613 0.365 0.338 2.4e-49
UNIPROTKB|E1BZK9 1075 TRPA1 "Uncharacterized protein 0.613 0.365 0.338 2.4e-49
UNIPROTKB|F1Q2M0 1117 TRPA1 "Uncharacterized protein 0.739 0.424 0.298 1.8e-47
UNIPROTKB|O75762 1119 TRPA1 "Transient receptor pote 0.739 0.423 0.306 7.9e-47
RGD|1303284 1125 Trpa1 "transient receptor pote 0.739 0.421 0.298 1.1e-44
UNIPROTKB|G5E522 1126 TRPA1 "Uncharacterized protein 0.736 0.419 0.295 1.8e-44
MGI|MGI:3522699 1125 Trpa1 "transient receptor pote 0.739 0.421 0.296 3.8e-44
UNIPROTKB|H0YAW0 916 TRPA1 "Transient receptor pote 0.692 0.484 0.308 2.9e-43
FB|FBgn0035934 TrpA1 "Transient receptor potential A1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1139 (406.0 bits), Expect = 1.5e-115, P = 1.5e-115
 Identities = 236/442 (53%), Positives = 305/442 (69%)

Query:   193 ACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNV 252
             A   G LD  + +F    S   + L   DA+  T  H AA  +R ++++Y+ D+  D N 
Sbjct:   162 AAESGNLDDFKRLFMADNSR--IALK--DAKGRTAAHQAAARNRVNILRYIRDQNGDFNA 217

Query:   253 LDKEKRSPLLLAASRGGWKTNG------VNTRILNNKKQAVLHLATELNKVPILLILLQY 306
              D    +PL +A     +          V+T +LN KKQA +HLATELNKV  L ++ QY
Sbjct:   218 KDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQY 277

Query:   307 KDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASS 366
             +++IDI QGGEHGRTALH+AAIYD +ECARIL+ +F A  ++ C+NGYYPIH+AAKNASS
Sbjct:   278 RNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASS 337

Query:   367 KTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFD 426
             KTMEVF Q+GE  GC+REEMIS + +EGN+PLHSAVHGGD KAVELCLKSGAKISTQQ D
Sbjct:   338 KTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHD 397

Query:   427 LSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLID 486
             LSTPVHLAC+QGA+DIV+LMF +QP EK +CL+ TD QKMTPLHCA+MFD  D+V YL+ 
Sbjct:   398 LSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVA 457

Query:   487 EGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHI 546
             EGAD+N LDKE RSPLLLAASR GWKTV  L+R  A I +KD   RN+LH +++NGG  +
Sbjct:   458 EGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGG-RL 516

Query:   547 KEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTVKKLLSSERGSFIIN 606
              +FAE+VA     +    L   +N K++   SPLH A+R G   +++ L+   R    IN
Sbjct:   517 TDFAEQVANC---QTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLI---RLGACIN 570

Query:   607 ESDGEGLTPLHIASKEGFHYSV 628
               +    +PLH A++ G + +V
Sbjct:   571 LKNNNNESPLHFAARYGRYNTV 592


GO:0006816 "calcium ion transport" evidence=ISS
GO:0005262 "calcium channel activity" evidence=ISS
GO:0009266 "response to temperature stimulus" evidence=NAS
GO:0005216 "ion channel activity" evidence=IEA
GO:0006811 "ion transport" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0043052 "thermotaxis" evidence=IDA;IMP
GO:0009408 "response to heat" evidence=IMP
GO:0034605 "cellular response to heat" evidence=IDA
GO:0042745 "circadian sleep/wake cycle" evidence=IMP
GO:0007613 "memory" evidence=IMP
GO:0033038 "bitter taste receptor activity" evidence=IDA
GO:0001580 "detection of chemical stimulus involved in sensory perception of bitter taste" evidence=IMP
GO:0040040 "thermosensory behavior" evidence=IMP
GO:0007638 "mechanosensory behavior" evidence=IMP
ZFIN|ZDB-GENE-050105-6 trpa1a "transient receptor potential cation channel, subfamily A, member 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7Y7 TRPA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZK9 TRPA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2M0 TRPA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O75762 TRPA1 "Transient receptor potential cation channel subfamily A member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1303284 Trpa1 "transient receptor potential cation channel, subfamily A, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G5E522 TRPA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:3522699 Trpa1 "transient receptor potential cation channel, subfamily A, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|H0YAW0 TRPA1 "Transient receptor potential cation channel subfamily A member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7Z020TRPA1_DROMENo assigned EC number0.53900.71910.3557yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-24
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-24
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-24
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-21
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 8e-20
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-19
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-17
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-15
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-14
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-14
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-11
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-11
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 8e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-10
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-10
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-10
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-08
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-08
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-08
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 7e-08
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 7e-08
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 8e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 8e-08
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-07
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-07
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-06
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-06
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-06
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-05
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-05
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 7e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 8e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 9e-05
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 2e-04
smart0024830 smart00248, ANK, ankyrin repeats 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.003
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.004
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.004
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 98.2 bits (245), Expect = 2e-24
 Identities = 47/138 (34%), Positives = 69/138 (50%), Gaps = 12/138 (8%)

Query: 459 NSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTVLTLV 518
           N+ D    TPLH AA     +VV+ L++ GAD+N  D + R+PL LAA  G  + V  L+
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLL 60

Query: 519 RNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNES 578
              A++  +D +    LHL   NG   + +             L+  GA +N ++    +
Sbjct: 61  EKGADVNARDKDGNTPLHLAARNGNLDVVKL------------LLKHGADVNARDKDGRT 108

