Psyllid ID: psy8771


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900----
MDTRCYVESPEEVFIILCPLPPLIPGYILVTEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITHPPTRAARSHARLAAQSVLRRGRLAHAVRQVADPVRRVPPQFSIPPPALLEVMLDSPLNLSCVAVGSPMPFVKWRKGQNIELTPDDKLPVGRNVLTLDRVTESENYTCIAASVLGVIETSTIVKVQCKYAPLLTLPVAPLDVKISEVTATSVRLDWTYPSETLLYYVIQYKPKAANTPYSEISGIITTYYTVRNLSPYTEYEFYIIAVNNLGRGPPSSPAVITTGETEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQAAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQALYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVGPGPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYVPGAPPQNVSCEPLSSTSIRISWEPPPVERSNGHIVYYKLQFVETGRSDSEASIVTLKNQTSFVLDELKKWTEYRIWVLAGTSIGDGPSSYPITIRTHEDDPSEVCPTQNDFRKNKKTNGSNFKGGYLNDPMRFDVSDGGALELNVTGLQPDTIYTIQVAALTRKGDGDRSKPETIKTPGGVPNRPHVNL
cccccEEcccEEEEEEEccccccccEEEEEEccccccccEEEEEEEcccEEEEEccccccccEEEEcccccccccEEEEEEEEEEcccEEcEEEEEEEEEEEccccEEccccccEEEcccccEEEEEEEEEccccEEEEEEccEEccccccEEEEEcEEEEEccccccEEEEEEEEEccccEEEEEEEEEEEccccccccccccccEEEEEEEccEEEEEEEccccccEEEEEEEEEccccccEEEEEcccccEEEEcccccccEEEEEEEEEcccccccccccEEEEEccccccccccccEEEEccccEEEEEEEccccccccEEEEEEEEEccEEEEEEccccccEEEEEEEEEEcccccccccccEEEEEccccccccccccccccccccEEEEEEEEcccccccEEEEEEEEEcccccccccccEEEEEEccccccEEEEcccccccEEEEEEEEEcccccccccccEEEEcccccccccccccEEEEccccEEEEEEEcccccccEEEEEEEEEEEccccccccEEEEEcccEEEEEEcccccccEEEEEEEEEcccccccccccEEEEEcccccccccccEEEEccccEEEEEEEccccccccEEEEEEEEEcccccccccEEEEEcccEEEEEEccccccccccEEEEEEEEccccccEEEEEEccEEEEEEcccccccEEEEEEEEEcccccccccccEEEEccccccccccccEEEEEccccEEEEEEEcccccccccEEEEEEEEEEEcccccccEEEEEcccccEEEEcccccccEEEEEEEEEcccccccccccEEEEccccccccccccccEEEcccccccEEEEEEEEccccEEEEccccEEEEEEcccccccEEEEEEEEEcccccccccccEEEEccccccccccccc
cccEEEEEccccEEEEccccccccccEEEEcccccccccEEEEEcccccEEEEEEcccccccEEEEEEEEEEccccccEEEEEEEEcccccEEEEEEEEEccccccccccccccEEEEcccEEEEEEEEccccccEEEEEEcccEccccccEEEEcEEEEEEEccccccEEEEEEEEcccccccccEEEEEcccccccccccccccEEEEccEEEEEEEEEccccccccEEEEEEEEccccccEEEEEccccEEEEEEcccccccEEEEEEEEEccccccccccEEEEccccccccccccEEEEEcccccEEEEEEccccccccEEEEEEEEEcccEEEEEEccccccEEEEEEEEEEccccccccccEEEEEccccccccccccEEEEEEEEEEEEEcccccccccccEEEEEEEEEccccccccccEEEEEEEcccEEEEEEEccccccEEEEEEEEEEccccccccccEEEEccccccccccccEEEEEEcccEEEEEEcccccccccEEEEEEEEEEcccccccEEEEEEccccEEEEEEccccccEEEEEEEEEEccccccccccEEEEcccccccccccEEEEEccccEEEEEEcccccccccEEEEEEEEEEcccccccEEEEEccccEEEEEEEccccccccEEEEEEEEEccccccEEEEEccccEEEEEcccccccEEEEEEEEEEccccccccccEEEEccccccccccccEEEEEccccEEEEEEcccccccccccEEEEEEEEEEccccccEEEEEEccccEEEEEEccccccEEEEEEEEEEccccccccccEEEEccccccccccccEEEccccccccccEEEEEEEccccEEEEEcccEEEEEEcccccccEEEEEEEEEEccccccccccEEEEccccccccccccc
mdtrcyvespeeVFIIlcplpplipgyilvtepgtaprdvqvrplssstmviqwdepetpngqithpptraaRSHARLAAQSVLRRGRLAHAVrqvadpvrrvppqfsipppallevmldsplnlscvavgspmpfvkwrkgqnieltpddklpvgrnvltldrvtesenyTCIAASVLGVIETSTIVKVQckyaplltlpvapldvkisEVTATSvrldwtypseTLLYYVIQykpkaantpyseISGIITTYYtvrnlspyteyEFYIIAVNnlgrgppsspavittgetepgtaprdvqvrplssstmviqwdepetpngqitakhHRRIGLVetysltglypntLYYIWLAaqsprgegattppipvrtkqygktpgfgeqAAKHHRRIGLVetysltglypntLYYIWLAaqsprgegattppipvrtkqygktpgfgeqalypnTLYYIWLAaqsprgegattppipvrtkqyepgtaprdvqvrplssstmviqwdepetpngqitgykvyytqdqslpmsawetqvvdnnqlttisdltphtIYTIRVQaftsvgpgplsapvlvktqqgvpsqprdlraVDIQETAVTLawskpthsgeniisyelywndtyakprdlravDIQETAVTLawskpthsgeniisyelywndtyAKAKHHRRIGLVetysltglypntLYYIWLAaqsprgegattppipvrtkqyvpgappqnvsceplsstsiriswepppversnghivYYKLQFvetgrsdseasiVTLKNQTSFVLDELKKWTEYRIWVLAgtsigdgpssypitirtheddpsevcptqndfrknkktngsnfkggylndpmrfdvsdggalelnvtglqpdtIYTIQVAALtrkgdgdrskpetiktpggvpnrphvnl
mdtrcyvesPEEVFIILCPLPPLIPGYILVTEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITHPPTRAARSHARLAAQSVLRRGRLAHAVrqvadpvrrvpPQFSIPPPALLEVMLDSPLNLSCVAVGSPMPFVKWRKGQNieltpddklpvgrNVLTldrvtesenyTCIAASVLGVIETSTIVKVQCKYAPLLTLPVAPLDVKISEVTatsvrldwtypSETLLYYVIQYKPKAANTPYSEISGIITTYYTVRNLSPYTEYEFYIIAVNNLGRGPPSSPAVITtgetepgtaprdvqvrpLSSSTMVIQwdepetpngqitakhhRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQAAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQALYPNTLYYIWLAAQSPRGEGATTPPIpvrtkqyepgtaprdvqvrplSSSTMVIqwdepetpngqiTGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVGPGPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVtlawskpthsgeniiSYELYWNDTYAKPRDLRAVDIQETAVtlawskpthsgenIISYELYWNDTYAKAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYVPGAPPQNVSCEPLSSTSIRISwepppversngHIVYYKLQFVETGRSDSeasivtlknqtsfVLDELKKWTEYRIWVLagtsigdgpsSYPITIRtheddpsevcptqndfrknkktngsnfkggylndPMRFDVSDGGALELNVTGLQPDTIYTIQVAAltrkgdgdrskpetiktpggvpnrphvnl
MDTRCYVESPEEVFiilcplpplipgyilVTEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITHPPTRAARSHARLAAQSVLRRGRLAHAVRQVADPVRRVPPQFSIPPPALLEVMLDSPLNLSCVAVGSPMPFVKWRKGQNIELTPDDKLPVGRNVLTLDRVTESENYTCIAASVLGVIETSTIVKVQCKYAPLLTLPVAPLDVKISEVTATSVRLDWTYPSETLLYYVIQYKPKAANTPYSEISGIITTYYTVRNLSPYTEYEFYIIAVNNLGRGPPSSPAVITTGETEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQAAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQALYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVGPGPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYVPGAPPQNVSCEPLSSTSIRISWEPPPVERSNGHIVYYKLQFVETGRSDSEASIVTLKNQTSFVLDELKKWTEYRIWVLAGTSIGDGPSSYPITIRTHEDDPSEVCPTQNDFRKNKKTNGSNFKGGYLNDPMRFDVSDGGALELNVTGLQPDTIYTIQVAALTRKGDGDRSKPETIKTPGGVPNRPHVNL
****CYVESPEEVFIILCPLPPLIPGYILVTEPG****************************************************GRLAHAVRQVADPVRRVPPQFSIPPPALLEVMLDSPLNLSCVAVGSPMPFVKWRKGQNIELTPDDKLPVGRNVLTLDRVTESENYTCIAASVLGVIETSTIVKVQCKYAPLLTLPVAPLDVKISEVTATSVRLDWTYPSETLLYYVIQYKPKAANTPYSEISGIITTYYTVRNLSPYTEYEFYIIAVNNLG***********************************************ITAKHHRRIGLVETYSLTGLYPNTLYYIWLAA******************************AKHHRRIGLVETYSLTGLYPNTLYYIWLAA*******************YGKTPGFGEQALYPNTLYYIWLAA***************************************VIQW******NGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVGPGPLSAPVLVK***********LRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKAKHHRRIGLVETYSLTGLYPNTLYYIWLAA***************************************************NGHIVYYKLQFVETGRSDSEASIVTLKNQTSFVLDELKKWTEYRIWVLAGTSIGDG***YPI********************************GYLNDPMRFDVSDGGALELNVTGLQPDTIYTIQVAALT***************************
*DTRCYVESPEEVFIILCPLPPLIPGYILVTEPGTAPRDVQVRPLSSSTMVIQWDEPE***GQITHPPTRAARSHARLAAQSVLRRGRLAHAVRQVADPVRRVPPQ*****************NLSCVAVGSPMPFVKWRKGQNIELTPDDKLPVGRNVLTLDRVTESENYTCIAASVLGVIETSTIVKVQCKY**********LDVKISEVTATSVRLDWTYPSETLLYYVIQYKPK***********IITTYYTVRNLSPYTEYEFYIIAVNNLGRGPPSSPAVITT*******APRDVQVRPLSSSTMVIQWDEPETPNGQITAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTK**************************LTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQALYPNTLYYIWLAAQSPRGEGATTPPIPV**********PRDVQVRPLSSSTMVIQWDEPETPNGQITGYKVYYTQ****************NQLTTISDLTPHTIYTIRVQAFTSVGPGPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQY****PPQNVSCEPLSSTSIRISWEPPPVERSNGHIVYYKLQFVETGRSDSEASIVTLKNQTSFVLDELKKWTEYRIWVLAGTSIGDGPSSYPITI****************FRKNKKTNGSNFKGGYLNDPMRFDVSDGGALELNVTGLQPDTIYTIQVAALTRKGDGDRSKPE****************
********SPEEVFIILCPLPPLIPGYILVTEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITHP***********AAQSVLRRGRLAHAVRQVADPVRRVPPQFSIPPPALLEVMLDSPLNLSCVAVGSPMPFVKWRKGQNIELTPDDKLPVGRNVLTLDRVTESENYTCIAASVLGVIETSTIVKVQCKYAPLLTLPVAPLDVKISEVTATSVRLDWTYPSETLLYYVIQYKPKAANTPYSEISGIITTYYTVRNLSPYTEYEFYIIAVNNLGRGPPSSPAVITTGETEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTP*********HRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQALYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVGPGPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYVPGAPPQNVSCEPLSSTSIRISWEPPPVERSNGHIVYYKLQFVETGRSDSEASIVTLKNQTSFVLDELKKWTEYRIWVLAGTSIGDGPSSYPITIRTHEDDPSEVCPTQNDFRKNKKTNGSNFKGGYLNDPMRFDVSDGGALELNVTGLQPDTIYTIQVAALT**********ETIKTPGGVPNRPHVNL
*DTRCYVESPEEVFIILCPLPPLIPGYILVTEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITHPPTRAARSHARLAAQSVLRRGRLAHAVRQVADPVRRVPPQFSIPPPALLEVMLDSPLNLSCVAVGSPMPFVKWRKGQNIELTPDDKLPVGRNVLTLDRVTESENYTCIAASVLGVIETSTIVKVQCKYAPLLTLPVAPLDVKISEVTATSVRLDWTYPSETLLYYVIQYKPKAANTPYSEISGIITTYYTVRNLSPYTEYEFYIIAVNNLGRGPPSSPAVITTGETEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQAAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQALYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVGPGPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYVPGAPPQNVSCEPLSSTSIRISWEPPPVERSNGHIVYYKLQFVETGRSDSEASIVTLKNQTSFVLDELKKWTEYRIWVLAGTSIGDGPSSYPITIRTHEDDPSEVCPTQNDFRKNKKTNGSNFKGGYLNDPMRFDVSDGGALELNVTGLQPDTIYTIQVAALTRKGDGDRSKPETIKTPGG*PNR*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTRCYVESPEEVFIILCPLPPLIPGYILVTEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITHPPTRAARSHARLAAQSVLRRGRLAHAVRQVADPVRRVPPQFSIPPPALLEVMLDSPLNLSCVAVGSPMPFVKWRKGQNIELTPDDKLPVGRNVLTLDRVTESENYTCIAASVLGVIETSTIVKVQCKYAPLLTLPVAPLDVKISEVTATSVRLDWTYPSETLLYYVIQYKPKAANTPYSEISGIITTYYTVRNLSPYTEYEFYIIAVNNLGRGPPSSPAVITTGETEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQAAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQALYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVGPGPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYVPGAPPQNVSCEPLSSTSIRISWEPPPVERSNGHIVYYKLQFVETGRSDSEASIVTLKNQTSFVLDELKKWTEYRIWVLAGTSIGDGPSSYPITIRTHEDDPSEVCPTQNDFRKNKKTNGSNFKGGYLNDPMRFDVSDGGALELNVTGLQPDTIYTIQVAALTRKGDGDRSKPETIKTPGGVPNRPHVNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query904 2.2.26 [Sep-21-2011]
P16621 2029 Tyrosine-protein phosphat yes N/A 0.460 0.205 0.549 1e-140
P10586 1907 Receptor-type tyrosine-pr yes N/A 0.788 0.373 0.334 1e-91
A7MBJ4 1898 Receptor-type tyrosine-pr yes N/A 0.775 0.369 0.337 7e-90
P23468 1912 Receptor-type tyrosine-pr no N/A 0.794 0.375 0.316 3e-88
Q64604 1898 Receptor-type tyrosine-pr yes N/A 0.779 0.371 0.325 2e-87
Q64605 1907 Receptor-type tyrosine-pr no N/A 0.788 0.373 0.319 1e-82
Q64487 1912 Receptor-type tyrosine-pr yes N/A 0.689 0.325 0.313 3e-82
B0V2N1 1907 Receptor-type tyrosine-pr yes N/A 0.662 0.314 0.343 5e-82
A2A8L5 1898 Receptor-type tyrosine-pr no N/A 0.799 0.380 0.289 7e-82
A4IFW2 1909 Receptor-type tyrosine-pr no N/A 0.761 0.360 0.307 6e-78
>sp|P16621|LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster GN=Lar PE=1 SV=2 Back     alignment and function desciption
 Score =  501 bits (1289), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 266/484 (54%), Positives = 323/484 (66%), Gaps = 68/484 (14%)