Query: 579 PLHLAARYGRYNTVKKLL 596
           PLHLAA+ G    VK LL
Sbjct: 109 PLHLAAKNGHLEVVKLLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 641
KOG4177|consensus 1143 100.0
KOG4177|consensus 1143 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG0510|consensus 929 100.0
KOG0510|consensus 929 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
KOG4369|consensus 2131 100.0
KOG0509|consensus 600 100.0
KOG0509|consensus600 100.0
PHA02859209 ankyrin repeat protein; Provisional 99.97
PHA02795 437 ankyrin-like protein; Provisional 99.97
PHA02795437 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
KOG0502|consensus296 99.96
KOG4369|consensus 2131 99.96
KOG0502|consensus296 99.95
KOG0507|consensus 854 99.93
KOG0507|consensus 854 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
KOG0514|consensus452 99.91
KOG0505|consensus527 99.91
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
KOG0514|consensus452 99.89
PHA02884 300 ankyrin repeat protein; Provisional 99.89
KOG0505|consensus 527 99.88
PHA02741169 hypothetical protein; Provisional 99.88
KOG0512|consensus228 99.87
KOG0512|consensus228 99.87
PHA02741169 hypothetical protein; Provisional 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.86
PHA02884300 ankyrin repeat protein; Provisional 99.86
PHA02736154 Viral ankyrin protein; Provisional 99.85
KOG0195|consensus448 99.82
KOG3676|consensus 782 99.82
KOG0195|consensus 448 99.81
KOG3676|consensus782 99.78
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.75
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.74
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.73
KOG4214|consensus117 99.7
KOG4214|consensus117 99.67
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.56
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.55
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.51
KOG1710|consensus 396 99.51
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.5
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.46
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.46
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.44
KOG1710|consensus396 99.43
KOG0515|consensus752 99.42
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.42
KOG0515|consensus752 99.39
KOG0783|consensus 1267 98.86
KOG0783|consensus 1267 98.84
KOG0506|consensus622 98.8
PF1360630 Ank_3: Ankyrin repeat 98.8
KOG0506|consensus622 98.79
PF1360630 Ank_3: Ankyrin repeat 98.79
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.7
KOG0522|consensus560 98.69
KOG0782|consensus1004 98.69
KOG0818|consensus 669 98.66
KOG0782|consensus1004 98.66
KOG0818|consensus669 98.65
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.64
KOG0705|consensus749 98.59
KOG3609|consensus 822 98.53
KOG0705|consensus749 98.49
KOG3609|consensus 822 98.47
KOG2384|consensus223 98.34
KOG0521|consensus785 98.31
KOG2384|consensus223 98.3
KOG0522|consensus 560 98.27
KOG0521|consensus785 98.2
KOG0511|consensus 516 98.14
KOG0511|consensus516 98.09
KOG0520|consensus 975 97.94
KOG0520|consensus 975 97.83
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 97.36
KOG2505|consensus591 97.04
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.93
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.82
KOG2505|consensus591 96.79
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.73
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.2
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.02
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.23
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 92.64
PLN032181060 maturation of RBCL 1; Provisional 91.6
PLN032181060 maturation of RBCL 1; Provisional 82.75
>KOG4177|consensus Back     alignment and domain information
Probab=100.00  E-value=4.6e-67  Score=530.42  Aligned_cols=572  Identities=30%  Similarity=0.435  Sum_probs=485.6

Q ss_pred             ccccccCCCceeeeccCCCcccccccCCCcchhhHHHhcCCHHHHHHHHhcCCccccccCCCCCchHHHHHHHcCCHHHH
Q psy8763           4 LSVQSDNKNKSRLIPSSSGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECA   83 (641)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~L~~A~~~g~~~~v~~ll~~g~~~~~~~~~~~g~t~L~~A~~~g~~~iv   83 (641)
                      .|..+|+.+....++. ...+.+.....+.||+|+|+-+|+.++.++|++.|+  .++....+|.||||.|++.|+.+++
T Consensus        27 ~a~r~~~~~~~~~l~~-~e~~~~~~sk~~~~pl~~aa~~~~~~v~~~ll~~~a--~v~~~~~~~~~plh~a~~~~~a~~v  103 (1143)
T KOG4177|consen   27 IAARNDDTNAAKLLLQ-NEHNADVDSKSGFTPLHIAAHYGNENVAELLLNRGA--IVNATARNGITPLHVASKRGDAEMV  103 (1143)
T ss_pred             HHHhccchhhcccccc-cccccchhcccccCHHHHHhhhhhhhhhhhhhcccc--ccCcccccCccHHHHHHhhcchhHH
Confidence            4667888888888885 444444455599999999999999999999999998  4556678899999999999999999


Q ss_pred             HHHHhcCCCcchhHhhhcCCCcccCCCCCCcHHHHHHHhCCHHHHHHHHHhcccCCCchhhhhccccCCCChHHHH----
Q psy8763          84 RILVSEQPECDWIMVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFDAEGNLPLHS----  159 (641)
Q Consensus        84 ~~Ll~~~~~~~~~~~~~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~t~L~~----  159 (641)
                      ++|+..            |+.++..+.+|.||||.|+..|+.+++++|+..++++        ++++.+|.||+++    
T Consensus       104 ~~ll~~------------ga~~~~~~~~~lTpLh~aa~~g~~~~~~~ll~~~a~~--------~~k~~~g~t~l~~a~~~  163 (1143)
T KOG4177|consen  104 KLLLCR------------GAQIDARDRDGLTPLHCAARKGHVQVIELLLQHGAPI--------NIKTKNGLSPLHMAAQV  163 (1143)
T ss_pred             HHHHhc------------cCchhhcccCCCcchhhhcccccHHHHHHHHHccCCC--------cccccCCCCchhhhcch
Confidence            999999            9999999999999999999999999999999999887        4456666665544    


Q ss_pred             -------------------HHhCCCHHHHHHHHHcCCCCCcCCCCCCcHHHHHHHcCcHHHHHHHHhcCCCccccccccC
Q psy8763         160 -------------------AVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNST  220 (641)
Q Consensus       160 -------------------A~~~g~~~~v~~Ll~~g~~~~~~~~~~~t~l~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~  220 (641)
                                         |...++.+++++|+...++++..+..+.||+|.||..+..+++++++.++++     +...
T Consensus       164 ~~~~ll~~~~~~d~l~~~~~~~~~~~~~~~ll~~~~~~~~a~~~~~~tpl~~a~~~nri~~~eLll~~gad-----v~a~  238 (1143)
T KOG4177|consen  164 ACARLLLEYKAPDYLRLHVAAHCGHARVAKLLLDKKADPNASALNGFTPLHIACKKNRIKVVELLLKHGAD-----VSAK  238 (1143)
T ss_pred             hhhHHhhhcccchhhhhhHHhhcchHHHHhhhhcccCCccccccCCCCchhhhccccccceeeeeeeccCc-----CCcc
Confidence                               4456667777778888888888888888888888888888888888888888     6888


Q ss_pred             CCCCCcHHHHHHhcCcHHHHHHHHHcCCCCCccCCCCCCHHHHHHHcCCccc------ccccccccccCchhHHHHHHhc
Q psy8763         221 DAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKT------NGVNTRILNNKKQAVLHLATEL  294 (641)
Q Consensus       221 ~~~~~t~L~~A~~~~~~~iv~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~~~------~~~~~~~~~~~~~~~l~~a~~~  294 (641)
                      +..|.||||.|+..|+.+++.+|+.+|+.++..+..+.||+|.++..+..+.      ++.++........++++.+...
T Consensus       239 d~~gl~~lh~a~~~g~~~i~~~l~~~ga~~~~~~vr~~tplh~AA~~~~~e~~~~ll~~ga~~~~~~~~~kt~l~~a~~~  318 (1143)
T KOG4177|consen  239 DESGLTPLHVAAFMGHLDIVKLLLQHGASVNVSTVRGETPLHMAARAGQVEVCKLLLQNGADVLAKARDDQTPLHIASRL  318 (1143)
T ss_pred             cccCccHHHHHHhccchhHHHHHHhcccccCcccccccCcchhhhccchhhhHhhhhccCcccccccccccChhhhhccc
Confidence            8888888988888888888888888888888888888888888888887663      6677778888888888888888


Q ss_pred             CChhHHHHHhhCCCcccccCCCCCcchHHHHHHHhCcHHHHHHHHHhcCccccccccCCCChHHHHHHcCChHHHHHHHh
Q psy8763         295 NKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQ  374 (641)
Q Consensus       295 ~~~~~~~~ll~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~  374 (641)
                      +..+++..+++.+.  .+...+..+.+|+|.++..++.++...+. ..+..-...+..+.+|++.|+..+..+.++.++.
T Consensus       319 g~~~i~~~~l~~~~--~~~aar~~g~t~lHlaa~~~~~~~~~~l~-~~~~~~~~a~~k~~~pl~la~~~g~~~~v~Lll~  395 (1143)
T KOG4177|consen  319 GHEEIVHLLLQAGA--TPNAARTAGYTPLHLAAKEGQVEVAGALL-EHGAQRRQAEEKGFTPLHLAVKSGRVSVVELLLE  395 (1143)
T ss_pred             chHHHHHHHhhccC--CccccCcCCcccccHhhhhhhHHHHHHhh-ccccccCcccccCCcchhhhcccCchhHHHhhhh
Confidence            88888888888887  45566677888999988888888777776 6677777777888889999999999999999988


Q ss_pred             ccccccCChHHHhHHHhhcCChHHHHHHhcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHcC-CHHHHHHHHhcCCCc
Q psy8763         375 FGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQG-ALDIVRLMFNLQPSE  453 (641)
Q Consensus       375 ~~~~~~~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~a~~~~-~~~~v~~ll~~~~~~  453 (641)
                      .|+++        +..+..|.||+|.++..++..+++.+++.|++++..+..|.|++|.|+..+ ..+....+++.    
T Consensus       396 ~ga~~--------~~~gk~gvTplh~aa~~~~~~~v~l~l~~gA~~~~~~~lG~T~lhvaa~~g~~~~~~~~l~~~----  463 (1143)
T KOG4177|consen  396 AGADP--------NSAGKNGVTPLHVAAHYGNPRVVKLLLKRGASPNAKAKLGYTPLHVAAKKGRYLQIARLLLQY----  463 (1143)
T ss_pred             ccCCc--------ccCCCCCcceeeehhhccCcceEEEEeccCCChhhHhhcCCChhhhhhhcccHhhhhhhHhhc----
Confidence            88874        344567888999998888888888888888888888888889999888888 67777777763    


Q ss_pred             cccccccCCCCCCcHHHHHHhcCChhHHHHHHHcCCCCCcCCCCCCCHHHHHHhcCCHHHHHHHHHcCCCccccccCCCc
Q psy8763         454 KLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRN  533 (641)
Q Consensus       454 ~~~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t  533 (641)
                       +.+++.....|.||||.|+..|+.++++.|++.++..+.....+-+++|.|...+...+.+.++++|++++.++..|.|
T Consensus       464 -g~~~n~~s~~G~T~Lhlaaq~Gh~~~~~llle~~~~~~~~~~~~l~~lhla~~~~~v~~~~~l~~~ga~v~~~~~r~~T  542 (1143)
T KOG4177|consen  464 -GADPNAVSKQGFTPLHLAAQEGHTEVVQLLLEGGANDNLDAKKGLTPLHLAADEDTVKVAKILLEHGANVDLRTGRGYT  542 (1143)
T ss_pred             -CCCcchhccccCcchhhhhccCCchHHHHhhhcCCccCccchhccchhhhhhhhhhHHHHHHHhhcCCceehhcccccc
Confidence             4447888888889999999999999999888888888878888888999988888888888899999998888888889