Query: 445 QALYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYEPGTAPRDVQVRPLSSSTMVIQWDE 504
           +AL P T Y  ++ A +  G G  + P    T + +  +APR+VQVR LSSSTMVI W+ 
Sbjct: 380 RALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEP 439

Query: 505 PETPNGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVGP 564
           PETPNGQ+TGYKVYYT + + P ++W +Q+VDN++LTT+S+LTPH IYT+RVQA+TS+G 
Sbjct: 440 PETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGA 499

Query: 565 GPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKP 624
           GP+S PV VK QQGVPSQP +                                       
Sbjct: 500 GPMSTPVQVKAQQGVPSQPSNF-------------------------------------- 521

Query: 625 RDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKAKHHRRIGLVETYSLTGLYP 684
              RA DI ETAVTL W+KPTHS ENI+ YELYWNDTYA   HH+RI   E Y+L GLYP
Sbjct: 522 ---RATDIGETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHHKRISNSEAYTLDGLYP 578

Query: 685 NTLYYIWLAAQSPRGEGATTPPIPVRTKQYVPGAPPQNVSCEPLSSTSIRISWEPPPVER 744
           +TLYYIWLAA+S RGEGATTPPIPVRTKQYVPGAPP+N++    SST+I +SW PPPVER
Sbjct: 579 DTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNITAIATSSTTISLSWLPPPVER 638

Query: 745 SNGHIVYYKLQFVETGRSDSEASIVTLKNQTSFVLDELKKWTEYRIWVLAGTSIGDGPSS 804
           SNG I+YYK+ FVE GR D EA+ +TL N TS VLDELK+WTEY+IWVLAGTS+GDGP S
Sbjct: 639 SNGRIIYYKVFFVEVGREDDEATTMTL-NMTSIVLDELKRWTEYKIWVLAGTSVGDGPRS 697

Query: 805 YPITIRTHED---DPSEVCPT------------------QNDFRKNKKTNGSNFKG---G 840
           +PI +RT ED   DP +V  T                  +N   +    +    +    G
Sbjct: 698 HPIILRTQEDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKG 757

Query: 841 YLNDPMRFDVSDGGALELNVTGLQPDTIYTIQVAALTRKGDGDRSKPETIKTPGGVPNRP 900
           +LN+P +FDV D   LE NVTGLQPDT Y+IQVAALTRKGDGDRS    +KTPGGVP RP
Sbjct: 758 FLNEPFKFDVVD--TLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRP 815

Query: 901 HVNL 904
            V+L
Sbjct: 816 TVSL 819




Possible cell adhesion receptor. It possesses an intrinsic protein tyrosine phosphatase activity (PTPase). It controls motor axon guidance.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|P10586|PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens GN=PTPRF PE=1 SV=2 Back     alignment and function description
>sp|A7MBJ4|PTPRF_BOVIN Receptor-type tyrosine-protein phosphatase F OS=Bos taurus GN=PTPRF PE=2 SV=1 Back     alignment and function description
>sp|P23468|PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens GN=PTPRD PE=1 SV=2 Back     alignment and function description
>sp|Q64604|PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus GN=Ptprf PE=2 SV=1 Back     alignment and function description
>sp|Q64605|PTPRS_RAT Receptor-type tyrosine-protein phosphatase S OS=Rattus norvegicus GN=Ptprs PE=1 SV=2 Back     alignment and function description
>sp|Q64487|PTPRD_MOUSE Receptor-type tyrosine-protein phosphatase delta OS=Mus musculus GN=Ptprd PE=1 SV=3 Back     alignment and function description
>sp|B0V2N1|PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus GN=Ptprs PE=1 SV=1 Back     alignment and function description
>sp|A2A8L5|PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus GN=Ptprf PE=1 SV=1 Back     alignment and function description
>sp|A4IFW2|PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio GN=ptprf PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query904
189235110 2016 PREDICTED: similar to receptor tyrosine 0.457 0.205 0.602 1e-156
270004034 2156 hypothetical protein TcasGA2_TC003342 [T 0.457 0.192 0.590 1e-153
357604037 2049 putative receptor tyrosine phosphatase t 0.460 0.203 0.593 1e-153
307166143 1810 Tyrosine-protein phosphatase Lar [Campon 0.462 0.230 0.595 1e-151
332020571 1785 Tyrosine-protein phosphatase Lar [Acromy 0.460 0.233 0.597 1e-150
350427923 2025 PREDICTED: tyrosine-protein phosphatase 0.461 0.205 0.590 1e-150
328786146 2029 PREDICTED: tyrosine-protein phosphatase 0.421 0.187 0.622 1e-148
383854788 2040 PREDICTED: tyrosine-protein phosphatase 0.461 0.204 0.584 1e-148
242003488 2014 Receptor-type tyrosine-protein phosphata 0.462 0.207 0.586 1e-146
157109352 2007 receptor tyrosine phosphatase type r2a [ 0.460 0.207 0.570 1e-143
>gi|189235110|ref|XP_971078.2| PREDICTED: similar to receptor tyrosine phosphatase type r2a [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  558 bits (1439), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 294/488 (60%), Positives = 343/488 (70%), Gaps = 74/488 (15%)

Query: 445 QALYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYEPGTAPRDVQVRPLSSSTMVIQWDE 504
           ++L P T Y +++ A +  G G  + P  V T + EPG++PR+VQVRPLSSSTMVIQWDE
Sbjct: 364 RSLSPYTEYEMYVIAVNNIGRGPPSAPEFVTTGETEPGSSPRNVQVRPLSSSTMVIQWDE 423

Query: 505 PETPNGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVGP 564
           PET NGQ+TGYKVYYT +  LPM+ WE+QVVDNNQLTTIS+LTPHTIYTIRVQAFTSVGP
Sbjct: 424 PETANGQVTGYKVYYTTNSQLPMAQWESQVVDNNQLTTISELTPHTIYTIRVQAFTSVGP 483