Q ss_pred             hhHHHhhcCCCchhhHHHHHHHHHHHHHHhhcCCcccccCCCCCChHHHHHhcCCHHHHHHHHhcCCCccccccCCCCCC
Q psy8763         534 ILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTVKKLLSSERGSFIINESDGEGL  613 (641)
Q Consensus       534 ~l~~a~~~~~~~~~~~~~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~d~~g~  613 (641)
                      |||.|+..|            ++.+|++|+++|+|++++++.|+||||.|+..|+.+|+.+|+++|++   +|..|.+|.
T Consensus       543 pLh~A~~~g------------~v~~VkfLLe~gAdv~ak~~~G~TPLH~Aa~~G~~~i~~LLlk~GA~---vna~d~~g~  607 (1143)
T KOG4177|consen  543 PLHVAVHYG------------NVDLVKFLLEHGADVNAKDKLGYTPLHQAAQQGHNDIAELLLKHGAS---VNAADLDGF  607 (1143)
T ss_pred             hHHHHHhcC------------CchHHHHhhhCCccccccCCCCCChhhHHHHcChHHHHHHHHHcCCC---CCcccccCc
Confidence            999999888            88889999999999998888899999999999988999999999988   888888999


Q ss_pred             hhHHHHHhhCCcceeeeceee
Q psy8763         614 TPLHIASKEGFHYSVSIFQVT  634 (641)
Q Consensus       614 t~l~~A~~~~~~~~~~~l~~~  634 (641)
                      |||++|...|+.+++++|+..
T Consensus       608 TpL~iA~~lg~~~~~k~l~~~  628 (1143)
T KOG4177|consen  608 TPLHIAVRLGYLSVVKLLKVV  628 (1143)
T ss_pred             chhHHHHHhcccchhhHHHhc
Confidence            999999999998888888765



>KOG4177|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-29
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-24
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-16
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 7e-16
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 9e-13
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-12
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-16
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-15
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-14
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-15
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 7e-15
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-13
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-15
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-14
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-06
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-14
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 5e-14
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 9e-12
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-14
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-13
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-10
2xeh_A157 Structural Determinants For Improved Thermal Stabil 6e-14
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-11
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-13
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-09
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-13
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 9e-11
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-13
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-10
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-13
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-07
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-13
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-11
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-07
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-13
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-12
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-10
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-07
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 9e-13
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-09
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-12
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-07
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-12
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-12
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 5e-07
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-12
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-11
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-08
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 4e-12
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 6e-05
1uoh_A226 Human Gankyrin Length = 226 6e-12
1uoh_A226 Human Gankyrin Length = 226 6e-05
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 6e-12
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-11
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 4e-11
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-07
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-11
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-11
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-07
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-11
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 6e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-11
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 6e-09
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-11
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-11
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-11
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 5e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 4e-11
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 5e-05
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-10
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-07
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-05
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 3e-10
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-05
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 9e-10
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 1e-09
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 9e-08
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 7e-07
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 2e-09
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-09
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-08
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 8e-07
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-09
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 1e-08
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 4e-09
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 4e-09
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 1e-08
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 1e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-09
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-09
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-04
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 5e-09
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 1e-08
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 1e-04
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 5e-09
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 1e-08
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 2e-04
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 5e-09
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 6e-09
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 6e-09
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 6e-09
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 1e-08
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 1e-08
3uxg_A172 Crystal Structure Of Rfxank Length = 172 2e-08
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 2e-08
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 4e-08
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 4e-08
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-04
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 5e-08
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 6e-04
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 5e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 1e-07
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-06
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-04
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-06
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-04
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-07
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-07
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 9e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-07
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-07
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 4e-07
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-07
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-07
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 9e-06
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-07
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-07
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-07
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-06
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-07
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-07
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-05
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 5e-07
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 6e-06
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 6e-07
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 6e-07
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 6e-07
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 9e-07
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 9e-07
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 9e-07
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 5e-04
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-06
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 7e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 4e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 8e-06
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 8e-06
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 8e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 9e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 6e-05
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 9e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-05
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 8e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 9e-06
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 9e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 1e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 7e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 1e-04
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 1e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 1e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 1e-05
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 2e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 3e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 3e-05
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-05
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 4e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 4e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 9e-04
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 1e-04
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 4e-04
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 5e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 9e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 127 bits (319), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 103/374 (27%), Positives = 171/374 (45%), Gaps = 27/374 (7%) Query: 156 PLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLV 215 PLH A G V+ L+ GA + + TP+H+A G ++ + + LQ K+ Sbjct: 17 PLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL--LQNKAKV- 73 Query: 216 CLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKT--- 272 N+ TPLHCAA ++V+ L++ A+ N+ +PL +AA G +T Sbjct: 74 --NAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLA 131 Query: 273 ---NGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIY 329 + + K LH+A + KV + +LL+ + G++G T LH+A + Sbjct: 132 LLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPN--AAGKNGLTPLHVAVHH 189 Query: 330 DFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISL 389 + + ++L+ G S NGY P+H AAK + LQ+G G + E + Sbjct: 190 NNLDIVKLLLPR-GGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYG---GSANAESV-- 243 Query: 390 FAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNL 449 +G PLH A G + V L L A + TP+HL +G + + ++ Sbjct: 244 ---QGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLI-- 298 Query: 450 QPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRG 509 + V +++T TPLH A+ + +V++L+ AD+N K SPL AA +G Sbjct: 299 ---KHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQG 355 Query: 510 GWKTVLTLVRNKAN 523 V L++N A+ Sbjct: 356 HTDIVTLLLKNGAS 369
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-78
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-72
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-71
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-52
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-32
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-23
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-60
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-53
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-53
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-46
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-39
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-25
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-24
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-52
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-50
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-48
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-36
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-32
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-25
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-44
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-42
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-38
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-32
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-43
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-34
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-29
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-43
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-41
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-40
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-35
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-34
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-33
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-29
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-21
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-11
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-08
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-42
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-40
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-40
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-32
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-23
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-42
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-38
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-31
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-41
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-41
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-36
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-32
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-32
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-32
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-17
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-41
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-38
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-37
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-32
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-30
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-23
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 2e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-40
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-37
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-34
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-30
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-30
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-29
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-29
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-40
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-32
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-29
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-28
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-28
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-39
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-38
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-35
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-33
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-31
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-31
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-28
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-39
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-34
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-32
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-32
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-30
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-22
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-36
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-34
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-30
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-29
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-26
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-35
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-29
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-29
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-27
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-26
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-26
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-26
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-23
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 2e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-34
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-33
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-33
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-34
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-34
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-28
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-28
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-22
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-33
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-28
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-26
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-21
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-32
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-28
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-27
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-22
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-32
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-27
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-24
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-22
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-20
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-32
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-25
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-21
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-18
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-32
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-24
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-24
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-23
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-22
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-32
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-28
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-23
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-08
2pnn_A273 Transient receptor potential cation channel subfa 5e-32
2pnn_A273 Transient receptor potential cation channel subfa 2e-23
2pnn_A273 Transient receptor potential cation channel subfa 2e-21
2pnn_A273 Transient receptor potential cation channel subfa 1e-20
2pnn_A273 Transient receptor potential cation channel subfa 1e-12
2pnn_A 273 Transient receptor potential cation channel subfa 1e-04
2rfa_A232 Transient receptor potential cation channel subfa 2e-31
2rfa_A232 Transient receptor potential cation channel subfa 8e-29
2rfa_A232 Transient receptor potential cation channel subfa 5e-28
2rfa_A232 Transient receptor potential cation channel subfa 5e-25
2rfa_A232 Transient receptor potential cation channel subfa 1e-23
2rfa_A 232 Transient receptor potential cation channel subfa 3e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-31
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-30
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-23
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-23
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-22
3v31_A 167 Ankyrin repeat family A protein 2; structural geno 6e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-31
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-26
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-19
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-16
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-30
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-30
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-29
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-21
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-21
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-19
3hra_A 201 Ankyrin repeat family protein; structural protein; 9e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-30
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-26
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-19
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-19
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-17
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-13
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-30
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-25
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-16
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-29
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-26
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-25
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-23
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-27
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-25
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-20
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-18
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-27
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-21
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-20
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-10
2etb_A256 Transient receptor potential cation channel subfam 4e-27
2etb_A256 Transient receptor potential cation channel subfam 1e-22
2etb_A256 Transient receptor potential cation channel subfam 5e-22
2etb_A256 Transient receptor potential cation channel subfam 1e-19
2etb_A256 Transient receptor potential cation channel subfam 1e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-27
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-25
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-26
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-23
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-26
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-24
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-24
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-23
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-22
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-19
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-14
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 3e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-26
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-18
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-17
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-09
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-24
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-23
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-21
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-19
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-24
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-17
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-22
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-23
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-19
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-13
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-21
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-20
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-14
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-11
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-21
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-13
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-11
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-09
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  254 bits (652), Expect = 3e-78
 Identities = 108/474 (22%), Positives = 178/474 (37%), Gaps = 68/474 (14%)

Query: 150 DAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRLMFNLQ 209
              G  PLH A   G    V+  L+ GA  +     + TP+H+A   G  ++ +      
Sbjct: 11  GESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKY----- 65

Query: 210 PSEKLV----CLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAA 265
               L+     +N+      TPLHCAA     ++V+ L++  A+ N+      +PL +AA
Sbjct: 66  ----LLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAA 121

Query: 266 SRGGWKTNGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHI 325
             G                    H+         +L LL+ +         + G T LH+
Sbjct: 122 REG--------------------HVE-------TVLALLEKE--ASQACMTKKGFTPLHV 152

Query: 326 AAIYDFDECARILVKDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREE 385
           AA Y     A +L+ +  A    A  NG  P+H A  + +   +++ L  G S       
Sbjct: 153 AAKYGKVRVAELLL-ERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP--- 208

Query: 386 MISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHLACSQGALDIVRL 445
                A  G  PLH A      +     L+ G   + +     TP+HLA  +G  ++V L
Sbjct: 209 -----AWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVAL 263

Query: 446 MFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLA 505
           +       K    N  +   +TPLH  A      V   LI  G  ++   +   +PL +A
Sbjct: 264 LL-----SKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVA 318

Query: 506 ASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINL 565
           +  G  K V  L++++A++  K     + LH     G   I               L+  
Sbjct: 319 SHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTL------------LLKN 366

Query: 566 GACINLKNNSNESPLHLAARYGRYNTVKKLLSSERGSFIINESDGEGLTPLHIA 619
           GA  N  ++   +PL +A R G  +    L      +  +  SD   ++     
Sbjct: 367 GASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETV 420


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query641
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.92
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.86
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.86
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.85
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.85
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.85
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.84
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.75
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.74
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=1.3e-66  Score=522.24  Aligned_cols=400  Identities=25%  Similarity=0.320  Sum_probs=318.2