Query: 565 GPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKP 624
           GPLSAPV VKTQQGVPSQP +                                       
Sbjct: 484 GPLSAPVHVKTQQGVPSQPSN--------------------------------------- 504

Query: 625 RDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKAKHHRRIGLVETYSLTGLYP 684
             L A DI ET+VTL WSKPTHSGENI++YELYWNDTYAK KHHRRI + E+Y+LTGLYP
Sbjct: 505 --LMASDIGETSVTLQWSKPTHSGENIVNYELYWNDTYAKEKHHRRIPITESYTLTGLYP 562

Query: 685 NTLYYIWLAAQSPRGEGATTPPIPVRTKQYVPGAPPQNVSCEPLSSTSIRISWEPPPVER 744
           NTLYY+WLAA+S RGEGATTPPIPVRTKQYVPGAPP NV+ E +S T+IR++WEPP   R
Sbjct: 563 NTLYYVWLAARSQRGEGATTPPIPVRTKQYVPGAPPSNVTGEAVSPTAIRVTWEPPLANR 622

Query: 745 SNGHIVYYKLQFVETGRSDSEASIVTLKNQTSFVLDELKKWTEYRIWVLAGTSIGDGPSS 804
           S+G+I+YYKLQ+VE  RSDSEA  V + N TSFVLDELK+WT YRIWVLAGTS+GDGPSS
Sbjct: 623 SHGNIIYYKLQYVEADRSDSEAIEVKM-NATSFVLDELKRWTTYRIWVLAGTSVGDGPSS 681

Query: 805 YPITIRTHEDDPS-----EVCPTQNDFRK-----------------------NKKTNGSN 836
           +PIT+RTHED P      +V P  +   K                         K  G N
Sbjct: 682 FPITVRTHEDVPGNPEDVKVTPINSTTIKVEWKPPHPKERNGIILGYHVHVQETKEEGKN 741

Query: 837 FKGGYLNDPMRFDVSDGGALELNVTGLQPDTIYTIQVAALTRKGDGDRSKPETIKTPGGV 896
           F    LNDPM+FDV     L+LNV+GLQPDT Y +QVAALTRKGDGDRS P  ++TPGGV
Sbjct: 742 F----LNDPMKFDVFGDAVLDLNVSGLQPDTTYAVQVAALTRKGDGDRSPPVNVRTPGGV 797

Query: 897 PNRPHVNL 904
           PNRP + +
Sbjct: 798 PNRPALTI 805




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270004034|gb|EFA00482.1| hypothetical protein TcasGA2_TC003342 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357604037|gb|EHJ64021.1| putative receptor tyrosine phosphatase type r2a [Danaus plexippus] Back     alignment and taxonomy information
>gi|307166143|gb|EFN60392.1| Tyrosine-protein phosphatase Lar [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332020571|gb|EGI60979.1| Tyrosine-protein phosphatase Lar [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350427923|ref|XP_003494927.1| PREDICTED: tyrosine-protein phosphatase Lar-like, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|328786146|ref|XP_397010.3| PREDICTED: tyrosine-protein phosphatase Lar [Apis mellifera] Back     alignment and taxonomy information
>gi|383854788|ref|XP_003702902.1| PREDICTED: tyrosine-protein phosphatase Lar-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242003488|ref|XP_002422752.1| Receptor-type tyrosine-protein phosphatase F precursor, putative [Pediculus humanus corporis] gi|212505585|gb|EEB10014.1| Receptor-type tyrosine-protein phosphatase F precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157109352|ref|XP_001650632.1| receptor tyrosine phosphatase type r2a [Aedes aegypti] gi|108879038|gb|EAT43263.1| AAEL005284-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query904
FB|FBgn0000464 2029 Lar "Leukocyte-antigen-related 0.549 0.244 0.465 1.3e-131
UNIPROTKB|F1N897 1767 PTPRF "Uncharacterized protein 0.547 0.280 0.376 6.4e-96
UNIPROTKB|F1SMP3 1342 PTPRD "Uncharacterized protein 0.637 0.429 0.354 5.1e-95
UNIPROTKB|F1MJR2 1776 PTPRD "Uncharacterized protein 0.543 0.276 0.381 1.6e-93
UNIPROTKB|F1PH17 1890 PTPRD "Uncharacterized protein 0.543 0.259 0.383 2.1e-93
UNIPROTKB|A7MBJ4 1898 PTPRF "Receptor-type tyrosine- 0.578 0.275 0.372 2.5e-93
UNIPROTKB|P23468 1912 PTPRD "Receptor-type tyrosine- 0.643 0.304 0.351 3.5e-93
UNIPROTKB|G3XAE2 1899 PTPRD "Receptor-type tyrosine- 0.637 0.303 0.352 9.2e-93
UNIPROTKB|F1NQ48 1918 F1NQ48 "Uncharacterized protei 0.662 0.312 0.355 1.4e-92
UNIPROTKB|F1M2Y2 1692 Ptprd "Protein Ptprd" [Rattus 0.543 0.290 0.384 1.4e-92
FB|FBgn0000464 Lar "Leukocyte-antigen-related-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1106 (394.4 bits), Expect = 1.3e-131, Sum P(2) = 1.3e-131
 Identities = 251/539 (46%), Positives = 329/539 (61%)

Query:   100 VRRVPPQFSIPPPALLEVMLDSPLNLSCVAVGSPMPFVKWRKGQNIELTPDDKLPVGRNV 159
             VRRVPP FS PP  + EVML S LNLSC+AVGSPMP VKW KG   +LTP++++P+GRNV
Sbjct:   229 VRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSE-DLTPENEMPIGRNV 287

Query:   160 LTLDRVTESENYTCIAASVLGVIETSTIVKVQCKYAPLLTLPVAPLDVKISEVTATSVRL 219
             L L  + ES NYTCIAAS LG I++ ++VKVQ       +LP AP DV+ISEVTATSVRL
Sbjct:   288 LQLINIQESANYTCIAASTLGQIDSVSVVKVQ-------SLPTAPTDVQISEVTATSVRL 340

Query:   220 DWTYPS-ETLLYYVIQYKPKAANTPYSEISGIITTYYTVRNLSPYTEYEFYIIAVNNLGR 278
             +W+Y   E L YYVIQYKPK AN  +SEISGIIT YY VR LSPYTEYEFY+IAVNN+GR
Sbjct:   341 EWSYKGPEDLQYYVIQYKPKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGR 400

Query:   279 GPPSSPAVITTGETEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITA-KHHRRIG--- 334
             GPPS+PA  TTGET+  +APR+VQVR LSSSTMVI W+ PETPNGQ+T  K +       
Sbjct:   401 GPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQ 460

Query:   335 --------LVETYSLTG---LYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFG 383
                     +V+   LT    L P+ +Y + + A +  G G  + P+ V+ +Q   +    
Sbjct:   461 PEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSN 520

Query:   384 EQAAKHHRRIGLVETYSLTGLYPNTLYY--IWLAAQSPRGEGATTPPIPVRTKQYGKTPG 441
              +A         ++    T    N ++Y   W    + +             K+   +  
Sbjct:   521 FRATDIGETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHH----------KRISNSEA 570

Query:   442 FGEQALYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYEPGTAPRDVQVRPLSSSTMVIQ 501
             +    LYP+TLYYIWLAA+S RGEGATTPPIPVRTKQY PG  PR++     SS+T+ + 
Sbjct:   571 YTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNITAIATSSTTISLS 630

Query:   502 WDEP--ETPNGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAF 559
             W  P  E  NG+I  YKV++ +       A  T +  N     + +L   T Y I V A 
Sbjct:   631 WLPPPVERSNGRIIYYKVFFVEVGREDDEA--TTMTLNMTSIVLDELKRWTEYKIWVLAG 688

Query:   560 TSVGPGPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVTLAWSKPTHSGEN-II-SYELY 616
             TSVG GP S P++++TQ+ VP  P+D++A  +  T++ ++W  P     N II  Y ++
Sbjct:   689 TSVGDGPRSHPIILRTQEDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIH 747


GO:0006470 "protein dephosphorylation" evidence=NAS;IDA
GO:0005001 "transmembrane receptor protein tyrosine phosphatase activity" evidence=ISS
GO:0004725 "protein tyrosine phosphatase activity" evidence=NAS;IDA
GO:0005886 "plasma membrane" evidence=ISS;IDA
GO:0007411 "axon guidance" evidence=IMP;TAS
GO:0008045 "motor neuron axon guidance" evidence=IGI;NAS;IMP;TAS
GO:0016021 "integral to membrane" evidence=NAS
GO:0001700 "embryonic development via the syncytial blastoderm" evidence=NAS
GO:0048477 "oogenesis" evidence=IMP
GO:0007399 "nervous system development" evidence=IMP
GO:0007155 "cell adhesion" evidence=IMP
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0045467 "R7 cell development" evidence=IMP
GO:0008594 "photoreceptor cell morphogenesis" evidence=IMP
GO:0031290 "retinal ganglion cell axon guidance" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0030424 "axon" evidence=IDA
GO:0048841 "regulation of axon extension involved in axon guidance" evidence=IMP
GO:0048675 "axon extension" evidence=IMP
GO:0051124 "synaptic growth at neuromuscular junction" evidence=IMP
GO:0007412 "axon target recognition" evidence=IMP
GO:0032093 "SAM domain binding" evidence=IPI
GO:0005925 "focal adhesion" evidence=IDA
UNIPROTKB|F1N897 PTPRF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SMP3 PTPRD "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MJR2 PTPRD "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PH17 PTPRD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBJ4 PTPRF "Receptor-type tyrosine-protein phosphatase F" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P23468 PTPRD "Receptor-type tyrosine-protein phosphatase delta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3XAE2 PTPRD "Receptor-type tyrosine-protein phosphatase delta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQ48 F1NQ48 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1M2Y2 Ptprd "Protein Ptprd" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P16621LAR_DROME3, ., 1, ., 3, ., 4, 80.54950.46010.2050yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query904
cd0573969 cd05739, Ig3_RPTP_IIa_LAR_like, Third immunoglobul 5e-25
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 2e-18
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 6e-17
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 9e-17
pfam0004184 pfam00041, fn3, Fibronectin type III domain 6e-15
pfam0004184 pfam00041, fn3, Fibronectin type III domain 2e-13
smart0006083 smart00060, FN3, Fibronectin type 3 domain 4e-13
pfam0004184 pfam00041, fn3, Fibronectin type III domain 5e-13
smart0006083 smart00060, FN3, Fibronectin type 3 domain 6e-13
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 5e-12
smart0006083 smart00060, FN3, Fibronectin type 3 domain 2e-11
pfam0004184 pfam00041, fn3, Fibronectin type III domain 1e-09
smart0006083 smart00060, FN3, Fibronectin type 3 domain 2e-09
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 3e-09
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 7e-08
smart0041085 smart00410, IG_like, Immunoglobulin like 1e-07
smart0040985 smart00409, IG, Immunoglobulin 1e-07
pfam0004184 pfam00041, fn3, Fibronectin type III domain 2e-06
smart0040863 smart00408, IGc2, Immunoglobulin C-2 Type 4e-06
smart0006083 smart00060, FN3, Fibronectin type 3 domain 5e-06
cd0572569 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like 2e-05
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 3e-05
cd0009674 cd00096, Ig, Immunoglobulin domain 3e-04
pfam0004762 pfam00047, ig, Immunoglobulin domain 4e-04
cd0584993 cd05849, Ig1_Contactin-1, First Ig domain of conta 0.001
cd0572985 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) 0.002
cd0573171 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig 0.002
>gnl|CDD|143216 cd05739, Ig3_RPTP_IIa_LAR_like, Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
 Score = 98.8 bits (246), Expect = 5e-25
 Identities = 40/69 (57%), Positives = 51/69 (73%), Gaps = 1/69 (1%)