Q ss_pred             CCCcccccccCCCcchhhHHHhcCCHHHHHHHHhcCCccccccCCCCCchHHHHHHHcCCHHHHHHHHhcCCCcchhHhh
Q psy8763          20 SSGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVSEQPECDWIMVK   99 (641)
Q Consensus        20 ~~~~~~~~~~~~~~t~L~~A~~~g~~~~v~~ll~~g~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~~~~~~~~~~   99 (641)
                      +.|++++..+..|+||||+|+..|+.++|++|+++|+  +++..+..|.||||+|+..|+.+++++|+++          
T Consensus         2 ~~g~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~--~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~----------   69 (437)
T 1n11_A            2 SPGISGGGGGESGLTPLHVASFMGHLPIVKNLLQRGA--SPNVSNVKVETPLHMAARAGHTEVAKYLLQN----------   69 (437)
T ss_dssp             -------------CCHHHHHHHHTCHHHHHHHHHTTC--CSCCSSSCCCCHHHHHHHHTCHHHHHHHHHH----------
T ss_pred             CCCCCccccCCCCCCHHHHHHHCCCHHHHHHHHHcCC--CCCCCCCCCCCHHHHHHHcCCHHHHHHHHhC----------
Confidence            4678888888889999999999999999999998887  5556778888999999999999999999888          


Q ss_pred             hcCCCcccCCCCCCcHHHHHHHhCCHHHHHHHHHhcccCCCchhhhhccccCCCChHHHHHHhCCCHHHHHHHHHcCCCC
Q psy8763         100 DFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFDAEGNLPLHSAVHGGDFKAVELCLKSGAKI  179 (641)
Q Consensus       100 ~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~  179 (641)
                        |++++.++..|.||||+|+..|+.+++++|+++|+++        +..+..|.||||+|+..|+.++|++|++.|+++
T Consensus        70 --g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~--------~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~  139 (437)
T 1n11_A           70 --KAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANP--------NLATTAGHTPLHIAAREGHVETVLALLEKEASQ  139 (437)
T ss_dssp             --TCCSSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCT--------TCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCS
T ss_pred             --CCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHhCCCCC--------CCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCC
Confidence              8888888888888888888888888888888888876        455777888888888888888888888888888


Q ss_pred             CcCCCCCCcHHHHHHHcCcHHHHHHHHhcCCCccccccccCCCCCCcHHHHHHhcCcHHHHHHHHHcCCCCCccCCCCCC
Q psy8763         180 STQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRS  259 (641)
Q Consensus       180 ~~~~~~~~t~l~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~iv~~Ll~~g~~~~~~~~~~~t  259 (641)
                      +..+..|.||||+|+..|+.+++++|++++..     ++..+..|.|||++|+..++.+++++|+++|++++..+.    
T Consensus       140 ~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~-----~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~----  210 (437)
T 1n11_A          140 ACMTKKGFTPLHVAAKYGKVRVAELLLERDAH-----PNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW----  210 (437)
T ss_dssp             CCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCC-----TTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCT----
T ss_pred             cCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCC-----CCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCC----
Confidence            87777888888888888888888888887776     466777778888888888888888888877765542211    


Q ss_pred             HHHHHHHcCCcccccccccccccCchhHHHHHHhcCChhHHHHHhhCCCcccccCCCCCcchHHHHHHHhCcHHHHHHHH
Q psy8763         260 PLLLAASRGGWKTNGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILV  339 (641)
Q Consensus       260 ~l~~a~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll  339 (641)
                                                                                                      
T Consensus       211 --------------------------------------------------------------------------------  210 (437)
T 1n11_A          211 --------------------------------------------------------------------------------  210 (437)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HhcCccccccccCCCChHHHHHHcCChHHHHHHHhccccccCChHHHhHHHhhcCChHHHHHHhcCCHHHHHHHHHCCCC
Q psy8763         340 KDFGASLKRACSNGYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAK  419 (641)
Q Consensus       340 ~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~Ll~~g~~  419 (641)
                                                                           .|.||||.|+..++.+++++|++.|++
T Consensus       211 -----------------------------------------------------~g~t~L~~A~~~~~~~~~~~Ll~~g~~  237 (437)
T 1n11_A          211 -----------------------------------------------------NGYTPLHIAAKQNQVEVARSLLQYGGS  237 (437)
T ss_dssp             -----------------------------------------------------TCCCHHHHHHHTTCHHHHHHHHHTTCC
T ss_pred             -----------------------------------------------------CCCCHHHHHHHcCCHHHHHHHHHcCCC
Confidence                                                                 133444445555555666666666777


Q ss_pred             CCCCCCCCCcHHHHHHHcCCHHHHHHHHhcCCCccccccccCCCCCCcHHHHHHhcCChhHHHHHHHcCCCCCcCCCCCC
Q psy8763         420 ISTQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKR  499 (641)
Q Consensus       420 ~~~~~~~~~t~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~  499 (641)
                      ++..+..|.||||.|+..|+.+++++|++.+.     +++..+..|.||||+|+..++.+++++|+++|++++..+..|+
T Consensus       238 ~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~-----~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~  312 (437)
T 1n11_A          238 ANAESVQGVTPLHLAAQEGHAEMVALLLSKQA-----NGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGY  312 (437)
T ss_dssp             TTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTC-----CTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCC
T ss_pred             CCCCCCCCCCHHHHHHHCCCHHHHHHHHhcCC-----CCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCCCCCCCC
Confidence            77777778888888888888888888887443     3677788888999999999999999999999999999999999


Q ss_pred             CHHHHHHhcCCHHHHHHHHHcCCCccccccCCCchhHHHhhcCCCchhhHHHHHHHHHHHHHHhhcCCcccccCCCCCCh
Q psy8763         500 SPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESP  579 (641)
Q Consensus       500 t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~  579 (641)
                      ||||+|+..|+.+++++|+++|++++.+|..|.||||+|+..+            +.+++++|+++|++++.+|..|.||
T Consensus       313 t~L~~A~~~g~~~~v~~Ll~~gad~n~~~~~g~t~L~~A~~~g------------~~~iv~~Ll~~ga~~~~~~~~g~t~  380 (437)
T 1n11_A          313 TPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQG------------HTDIVTLLLKNGASPNEVSSDGTTP  380 (437)
T ss_dssp             CHHHHHHHSSCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTT------------CHHHHHHHHHTTCCSCCCCSSSCCH
T ss_pred             CHHHHHHHcCcHHHHHHHHhcCCCCCCCCCCCCCHHHHHHHCC------------hHHHHHHHHHCcCCCCCCCCCCCCH
Confidence            9999999999999999999999999999999999999999998            8899999999999999999999999


Q ss_pred             HHHHHhcCCHHHHHHHHhcCC
Q psy8763         580 LHLAARYGRYNTVKKLLSSER  600 (641)
Q Consensus       580 L~~A~~~~~~~~v~~Ll~~g~  600 (641)
                      |++|++.|+.+++++|.....
T Consensus       381 l~~A~~~g~~~~~~~l~~~~~  401 (437)
T 1n11_A          381 LAIAKRLGYISVTDVLKVVTD  401 (437)
T ss_dssp             HHHHHHTTCHHHHHHHHHHCC
T ss_pred             HHHHHHcCcHHHHHHHHhccc
Confidence            999999999999998876543



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 641
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-50
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-47
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-47
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-35
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-23
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-21
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-21
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-20
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-16
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-16
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-06
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-22
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-21
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-19
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-18
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-16
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-15
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-22
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-20
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-20
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-20
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-16
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-12
d1uoha_ 223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-18
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-14
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-14
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-13
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-07
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-17
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-15
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-15
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-08
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-15
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-11
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-13
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-06
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 9e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-10
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-11
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-11
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 9e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 9e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 7e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.002
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.004
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-05
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  177 bits (449), Expect = 4e-50
 Identities = 105/433 (24%), Positives = 173/433 (39%), Gaps = 39/433 (9%)

Query: 188 TPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEG 247
           TP+H+A   G L IV+ +      ++    N ++ +  TPLH AA     +V +YL+   
Sbjct: 2   TPLHVASFMGHLPIVKNLL-----QRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNK 56

Query: 248 ADLNVLDKEKRSPLLLAASRGGWKT------NGVNTRILNNKKQAVLHLATELNKVPILL 301
           A +N   K+ ++PL  AA  G          N  N  +        LH+A     V  +L
Sbjct: 57  AKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVL 116

Query: 302 ILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSNGYYPIHDAA 361
            LL+ +     +   + G T LH+AA Y     A +L+ +  A    A  NG  P+H A 
Sbjct: 117 ALLEKEASQACM--TKKGFTPLHVAAKYGKVRVAELLL-ERDAHPNAAGKNGLTPLHVAV 173

Query: 362 KNASSKTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKIS 421
            + +   +++ L  G S               G  PLH A      +     L+ G   +
Sbjct: 174 HHNNLDIVKLLLPRGGSPHSPAW--------NGYTPLHIAAKQNQVEVARSLLQYGGSAN 225

Query: 422 TQQFDLSTPVHLACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVV 481
            +     TP+HLA  +G  ++V L+ + Q        N  +   +TPLH  A      V 
Sbjct: 226 AESVQGVTPLHLAAQEGHAEMVALLLSKQA-----NGNLGNKSGLTPLHLVAQEGHVPVA 280

Query: 482 QYLIDEGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLN 541
             LI  G  ++   +   +PL +A+  G  K V  L++++A++  K     + LH     
Sbjct: 281 DVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQ 340

Query: 542 GGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTVKKLLSSERG 601
           G   I               L+  GA  N  ++   +PL +A R G  +    L      
Sbjct: 341 GHTDIVTL------------LLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDE 388

Query: 602 SFIINESDGEGLT 614
           +  +  SD   ++
Sbjct: 389 TSFVLVSDKHRMS 401


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query641
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.98
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.98
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.9
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.88
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.4e-53  Score=422.64  Aligned_cols=385  Identities=24%  Similarity=0.321  Sum_probs=296.3

Q ss_pred             cchhhHHHhcCCHHHHHHHHhcCCccccccCCCCCchHHHHHHHcCCHHHHHHHHhcCCCcchhHhhhcCCCcccCCCCC
Q psy8763          33 QAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVSEQPECDWIMVKDFGASLKRACSNG  112 (641)
Q Consensus        33 ~t~L~~A~~~g~~~~v~~ll~~g~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~g~~~~~~~~~g  112 (641)
                      .||||+||..|++++|++|+++|+  +++..|..|.||||+|+..|+.++|++|+++            |++++..+..|
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~g~--~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~------------gadi~~~~~~g   66 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQRGA--SPNVSNVKVETPLHMAARAGHTEVAKYLLQN------------KAKVNAKAKDD   66 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHTTC--CSCCSSSCCCCHHHHHHHHTCHHHHHHHHHH------------TCCSSCCCTTS
T ss_pred             CChHHHHHHCcCHHHHHHHHHCCC--CCCCCCCCCCCHHHHHHHcCCHHHHHHHHHC------------cCCCCCCCCCC
Confidence            378888888888888888888886  5666778888888888888888888888887            78888888888


Q ss_pred             CcHHHHHHHhCCHHHHHHHHHhcccCCCchhhhhccccCCCChHHHHHHhCCCHHHHHHHHHcCCCCCcCCCCCCcHHHH
Q psy8763         113 YYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFDAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVHL  192 (641)
Q Consensus       113 ~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~t~l~~  192 (641)
                      .||||+|+..|+.+++++|+..+.++        ........+++..+...+...........+...+..+..+.++++.
T Consensus        67 ~t~L~~A~~~g~~~~~~~Ll~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  138 (408)
T d1n11a_          67 QTPLHCAARIGHTNMVKLLLENNANP--------NLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHV  138 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHHTCCT--------TCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHH
T ss_pred             CCHHHHHHHcCCHHHHHHHHHhhhcc--------ccccccccchhhhhhhhcccccccccccccccccccccccchHHHH
Confidence            88888888888888888888777654        2334555677777777777777777777777777777777777777