Query: 121 SPLNLSCVAVGSPMPFVKWRKGQNIELTPDDKLPVGRNVLTLDRVTESENYTCIAASVLG 180
             +NL+CVAVG+PMP+VKW KG   ELT +D++PVGRNVL L  + ES NYTC+A S LG
Sbjct: 2   GSVNLTCVAVGAPMPYVKWMKGG-EELTKEDEMPVGRNVLELTNIYESANYTCVAISSLG 60

Query: 181 VIETSTIVK 189
           +IE +  V 
Sbjct: 61  MIEATAQVT 69


Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR). Length = 69

>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|215677 pfam00047, ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143257 cd05849, Ig1_Contactin-1, First Ig domain of contactin-1 Back     alignment and domain information
>gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>gnl|CDD|143208 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 904
KOG4221|consensus 1381 100.0
KOG4221|consensus 1381 100.0
KOG3513|consensus1051 100.0
KOG3513|consensus1051 100.0
KOG4222|consensus 1281 100.0
KOG4222|consensus 1281 100.0
KOG0196|consensus 996 99.71
KOG0196|consensus 996 99.67
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.61
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.6
KOG4258|consensus1025 99.57
KOG4194|consensus873 99.56
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.46
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.45
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.44
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.44
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.42
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.4
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.38
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.37
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.37
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.36
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.35
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.35
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.34
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.34
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.34
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.33
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.33
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.32
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.32
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.32
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.31
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.31
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.3
PHA02785326 IL-beta-binding protein; Provisional 99.29
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.28
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.28
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.27
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.27
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.27
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.26
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.25
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.25
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.25
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.25
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.25
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.25
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.25
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.23
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.23
KOG4258|consensus1025 99.23
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.23
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.23
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.22
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.21
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.21
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.2
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.2
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.19
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.19
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.18
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.18
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.17
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.16
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.16
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.15
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.14
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.14
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.14
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.14
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.13
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.11
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.11
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.11
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.11
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.1
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.09
KOG4194|consensus873 99.09
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.08
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.07
PHA02785326 IL-beta-binding protein; Provisional 99.07
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.05
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.04
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 98.99
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 98.98
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 98.98
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 98.97
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 98.97
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 98.96
PHA02826227 IL-1 receptor-like protein; Provisional 98.95
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 98.95
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 98.93
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 98.93
PHA02826227 IL-1 receptor-like protein; Provisional 98.92
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 98.9
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 98.89
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 98.88
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 98.87
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 98.86
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 98.85
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 98.83
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 98.83
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 98.81
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.8
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 98.76
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 98.68
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.64
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 98.63
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 98.62
KOG4802|consensus516 98.59
smart0040863 IGc2 Immunoglobulin C-2 Type. 98.58
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 98.56
KOG4802|consensus516 98.56
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 98.55
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 98.48
COG3401343 Fibronectin type 3 domain-containing protein [Gene 98.46
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.4
smart0040986 IG Immunoglobulin. 98.38
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.38
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.37
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.36
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.29
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.28
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 98.28
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.2
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.2
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.18
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.11
KOG3632|consensus 1335 98.11
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.11
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.04
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.04
COG3401343 Fibronectin type 3 domain-containing protein [Gene 97.99
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 97.98
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.91
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 97.86
KOG4228|consensus 1087 97.85
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 97.8
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 97.8
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 97.79
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.76
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 97.75
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 97.74
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 97.74
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 97.7
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 97.69
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 97.66
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 97.63
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 97.61
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 97.58
KOG3515|consensus741 97.55
PHA02987189 Ig domain OX-2-like protein; Provisional 97.53
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 97.5
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 97.49
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 97.45
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 97.4
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 97.4
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 97.39
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 97.37
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 97.37
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 97.33
KOG4367|consensus699 97.31
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 97.27
KOG0613|consensus 1205 97.24
KOG4367|consensus699 97.18
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 97.18
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 97.12
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 97.12
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 97.09
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 97.09
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 97.08
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 97.07
KOG3632|consensus 1335 97.07
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 97.04
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 97.02
KOG4152|consensus830 97.0
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 97.0
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 96.96
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 96.92
KOG0613|consensus 1205 96.91
KOG3515|consensus741 96.89
KOG4228|consensus 1087 96.76
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 96.75
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 96.69
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 96.62
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 96.57
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 96.54
KOG4806|consensus454 96.52
KOG4152|consensus830 96.5
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 96.5
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 96.49
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 96.41
TIGR008642740 PCC polycystin cation channel protein. Note: this 96.27
COG4733952 Phage-related protein, tail component [Function un 96.27
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 96.25
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 96.24
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 96.22
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 96.22
PHA03376221 BARF1; Provisional 96.11
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 95.99
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 95.98
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 95.94
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 95.92
KOG4806|consensus454 95.9
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 95.9
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 95.88
cd0577093 IgC_beta2m Class I major histocompatibility comple 95.83
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 95.71
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 95.59
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 95.56
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 95.37
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 95.31
smart0040775 IGc1 Immunoglobulin C-Type. 95.19
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 95.12
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 94.82
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 94.81
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 94.63
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 94.58
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 94.47
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 94.36
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 94.34
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 94.2
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 94.19
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 94.14
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 94.11
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 93.99
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 93.95
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 93.93
smart0040681 IGv Immunoglobulin V-Type. 93.91
COG4733952 Phage-related protein, tail component [Function un 93.9
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 93.83
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 93.78
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 93.77
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 93.71
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 93.49
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 93.42
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 93.33
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 93.22
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 92.93
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 92.85
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 92.84
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 92.77
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 92.66
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 92.54
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 92.5
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 92.3
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 92.19
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 92.01
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 91.95
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 91.81
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 91.79
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 91.73
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 91.64
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 91.64
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 91.53
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 91.44
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 91.35
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 91.34
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 91.32
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 91.22
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 91.22
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 91.09
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 90.89
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 90.72
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 90.64
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 90.59
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 90.54
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 90.51
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 90.31
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 90.28
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 90.18
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 90.12
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 90.02
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 89.95
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 89.29
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 89.18
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 89.08
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 89.02
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 88.91
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 88.74
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 88.74
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 88.65
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 88.51
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 88.39
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 87.96
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 87.85
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 87.84
PHA0263363 hypothetical protein; Provisional 87.82
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 87.8
KOG4597|consensus560 87.77
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 87.71
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 87.61
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 87.58
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 87.26
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 87.13
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 86.93
KOG1948|consensus1165 86.82
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 86.78
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 86.64
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 86.53
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 86.44
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 86.23
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 86.17
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 86.11
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 85.25
PLN02533 427 probable purple acid phosphatase 84.97
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 84.58
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 84.47
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 84.21
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 83.97
KOG1225|consensus525 83.6
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 83.55
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 83.47
PLN02533 427 probable purple acid phosphatase 82.86
KOG1480|consensus909 82.71
PHA02865338 MHC-like TNF binding protein; Provisional 81.45
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 81.42
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 81.37
PHA02982251 hypothetical protein; Provisional 81.29
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 80.94
PHA03042286 CD47-like protein; Provisional 80.84
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 80.15
>KOG4221|consensus Back     alignment and domain information
Probab=100.00  E-value=2.2e-61  Score=522.32  Aligned_cols=818  Identities=22%  Similarity=0.298  Sum_probs=593.7

Q ss_pred             CcceeeeccceEEEEe--------cCCCCCcceeeEeeCCCCCCCCcEEEeccCCceEEEEeCCCC-----------CCC
Q psy8771           2 DTRCYVESPEEVFIIL--------CPLPPLIPGYILVTEPGTAPRDVQVRPLSSSTMVIQWDEPET-----------PNG   62 (904)
Q Consensus         2 ~~~~~~~~~~~~~~~~--------~~~~p~~~~~~~~~~p~~~p~~l~~~~~~~~s~~v~W~~~~~-----------~~g   62 (904)
                      .|||.+... ++-.|+        ..+++--++.+..+.-.+.+.-+.|..-.++...|.|.+...           ++|
T Consensus       115 ~Yqc~atv~-~~gsi~Sr~a~v~~a~~~~f~~~~~~~t~~~g~ta~f~c~vn~e~~p~i~w~kn~~pl~~~~r~i~lpsG  193 (1381)
T KOG4221|consen  115 VYQCLATVE-DVGSILSRTAKVALAGLADFALQPESTTLLYGQTALFSCEVNAEPVPTIMWLKNDQPLPLDSRVIVLPSG  193 (1381)
T ss_pred             eEEEEEEcc-ccceeecceEEEEecccCccccCccceeEecCCcEEEEEEEcCccCceeEEecccccccCCCcEEEcCCC
Confidence            489999887 333333        335555556555555555788888888888888999987754           266


Q ss_pred             ceecccccccccc-eEEEEeeeccCCeeeeeeeecc-CCCCCCCCeEEcCCCCceEEecCCCeEEEEEEccCCCCeEEEe
Q psy8771          63 QITHPPTRAARSH-ARLAAQSVLRRGRLAHAVRQVA-DPVRRVPPQFSIPPPALLEVMLDSPLNLSCVAVGSPMPFVKWR  140 (904)
Q Consensus        63 ~i~~~~~~~~~~~-~~~~~~~~~~~g~~~~~~~~v~-~~~~~~~P~~~~~~~~~~~~~~g~~~~l~C~~~g~p~p~i~W~  140 (904)
                      .+....+.+.+.+ .++++..+...+...++.+.+. ++....--.|...|.+ .++.+|+++.|+|.+.|.|+|.|.|.
T Consensus       194 ~L~I~~~qp~d~g~yrc~vt~g~~~r~S~~a~ltv~s~~~~~~~~~fl~~p~~-~~v~~g~~v~leCvvs~~p~p~v~Wl  272 (1381)
T KOG4221|consen  194 ALEISGLQPSDTGEYRCVVTGGASQRTSNEAELTVLSDPGALNKLVFLDEPSN-AVVVEGDDVVLECVVSGVPKPSVKWL  272 (1381)
T ss_pred             cEEecccccCCCceEEEEEecCCcCCccceeEEEecCCcccccceeeecCCCc-cccccCCcEEEEEEecCCCCCceEEe
Confidence            6666666666433 3444444444444445555554 3323333337888888 99999999999999999999999999


Q ss_pred             eCCccccC-CCCceee-cceEEEEeee--cCCeEEEEEEEecCcceEEEEEEEEEeecCCCCCCCCCCcceEEEeecCCe
Q psy8771         141 KGQNIELT-PDDKLPV-GRNVLTLDRV--TESENYTCIAASVLGVIETSTIVKVQCKYAPLLTLPVAPLDVKISEVTATS  216 (904)
Q Consensus       141 k~~~~~~~-~~~~~~~-~~~~l~i~~l--~d~g~Y~c~a~n~~g~~~~~~~l~v~~~~~~~~~~P~~p~~l~~~~~~~~s  216 (904)
                      || +..+. ++.|+.. ..++|.|.++  .|+|.|+|+|.|......+++.|.|+.+    ...+..|.++...+    +
T Consensus       273 rn-g~~i~~ds~rivl~g~~slliS~a~~~dSg~YtC~Atn~~D~idasaev~V~a~----P~~~~~p~~l~A~e----~  343 (1381)
T KOG4221|consen  273 RN-GEKISVDSYRIVLVGGSSLLISNATDDDSGKYTCRATNTNDSIDASAEVTVLAP----PGFTKAPTTLVAHE----S  343 (1381)
T ss_pred             eC-CeeeeecceEEEEecccceEEeccccccCceEEEEecCCCcccccceEEEEEcC----CCCCCCCcceeeee----c
Confidence            99 66554 3445543 6889999999  5899999999998888899999999922    23344666665433    6


Q ss_pred             EEEEEeCC--CccceEEEEEEEeCC-CCCCeEEeecceeceEEEcCCCCCCeEEEEEEEEcCCCCCCCCCCeEEecCCC-
Q psy8771         217 VRLDWTYP--SETLLYYVIQYKPKA-ANTPYSEISGIITTYYTVRNLSPYTEYEFYIIAVNNLGRGPPSSPAVITTGET-  292 (904)
Q Consensus       217 v~l~W~~~--~~~~~~y~v~~~~~~-~~~~~~~~~~~~~~~~~i~~L~p~~~Y~~~v~a~n~~g~s~~s~~~~~~t~~~-  292 (904)
                      ..++|+.+  +.++..|++....+- ....+..+.+.. . +.|.++-..++..|+|.|.|+.|....+..+.+...+. 
T Consensus       344 ~die~ec~~~g~p~p~v~w~kNgd~~ipsdy~ki~~~~-~-lrIlgi~~sdeg~yQcvaen~~G~a~a~a~l~vv~~p~~  421 (1381)
T KOG4221|consen  344 MDIEFECPVSGKPIPTVRWYKNGDRIIPSDYFKIVGGG-N-LRILGIVKSDEGFYQCVAENDAGSAQAAAQLEVVPQPAS  421 (1381)
T ss_pred             cceeEeCCCCCCCcceEEEEecCcccCcccceEecCCC-C-cEEEEEecccchhhhhhhccCcccccchhhheeccCCcc
Confidence            67888877  555665554433210 012333343332 2 78888888888888999999999876665554443322 


Q ss_pred             ----CCCCCCCceEecccCCCeeEEEecCCCCCCceeeEEEEEeec-------------eeEEEEEcCCCCCcEEEEEEE
Q psy8771         293 ----EPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITAKHHRRIG-------------LVETYSLTGLYPNTLYYIWLA  355 (904)
Q Consensus       293 ----~p~~~p~~l~~~~~~~~~v~l~W~~p~~~~~~~~~~~~~~~~-------------~~~~~~~~~L~~~~~Y~v~v~  355 (904)
                          .-+..|..+.+...+.+.+.++|.+|...++.+..|.+....             ......+..|.+.+.|.|+|.
T Consensus       422 ~~s~~~~sap~~lv~~~~~srfi~~tw~~p~~~~g~i~~~~v~~~~~~~~rer~~~tss~g~~~tv~nl~p~t~Y~~rv~  501 (1381)
T KOG4221|consen  422 ASSDLLPSAPRDLVANLVSSRFIQLTWRPPAQISGNISTYTVFYKVEGDVRERLQNTSSPGIQVTVQNLSPLTMYFFRVR  501 (1381)
T ss_pred             cccCccccCCcceecccccceeEEEeecCccccCCCcceEEEEEecCCchhhhheeccCCceEEEeeecccceeEEEEEe
Confidence                224678899999999999999999888777777776543321             114678899999999999999


Q ss_pred             EEcCCCCCCCCCCcceeeccCCCCCCCCcccccccccceeeeEEEEecc------ccCcEEEEEEeeecCCCCCCCCCCc
Q psy8771         356 AQSPRGEGATTPPIPVRTKQYGKTPGFGEQAAKHHRRIGLVETYSLTGL------YPNTLYYIWLAAQSPRGEGATTPPI  429 (904)
Q Consensus       356 a~~~~g~~~~s~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~y~~~~~~~~~~g~~~~~~~~  429 (904)
                      |.|..|.+.++.++.+.+...++.. +....       .......+.+-      .+...|.+.+.-.+.          
T Consensus       502 A~n~~g~g~sS~pLkV~t~pEgp~~-~~a~a-------ts~~ti~v~WepP~~~n~~I~~yk~~ys~~~~----------  563 (1381)
T KOG4221|consen  502 AKNEAGSGESSAPLKVTTQPEGPVQ-LQAYA-------TSPTTILVTWEPPPFGNGPITGYKLFYSEDDT----------  563 (1381)
T ss_pred             ccCcccCCccCCceEEecCCCCCcc-ccccc-------cCcceEEEEecCCCCCCCCceEEEEEEEcCCC----------
Confidence            9999999999999999987653222 11000       00111111111      233455555443211          


Q ss_pred             ceEeeccCCCCceeeeeccCCeEEEEEEEEeeCCCCCCCCCCceeeecCCCCCCCCCCeEEEecCCceEEEEecCCC--C
Q psy8771         430 PVRTKQYGKTPGFGEQALYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYEPGTAPRDVQVRPLSSSTMVIQWDEPE--T  507 (904)
Q Consensus       430 ~~~~~~~~~~~~~~~~~L~p~~~Y~~~v~a~~~~g~~~~s~~~~~~t~~~~p~~~p~~l~v~~~~~~~~~l~W~~p~--~  507 (904)
                      ...........+++|.||++.|+|.|+|.|+|..|.|..|..+.+.|..+.|..||.||++...++++|+|+|.+|.  .
T Consensus       564 ~~~~~~~~n~~e~ti~gL~k~TeY~~~vvA~N~~G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t  643 (1381)
T KOG4221|consen  564 GKELRVENNATEYTINGLEKYTEYSIRVVAYNSAGSGVSSADITVRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSET  643 (1381)
T ss_pred             CceEEEecCccEEEeecCCCccceEEEEEEecCCCCCCCCCceEEEeccCCCCCCCcceEEEecCCCeEEEEccCCCccc
Confidence            11333445678899999999999999999999999999999999999999999999999999999999999999964  3


Q ss_pred             CCCceeeEEEEEEeCCCCCCcceEEEeecCceEEEEcCCCCCCeEEEEEEEEeCCCCCCCCCcEEEecCCCC-----CCC
Q psy8771         508 PNGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVGPGPLSAPVLVKTQQGV-----PSQ  582 (904)
Q Consensus       508 ~~~~i~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~t~Y~~~V~a~~~~g~~~~S~~~~~~t~~~~-----p~~  582 (904)
                      .+|.+.+|+|+|+.........|. ...++.+.+.+.+|+|++.|.|+|.|.+..|.|+.|++..+.|+...     |.+
T Consensus       644 ~ng~itgYkIRy~~~~~~~~~~~t-~v~~n~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w~~aeT~~~d~~e~vp~~  722 (1381)
T KOG4221|consen  644 QNGQITGYKIRYRKLSREDEVNET-VVKGNTTQYLFNGLEPNTQYRVRISAMTVNGTGPASEWVSAETPESDLDERVPGK  722 (1381)
T ss_pred             ccceEEEEEEEecccCccccccee-ecccchhhhHhhcCCCCceEEEEEEEeccCCCCCcccceeccCccccccccCCCC
Confidence            568999999999977644333332 22247788999999999999999999999999999999999987643     334


Q ss_pred             CCCceEEecCCCeEEEEEeCCCCCCCCceEEEEEeccCCCCCcceEEEeeccceEEEeccCCCCCCCceeeEEEEEEeCC
Q psy8771         583 PRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTY  662 (904)
Q Consensus       583 p~~~~~~~~~~~~~~l~W~~~~~~~~~~~~y~v~~~~~~~~p~~l~~~~~~~~~~~l~w~~~~~~~~~~~~y~v~~~~~~  662 (904)
                      |..|.+.. ..++|.++|.++.+                                         .+-.+.+|+|.|+...
T Consensus       723 ps~l~~~~-g~~si~vsW~Pp~~-----------------------------------------~~~~vrgY~ig~r~g~  760 (1381)
T KOG4221|consen  723 PSELHVHP-GSNSIVVSWTPPPH-----------------------------------------PNIVVRGYKIGYRPGS  760 (1381)
T ss_pred             Cceeeecc-CceeEEEEeCCCCC-----------------------------------------hhhhhcceEEeeeccc
Confidence            55555544 67789999999876                                         4456778888885443


Q ss_pred             ccc--cceEEecccceEEEeCCCCCcEEEEEEEEEcCCCCCCCCC-CeeEEecCC------CCCCCCCCcEEEecCCCEE
Q psy8771         663 AKA--KHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTP-PIPVRTKQY------VPGAPPQNVSCEPLSSTSI  733 (904)
Q Consensus       663 ~~~--~~~~~~~~~~~~~l~~L~p~t~Y~v~V~a~~~~G~~~~s~-~~~~~t~~~------~p~~~P~~l~~~~~~~~~v  733 (904)
                      +..  ...........|.|..|.++..|.|+++|+|..|.|.+.. .+.+++...      .|..+|..+++...+.++|
T Consensus       761 ~~p~~~tIrl~~~~s~y~l~~Le~~~~YvVkL~AfNn~gdG~p~y~~~~tR~~~~~~~~v~tp~~ppvgv~A~~~S~tsI  840 (1381)
T KOG4221|consen  761 GIPDTGTIRLDEKVSYYNLEQLEPNRDYVVKLRAFNNHGDGNPIYESVKTRSATDPTSPVDTPMLPPVGVRANALSSTSI  840 (1381)
T ss_pred             CCCCCccEEecceeeEEEEEecccCceEEEEEEEeccCCCCcceeeeeeeccCCCcCCcCCCCCCCcccccccccccceE
Confidence            332  2445556678999999999999999999999999997642 233332111      2555778888888999999


Q ss_pred             EEEecCCCCCCCCccEEEEEEEEEEccCCCCccEEEEecCcceEEecCCCCCceEEEEEEEee-CCCCCCCCCcEEeecC
Q psy8771         734 RISWEPPPVERSNGHIVYYKLQFVETGRSDSEASIVTLKNQTSFVLDELKKWTEYRIWVLAGT-SIGDGPSSYPITIRTH  812 (904)
Q Consensus       734 ~l~W~~~~~~~~~g~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~a~~-~~g~g~~s~~~~~~t~  812 (904)
                      .+.|..-. +. -.....|.|.|...+-.....-+.......++.+.+|+|.+.|+|.|.++- ....|.+|..+..+|.
T Consensus       841 ~v~w~~~~-~~-t~~~~~yTVr~~~~gi~~~~~~~~~~~t~ls~~v~glkpnt~yEfav~~~~~~~r~stwsmsv~~~tl  918 (1381)
T KOG4221|consen  841 RVTWADNK-DQ-TTDNRIYTVRWSLTGIRNGTLYRYDNSTDLSYLVGGLKPNTPYEFAVMVVKRNRRESTWSMSVENRTL  918 (1381)
T ss_pred             EEEEecCC-Cc-cccceEEEEEEeecccccceeEEEecccccceeccCcCcCChhhhhhhhhhccCcCCcccceeeeeec
Confidence            99999731 12 335788999998544222222233333888999999999999999999887 4557888999999998


Q ss_pred             CCCCCC------------CccCCcceeeCCCCCceeeeeeeecCC--------ceEEecCCCeeEEEEcCCCCCcEEEEE
Q psy8771         813 EDDPSE------------VCPTQNDFRKNKKTNGSNFKGGYLNDP--------MRFDVSDGGALELNVTGLQPDTIYTIQ  872 (904)
Q Consensus       813 ~~~P~~------------v~~~~~~W~~p~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~i~~L~p~t~Y~~~  872 (904)
                      +..|..            ...+.+.|.+|...||.|..|.+.+..        .......+....+.+.+|.+++.|.|+
T Consensus       919 e~~P~sPP~d~tv~p~e~P~~v~v~WqPp~e~nG~I~~Yii~Ys~~~n~~~~dWt~~t~~g~~L~~~v~~l~p~t~yffk  998 (1381)
T KOG4221|consen  919 ELVPSSPPRDLTVQPDEKPTTVIVHWQPPTEPNGEITEYIIYYSTDGNTPEHDWTIETTAGAELSHQVPNLDPDTGYFFK  998 (1381)
T ss_pred             ccCCCCCChhceecccCCCCccccccCCCcCCCCceeeEEEEEecCCCCchhhceeeecccchhhhccCCCCCCCceEEE
Confidence            876632            122334999999999998876654321        112235677889999999999999999


Q ss_pred             EEEEecCCCCCCCCceEEecCCC
Q psy8771         873 VAALTRKGDGDRSKPETIKTPGG  895 (904)
Q Consensus       873 v~a~n~~G~g~~s~~~~~~t~~~  895 (904)
                      |+|.|..|.|+.|..+.+.|...
T Consensus       999 iQAr~~kG~gp~s~~v~y~t~~~ 1021 (1381)
T KOG4221|consen  999 IQARNEKGPGPFSSPVLYETSKA 1021 (1381)
T ss_pred             EEeeccCCCCccccceeeecccc
Confidence            99999999999999999888765



>KOG4221|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query904
2dlh_A121 Solution Structure Of The Second Fn3 Domain Of Huma 4e-26
2dlh_A121 Solution Structure Of The Second Fn3 Domain Of Huma 1e-05
2edx_A134 Solution Structures Of The Fn3 Domain Of Human Rece 5e-20
2yd9_A304 Crystal Structure Of The N-Terminal Ig1-3 Module Of 1e-19
2dju_A106 Solution Structures Of The Fn3 Domain Of Human Rece 4e-17
2ede_A114 Solution Structure Of The Sixth Fibronectin Type Ii 1e-12
1x5h_A132 The Solution Structure Of The Third Fibronectin Typ 1e-11
1va9_A122 Solution Structure Of The Second Fniii Domain Of Ds 2e-11
2ed9_A124 Solution Structure Of The Third Fibronectin Type Ii 5e-11
3p4l_A211 Crystal Structure Of A Hemojuvelin-Binding Fragment 1e-10
3p4l_A211 Crystal Structure Of A Hemojuvelin-Binding Fragment 5e-04
1x5z_A115 Solution Structure Of The Fibronectin Type-Iii Doma 2e-09
1x5z_A115 Solution Structure Of The Fibronectin Type-Iii Doma 8e-04
1x5k_A124 The Solution Structure Of The Sixth Fibronectin Typ 4e-09
3f7p_C248 Crystal Structure Of A Complex Between Integrin Bet 2e-08
3f7p_C248 Crystal Structure Of A Complex Between Integrin Bet 2e-05
3f7r_A249 First Pair Of Fibronectin Type Iii Domains And Part 2e-08
3f7r_A249 First Pair Of Fibronectin Type Iii Domains And Part 2e-05
3f7q_A234 First Pair Of Fibronectin Type Iii Domains And Part 4e-08
3f7q_A234 First Pair Of Fibronectin Type Iii Domains And Part 2e-05
1qg3_A195 Crystal Structure Of A Tandem Pair Of Fibronectin T 6e-08
1qg3_A195 Crystal Structure Of A Tandem Pair Of Fibronectin T 1e-05
1fnf_A368 Fragment Of Human Fibronectin Encompassing Type-Iii 1e-07
1fnf_A368 Fragment Of Human Fibronectin Encompassing Type-Iii 1e-05
1fnf_A368 Fragment Of Human Fibronectin Encompassing Type-Iii 2e-05
2nzi_A305 Crystal Structure Of Domains A168-A170 From Titin L 9e-07
2edy_A103 Solution Structures Of The Fn3 Domain Of Human Rece 2e-06
2ed7_A119 Solution Structure Of The First Fibronectin Type Ii 2e-06
1uey_A127 Solution Structure Of The First Fibronectin Type Ii 5e-06
2jll_A389 Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 5e-06
1mfn_A184 Solution Nmr Structure Of Linked Cell Attachment Mo 8e-06
1mfn_A184 Solution Nmr Structure Of Linked Cell Attachment Mo 1e-05
1x5f_A120 The Solution Structure Of The First Fibronectin Typ 8e-06
1x5g_A116 The Solution Structure Of The Second Fibronectin Ty 8e-06
2xyc_A291 Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 9e-06
3r8q_A290 Structure Of Fibronectin Domain 12-14 Length = 290 2e-05
1fnh_A271 Crystal Structure Of Heparin And Integrin Binding S 2e-05
1x5l_A111 Solution Structure Of The Second Fn3 Domain Of Eph 3e-05
2v5y_A731 Crystal Structure Of The Receptor Protein Tyrosine 3e-05
3lpw_A197 Crystal Structure Of The Fniii-Tandem A77-A78 From 1e-04
3lpw_A197 Crystal Structure Of The Fniii-Tandem A77-A78 From 3e-04
3lcy_A197 Titin Ig Tandem Domains A164-A165 Length = 197 2e-04
2ck2_A96 Structure Of Core-Swapped Mutant Of Fibronectin Len 3e-04
2eo9_A118 Solution Structure Of The Fifth Ig-Like Domain From 4e-04
2vkx_A209 Human Ncam, Fn3 Domains 1 And 2, M610r Mutant Lengt 4e-04
2vkw_A209 Human Ncam, Fn3 Domains 1 And 2 Length = 209 4e-04
3t1w_A375 Structure Of The Four-Domain Fragment Fn7b89 Of Onc 5e-04
2haz_A105 Crystal Structure Of The First Fibronectin Domain O 5e-04
4gh7_B285 Crystal Structure Of Anticalin N7a In Complex With 5e-04
2e3v_A122 Crystal Structure Of The First Fibronectin Type Iii 5e-04
2ed8_A106 Solution Structure Of The Second Fibronectin Type I 6e-04
1bqu_A215 Cytokyne-Binding Region Of Gp130 Length = 215 7e-04
3mtr_A215 Crystal Structure Of The Ig5-Fn1 Tandem Of Human Nc 7e-04
3l5h_A589 Crystal Structure Of The Full Ectodomain Of Human G 7e-04
1wfn_A119 The Fourth Fn3 Domain Of Human Sidekick-2 Length = 8e-04
1pvh_A201 Crystal Structure Of Leukemia Inhibitory Factor In 9e-04
>pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 Back     alignment and structure

Iteration: 1

Score = 116 bits (291), Expect = 4e-26, Method: Compositional matrix adjust. Identities = 55/115 (47%), Positives = 79/115 (68%) Query: 464 GEGATTPPIPVRTKQYEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQITGYKVYYTQDQ 523 G ++ P+ +T + P +APRDVQ R LSS+T+++QW EPE PNGQI GY+VYYT D Sbjct: 1 GSSGSSGPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDP 60 Query: 524 SLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVGPGPLSAPVLVKTQQG 578 + ++ W V ++Q+TTI +L P Y+++V AFTS+G GPLS+ + V TQ G Sbjct: 61 TQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG 115
>pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 Back     alignment and structure
>pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 Back     alignment and structure
>pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 Back     alignment and structure
>pdb|2DJU|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 106 Back     alignment and structure
>pdb|2EDE|A Chain A, Solution Structure Of The Sixth Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 114 Back     alignment and structure
>pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 Back     alignment and structure
>pdb|1VA9|A Chain A, Solution Structure Of The Second Fniii Domain Of Dscaml1 Protein Length = 122 Back     alignment and structure
>pdb|2ED9|A Chain A, Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 124 Back     alignment and structure
>pdb|3P4L|A Chain A, Crystal Structure Of A Hemojuvelin-Binding Fragment Of Neogenin Length = 211 Back     alignment and structure
>pdb|3P4L|A Chain A, Crystal Structure Of A Hemojuvelin-Binding Fragment Of Neogenin Length = 211 Back     alignment and structure
>pdb|1X5Z|A Chain A, Solution Structure Of The Fibronectin Type-Iii Domain Of Human Protein Tyrosine Phosphatase, Receptor Type, D Isoform 4 Variant Length = 115 Back     alignment and structure
>pdb|1X5Z|A Chain A, Solution Structure Of The Fibronectin Type-Iii Domain Of Human Protein Tyrosine Phosphatase, Receptor Type, D Isoform 4 Variant Length = 115 Back     alignment and structure
>pdb|1X5K|A Chain A, The Solution Structure Of The Sixth Fibronectin Type Iii Domain Of Human Neogenin Length = 124 Back     alignment and structure
>pdb|3F7P|C Chain C, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 248 Back     alignment and structure
>pdb|3F7P|C Chain C, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 248 Back     alignment and structure
>pdb|3F7R|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 249 Back     alignment and structure
>pdb|3F7R|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 249 Back     alignment and structure
>pdb|3F7Q|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 234 Back     alignment and structure
>pdb|3F7Q|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 234 Back     alignment and structure
>pdb|1QG3|A Chain A, Crystal Structure Of A Tandem Pair Of Fibronectin Type Iii Domains From The Cytoplasmic Tail Of Integrin Alpha6 Beta4 Length = 195 Back     alignment and structure
>pdb|1QG3|A Chain A, Crystal Structure Of A Tandem Pair Of Fibronectin Type Iii Domains From The Cytoplasmic Tail Of Integrin Alpha6 Beta4 Length = 195 Back     alignment and structure
>pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 Back     alignment and structure
>pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 Back     alignment and structure
>pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 Back     alignment and structure
>pdb|2NZI|A Chain A, Crystal Structure Of Domains A168-A170 From Titin Length = 305 Back     alignment and structure
>pdb|2EDY|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 103 Back     alignment and structure
>pdb|2ED7|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 119 Back     alignment and structure
>pdb|1UEY|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Kiaa0343 Protein Length = 127 Back     alignment and structure
>pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 Back     alignment and structure
>pdb|1MFN|A Chain A, Solution Nmr Structure Of Linked Cell Attachment Modules Of Mouse Fibronectin Containing The Rgd And Synergy Regions, 20 Structures Length = 184 Back     alignment and structure
>pdb|1MFN|A Chain A, Solution Nmr Structure Of Linked Cell Attachment Modules Of Mouse Fibronectin Containing The Rgd And Synergy Regions, 20 Structures Length = 184 Back     alignment and structure
>pdb|1X5F|A Chain A, The Solution Structure Of The First Fibronectin Type Iii Domain Of Human Neogenin Length = 120 Back     alignment and structure
>pdb|1X5G|A Chain A, The Solution Structure Of The Second Fibronectin Type Iii Domain Of Human Neogenin Length = 116 Back     alignment and structure
>pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 Back     alignment and structure
>pdb|3R8Q|A Chain A, Structure Of Fibronectin Domain 12-14 Length = 290 Back     alignment and structure
>pdb|1FNH|A Chain A, Crystal Structure Of Heparin And Integrin Binding Segment Of Human Fibronectin Length = 271 Back     alignment and structure
>pdb|1X5L|A Chain A, Solution Structure Of The Second Fn3 Domain Of Eph Receptor A8 Protein Length = 111 Back     alignment and structure
>pdb|2V5Y|A Chain A, Crystal Structure Of The Receptor Protein Tyrosine Phosphatase Mu Ectodomain Length = 731 Back     alignment and structure
>pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 Back     alignment and structure
>pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 Back     alignment and structure
>pdb|3LCY|A Chain A, Titin Ig Tandem Domains A164-A165 Length = 197 Back     alignment and structure
>pdb|2CK2|A Chain A, Structure Of Core-Swapped Mutant Of Fibronectin Length = 96 Back     alignment and structure
>pdb|2EO9|A Chain A, Solution Structure Of The Fifth Ig-Like Domain From Human Roundabout Homo1 Length = 118 Back     alignment and structure
>pdb|2VKX|A Chain A, Human Ncam, Fn3 Domains 1 And 2, M610r Mutant Length = 209 Back     alignment and structure
>pdb|2VKW|A Chain A, Human Ncam, Fn3 Domains 1 And 2 Length = 209 Back     alignment and structure
>pdb|3T1W|A Chain A, Structure Of The Four-Domain Fragment Fn7b89 Of Oncofetal Fibronectin Length = 375 Back     alignment and structure
>pdb|2HAZ|A Chain A, Crystal Structure Of The First Fibronectin Domain Of Human Ncam1 Length = 105 Back     alignment and structure
>pdb|4GH7|B Chain B, Crystal Structure Of Anticalin N7a In Complex With Oncofetal Fibronectin Fragment Fn7b8 Length = 285 Back     alignment and structure
>pdb|2E3V|A Chain A, Crystal Structure Of The First Fibronectin Type Iii Domain Of Neural Cell Adhesion Molecule Splicing Isoform From Human Muscle Culture Lambda-4.4 Length = 122 Back     alignment and structure
>pdb|2ED8|A Chain A, Solution Structure Of The Second Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 106 Back     alignment and structure
>pdb|1BQU|A Chain A, Cytokyne-Binding Region Of Gp130 Length = 215 Back     alignment and structure
>pdb|3MTR|A Chain A, Crystal Structure Of The Ig5-Fn1 Tandem Of Human Ncam Length = 215 Back     alignment and structure
>pdb|3L5H|A Chain A, Crystal Structure Of The Full Ectodomain Of Human Gp130: New Insights Into The Molecular Assembly Of Receptor Complexes Length = 589 Back     alignment and structure
>pdb|1WFN|A Chain A, The Fourth Fn3 Domain Of Human Sidekick-2 Length = 119 Back     alignment and structure
>pdb|1PVH|A Chain A, Crystal Structure Of Leukemia Inhibitory Factor In Complex With Gp130 Length = 201 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query904
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 7e-67
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-48
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-41
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-32
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-23
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-16
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 1e-60
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-51
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 1e-45
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 5e-37
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 3e-26
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 5e-20
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-17
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-60
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-59
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-54
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-51
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 7e-45
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 5e-57
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-51
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 4e-43
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 4e-39
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 8e-32
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-29
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-20
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 6e-18
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-52
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-35
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-30
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 1e-24
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 3e-20
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 6e-52
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 9e-49
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-44
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-29
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-26
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 4e-19
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-18
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 5e-50
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 2e-33
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 2e-32
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 2e-31
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 8e-15
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 7e-11
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 6e-50
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 5e-48
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 6e-35
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 8e-27
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 1e-16
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-49
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 6e-41
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-31
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-29
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-28
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-22
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-16
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 4e-44
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 4e-39
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 9e-37
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 3e-36
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 1e-35
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 2e-18
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 4e-18
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 2e-04
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-42
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 4e-38
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 5e-38
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-37
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 3e-35
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 3e-14
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-42
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-41
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 8e-34
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-29
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-25
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-17
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 5e-15
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 4e-41
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 3e-12
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-10
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-10
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 1e-06
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 2e-39
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 4e-30
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 7e-24
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 2e-15
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 5e-14
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 3e-10
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 5e-08
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 2e-39
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 3e-32
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 2e-23
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 8e-19
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 4e-14
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 9e-12
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 6e-05
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 4e-39
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-33
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 3e-20
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-15
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 2e-14
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 6e-12
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-04
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 5e-04
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 5e-38
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 9e-32
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-27
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-21
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-18
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-17
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 4e-04
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 8e-38
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 3e-36
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 1e-20
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 6e-20
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 2e-19
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 2e-11
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 1e-07
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 6e-05
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-35
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 5e-31
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 7e-21
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 3e-13
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 7e-12
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 6e-10
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 3e-05
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-35
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-31
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 6e-31
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-26
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 7e-26
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 1e-04
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 7e-35
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 2e-33
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 7e-19
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 5e-16
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 9e-13
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 2e-08
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 8e-05
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-33
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-29
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-27
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-24
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 2e-20
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-04
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 2e-32
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 7e-13
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 3e-10
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 3e-05
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 3e-04
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 2e-32
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-21
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-15
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 2e-13
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-10
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 2e-07
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 5e-05
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 8e-32
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 1e-28
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 2e-21
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 3e-18
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 5e-17
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 1e-10
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 3e-05
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 2e-31
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 6e-25
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 2e-15
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 2e-14
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 2e-10
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 5e-08
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 8e-05
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 2e-31
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 2e-29
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 1e-15
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 8e-10
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 1e-09
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 1e-08
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 4e-31
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 7e-28
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 5e-16
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 7e-13
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 4e-11
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 3e-10
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 6e-04
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 5e-31
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 4e-29
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 8e-27
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-23
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 7e-19
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 3e-16
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 7e-31
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 3e-30
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 5e-20
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 4e-18
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 2e-16
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 4e-07
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 1e-04
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-30
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-28
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 2e-25
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 4e-20
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 8e-18
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 4e-16
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 2e-30
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 1e-27
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 7e-15
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 3e-14
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 4e-11
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 1e-07
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 5e-05
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 2e-30
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 6e-25
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 9e-19
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 6e-17
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 1e-15
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 4e-07
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 1e-04
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 6e-30
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 5e-29
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 2e-17
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 1e-13
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 2e-11
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 6e-06
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 2e-05
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-29
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 4e-29
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-24
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-22
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-20
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-13
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 2e-29
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 9e-27
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 8e-24
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 3e-20
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 2e-18
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 9e-09
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 7e-05
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 6e-29
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 4e-18
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 5e-14
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 3e-13
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 2e-10
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 1e-06
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 7e-04
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 1e-28
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 5e-22
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 8e-16
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 3e-14
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 1e-11
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 1e-07
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 2e-04
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 1e-28
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 6e-28
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 4e-17
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 3e-16
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 3e-14
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 1e-06
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 2e-05
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 3e-28
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 3e-27
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 2e-17
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 2e-16
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 1e-14
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 2e-11
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 9e-05
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 4e-28
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 7e-25
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 5e-19
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 5e-14
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 9e-13
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-06
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 6e-28
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 3e-27
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 3e-23
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 4e-18
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 7e-18
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 2e-27
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 2e-23
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 3e-16
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 2e-15
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 3e-14
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 4e-07
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 5e-05
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 5e-27
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 1e-23
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 3e-12
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 4e-09
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 6e-08
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 5e-07
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 6e-27
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 3e-12
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 3e-12
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 1e-06
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 4e-26
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 9e-26
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 4e-23
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 1e-16
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 8e-04
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 6e-26
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 2e-21
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 1e-19
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 3e-15
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 9e-10
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 1e-25
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 6e-22
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 3e-15
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 3e-14
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 4e-14
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 6e-05
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 2e-24
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 1e-22
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 5e-15
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 4e-13
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 4e-13
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 9e-06
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 4e-24
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 2e-21
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 1e-14
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 2e-13
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 3e-13
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 3e-06
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 3e-23
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 3e-13
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 1e-12
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 4e-10
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 8e-06
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 6e-05
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 7e-23
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 5e-22
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 5e-19
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 3e-16
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 7e-12
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 7e-07
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 1e-22
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 6e-15
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 9e-12
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 3e-10
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 3e-10
3bpo_C 314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 2e-07
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 7e-06
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 2e-22
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 4e-21
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 1e-20
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 1e-12
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 2e-11
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 2e-05
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 3e-22
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 2e-21
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 2e-21
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 4e-13
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 1e-11
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 8e-07
1x5x_A109 Fibronectin type-III domain containing protein 3A; 3e-22
1x5x_A109 Fibronectin type-III domain containing protein 3A; 2e-10
1x5x_A109 Fibronectin type-III domain containing protein 3A; 2e-08
1x5x_A109 Fibronectin type-III domain containing protein 3A; 3e-06
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 4e-22
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 1e-21
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 3e-18
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 5e-17
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-14
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-13
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-05
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-21
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-13
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 2e-10
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 4e-09
1x3d_A118 Fibronectin type-III domain containing protein 3A; 3e-21
1x3d_A118 Fibronectin type-III domain containing protein 3A; 2e-13
1x3d_A118 Fibronectin type-III domain containing protein 3A; 4e-11
1x3d_A118 Fibronectin type-III domain containing protein 3A; 4e-08
1x3d_A118 Fibronectin type-III domain containing protein 3A; 9e-06
2gys_A419 Cytokine receptor common beta chain; dimer of inte 5e-21
2gys_A419 Cytokine receptor common beta chain; dimer of inte 4e-12
2gys_A419 Cytokine receptor common beta chain; dimer of inte 2e-11
2gys_A419 Cytokine receptor common beta chain; dimer of inte 2e-04
3t04_D103 Monobody 7C12; engineered binding protein, antibod 1e-20
3t04_D103 Monobody 7C12; engineered binding protein, antibod 3e-20
3t04_D103 Monobody 7C12; engineered binding protein, antibod 8e-18
3t04_D103 Monobody 7C12; engineered binding protein, antibod 9e-11
3t04_D103 Monobody 7C12; engineered binding protein, antibod 1e-10
3t04_D103 Monobody 7C12; engineered binding protein, antibod 1e-04
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 3e-20
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 2e-10
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 3e-09
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 4e-05
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 3e-20
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 5e-15
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 1e-12
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 9e-08
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 2e-06
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 3e-20
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 6e-14
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 8e-13
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 7e-08
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 1e-06
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 4e-04
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 3e-20
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 3e-16
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 9e-13
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 5e-07
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 6e-20
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 1e-12
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 4e-12
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 4e-06
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 3e-04
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 9e-20
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 5e-14
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 6e-13
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-07
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 1e-05
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 1e-19
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 2e-19
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 3e-15
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 3e-07
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 5e-07
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 2e-19
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 2e-15
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 7e-12
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 6e-06
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 7e-06
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 7e-05
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 2e-19
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 9e-12
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 4e-11
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 1e-04
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 3e-19
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 1e-09
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 1e-09
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 4e-19
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 2e-18
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 3e-13
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 2e-11
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 3e-10
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 3e-08
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 5e-19
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 5e-17
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 6e-16
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 1e-07
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-06
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 1e-18
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 2e-16
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 7e-13
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 4e-12
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 1e-08
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 6e-04
1x4x_A106 Fibronectin type-III domain containing protein 3A; 1e-18
1x4x_A106 Fibronectin type-III domain containing protein 3A; 4e-18
1x4x_A106 Fibronectin type-III domain containing protein 3A; 2e-14
1x4x_A106 Fibronectin type-III domain containing protein 3A; 4e-14
1x4x_A106 Fibronectin type-III domain containing protein 3A; 2e-10
1x4x_A106 Fibronectin type-III domain containing protein 3A; 1e-04
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-18
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 6e-10
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 7e-10
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-06
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 9e-04
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 2e-18
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 2e-14
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 5e-13
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 2e-06
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 1e-04
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 2e-18
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 6e-12
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 3e-11
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 2e-04
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 2e-18
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 7e-10
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 9e-10
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 1e-07
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 4e-04
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-18
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 5e-16
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-11
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-07
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 5e-07
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-05
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 3e-18
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 1e-13
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 2e-09
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 3e-09
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 4e-04
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-18
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-17
3k2m_C101 Monobody HA4; engineered binding protein, antibody 2e-14
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-09
3k2m_C101 Monobody HA4; engineered binding protein, antibody 5e-08
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 4e-18
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 5e-10
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 6e-10
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 6e-05
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 4e-18
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-14
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 3e-14
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 5e-13
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-12
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 8e-10
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 4e-18
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 2e-16
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 2e-15
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 2e-09
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 9e-07
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 8e-04
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 5e-18
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 6e-09
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 1e-08
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 2e-04
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 5e-18
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 1e-10
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 2e-10
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 3e-05
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 4e-04
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-17
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 1e-11
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 7e-11
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 1e-05
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 3e-04
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 3e-17
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 4e-13
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 4e-13
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 8e-13
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 5e-07
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 3e-05
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 4e-17
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 5e-09
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 1e-08
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 8e-04
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 5e-17
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 2e-16
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 5e-13
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 4e-07
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 1e-05
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 5e-05
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 6e-17
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 2e-14
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 9e-13
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 6e-10
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 4e-08
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 3e-05
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 2e-16
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 6e-15
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 2e-11
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 1e-05
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 4e-05
2crm_A120 Fibronectin type-III domain containing protein 3A; 3e-16
2crm_A120 Fibronectin type-III domain containing protein 3A; 3e-13
2crm_A120 Fibronectin type-III domain containing protein 3A; 3e-11
2crm_A120 Fibronectin type-III domain containing protein 3A; 1e-06
2crm_A120 Fibronectin type-III domain containing protein 3A; 1e-04
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 4e-16
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 4e-16
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 5e-13
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 2e-10
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 3e-05
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 5e-05
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 4e-16
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 1e-11
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 3e-09
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 2e-06
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 5e-16
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 5e-09
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 9e-09
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 1e-15
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 4e-12
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 6e-12
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 2e-10
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 1e-07
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 6e-06
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 2e-04
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 2e-15
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 6e-10
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 1e-07
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 3e-15
3qt2_A 317 Interleukin-5 receptor subunit alpha; cytokine typ 4e-06
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 4e-05
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 5e-15
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 4e-11
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 6e-09
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 6e-08
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 2e-06
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 8e-15
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 3e-09
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 5e-08
2crz_A110 Fibronectin type-III domain containing protein 3A; 1e-14
2crz_A110 Fibronectin type-III domain containing protein 3A; 4e-11
2crz_A110 Fibronectin type-III domain containing protein 3A; 6e-10
2crz_A110 Fibronectin type-III domain containing protein 3A; 2e-04
2crz_A110 Fibronectin type-III domain containing protein 3A; 4e-04
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 3e-14
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 3e-14
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 3e-11
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 7e-11
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 5e-10
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 7e-09
2q7n_A 488 Leukemia inhibitory factor receptor; cytokine cell 2e-05
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 4e-14
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 7e-04
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 6e-14
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 6e-09
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 4e-07
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 3e-05
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 3e-05
1eer_B227 Epobp, erythropoietin receptor; signal transductio 1e-13
1eer_B227 Epobp, erythropoietin receptor; signal transductio 4e-09
1eer_B227 Epobp, erythropoietin receptor; signal transductio 2e-08
1eer_B227 Epobp, erythropoietin receptor; signal transductio 1e-06
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 2e-13
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 6e-07
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 5e-06
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 3e-04
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 9e-04
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 2e-13
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 1e-10
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 4e-09
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 5e-07
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 2e-06
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 6e-06
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 2e-13
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 2e-11
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 8e-10
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 3e-08
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 2e-06
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 3e-13
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 7e-12
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 1e-11
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 3e-13
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 1e-08
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 4e-13
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 4e-10
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-07
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 3e-05
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 4e-13
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 4e-13
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 4e-11
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-07
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 9e-07
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 8e-13
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 9e-11
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 9e-13
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-06
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-05
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-05
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-12
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 8e-11
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 8e-10
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 9e-10
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-09
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 6e-09
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-08
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 1e-12
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 2e-07
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 1e-12
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-12
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 1e-09
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 4e-08
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-06
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 3e-12
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 4e-10
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 8e-08
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-12
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 1e-10
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-06
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 3e-12
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 3e-12
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 3e-12
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-11
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 6e-11
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-09
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-09
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 6e-09
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 3e-12
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 1e-11
2erj_C247 Cytokine receptor common gamma chain; immune syste 4e-12
2erj_C247 Cytokine receptor common gamma chain; immune syste 2e-09
2erj_C247 Cytokine receptor common gamma chain; immune syste 2e-06
2erj_C247 Cytokine receptor common gamma chain; immune syste 3e-06
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 4e-12
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 4e-10
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 4e-12
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 5e-12
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 2e-11
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 1e-08
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 4e-07
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 4e-07
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 2e-06
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 5e-12
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 4e-09
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 5e-09
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 5e-12
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-10
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-08
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 4e-05
1gl4_B98 Basement membrane-specific heparan sulfate proteog 7e-12
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 8e-12
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 1e-08
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 2e-08
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 4e-08
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 3e-07
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 3e-05
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 1e-11
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 6e-10
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 6e-05
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 1e-11
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 2e-04
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 4e-04
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 1e-11
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 3e-08
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 6e-08
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 3e-04
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 1e-11
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 2e-11
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 4e-08
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 2e-11
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 2e-11
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 4e-10
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 4e-10
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 2e-07
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 2e-07
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 4e-07
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 2e-11
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 3e-11
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-08
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 6e-08
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 3e-11
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 9e-10
2ens_A96 Advanced glycosylation END product-specific recept 3e-11
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 3e-11
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 8e-05
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 3e-11
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 3e-11
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 3e-11
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-09
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 3e-09
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 7e-06
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 4e-11
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 5e-11
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 4e-11
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 4e-09
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 3e-04
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 4e-04
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 5e-11
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 5e-11
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 3e-10
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 7e-08
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 3e-04
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 5e-11
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 6e-11
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 2e-09
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 7e-11
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 7e-11
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 6e-08
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 2e-07
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 3e-07
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 4e-04
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 8e-04
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 1e-10
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 1e-10
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-09
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 6e-08
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-10
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-09
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-09
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 5e-09
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-07
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-07
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 1e-10
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 1e-09
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 2e-10
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 8e-04
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 2e-10
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 2e-10
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 2e-10
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 2e-10
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 3e-08
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 5e-06
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 2e-10
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 4e-08
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 3e-10
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 5e-09
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 3e-10
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 6e-10
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 4e-10
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 7e-10
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 7e-09
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 6e-