Q ss_pred             HHHcCcHHHHHHHHhcCCCccccccccCCCCCCcHHHHHHhcCcHHHHHHHHHcCCCCCccCCCCCCHHHHHHHcCCccc
Q psy8763         193 ACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWKT  272 (641)
Q Consensus       193 A~~~g~~~iv~~Ll~~~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~iv~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~~~  272 (641)
                      |+..++.+++++|++++..     ++..+..+.+||++|+..++.+++++|+++|++++..+..|.+|++          
T Consensus       139 a~~~~~~~~v~~ll~~~~~-----~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~----------  203 (408)
T d1n11a_         139 AAKYGKVRVAELLLERDAH-----PNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLH----------  203 (408)
T ss_dssp             HHHTTCHHHHHHHHHTTCC-----TTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHH----------
T ss_pred             HHHcCCHHHHHHHHHcCCC-----CCcCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcch----------
Confidence            7777777777777777766     4666667777777777777777777777777766544333333222          


Q ss_pred             ccccccccccCchhHHHHHHhcCChhHHHHHhhCCCcccccCCCCCcchHHHHHHHhCcHHHHHHHHHhcCccccccccC
Q psy8763         273 NGVNTRILNNKKQAVLHLATELNKVPILLILLQYKDMIDILQGGEHGRTALHIAAIYDFDECARILVKDFGASLKRACSN  352 (641)
Q Consensus       273 ~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~  352 (641)
                                                                                                      
T Consensus       204 --------------------------------------------------------------------------------  203 (408)
T d1n11a_         204 --------------------------------------------------------------------------------  203 (408)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCChHHHHHHcCChHHHHHHHhccccccCChHHHhHHHhhcCChHHHHHHhcCCHHHHHHHHHCCCCCCCCCCCCCcHHH
Q psy8763         353 GYYPIHDAAKNASSKTMEVFLQFGESIGCSREEMISLFAAEGNLPLHSAVHGGDFKAVELCLKSGAKISTQQFDLSTPVH  432 (641)
Q Consensus       353 ~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~  432 (641)
                                                                     .++.....+....++..+......+..+.|||+
T Consensus       204 -----------------------------------------------~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~  236 (408)
T d1n11a_         204 -----------------------------------------------IAAKQNQVEVARSLLQYGGSANAESVQGVTPLH  236 (408)
T ss_dssp             -----------------------------------------------HHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHH
T ss_pred             -----------------------------------------------hhhccchhhhhhhhhhccccccccCCCCCCHHH
Confidence                                                           222222333333444444445555666778888


Q ss_pred             HHHHcCCHHHHHHHHhcCCCccccccccCCCCCCcHHHHHHhcCChhHHHHHHHcCCCCCcCCCCCCCHHHHHHhcCCHH
Q psy8763         433 LACSQGALDIVRLMFNLQPSEKLVCLNSTDAQKMTPLHCAAMFDRCDVVQYLIDEGADLNVLDKEKRSPLLLAASRGGWK  512 (641)
Q Consensus       433 ~a~~~~~~~~v~~ll~~~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~  512 (641)
                      .|+..+..++++++++....     .+..+..|.|||+.|+..++.+++++|+++|++++..+..+.|||+.++..++.+
T Consensus       237 ~a~~~~~~~~~~~~~~~~~~-----~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~~~~~~~~~t~L~~~~~~~~~~  311 (408)
T d1n11a_         237 LAAQEGHAEMVALLLSKQAN-----GNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIK  311 (408)
T ss_dssp             HHHHTTCHHHHHHHHTTTCC-----TTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHSSCSH
T ss_pred             HHHHhCcHhHhhhhhccccc-----cccccCCCCChhhhhhhcCcHHHHHHHHHCCCccccccccccccchhhcccCcce
Confidence            88888888888888774433     5667778888999999999999999999999999888888899999999999999


Q ss_pred             HHHHHHHcCCCccccccCCCchhHHHhhcCCCchhhHHHHHHHHHHHHHHhhcCCcccccCCCCCChHHHHHhcCCHHHH
Q psy8763         513 TVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGENLINLGACINLKNNSNESPLHLAARYGRYNTV  592 (641)
Q Consensus       513 ~v~~Ll~~g~~~~~~~~~g~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v  592 (641)
                      +++++++.|++++.+|..|.||||+|+..+            +.+++++|+++|++++.+|..|+||||+|++.|+.++|
T Consensus       312 ~~~~ll~~g~~in~~d~~G~T~Lh~A~~~g------------~~~iv~~Ll~~GAd~n~~d~~G~t~L~~A~~~~~~~iv  379 (408)
T d1n11a_         312 LVKFLLQHQADVNAKTKLGYSPLHQAAQQG------------HTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVT  379 (408)
T ss_dssp             HHHHHHHTTCCTTCCCTTSCCHHHHHHHTT------------CHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHH
T ss_pred             eeeeeccccccccccCCCCCCHHHHHHHcC------------CHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHH
Confidence            999999999999999999999999999988            88899999999999999999999999999999999988


Q ss_pred             HHHHhc
Q psy8763         593 KKLLSS  598 (641)
Q Consensus       593 ~~Ll~~  598 (641)
                      ++|..-
T Consensus       380 ~~L~~~  385 (408)
T d1n11a_         380 DVLKVV  385 (408)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            866533



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure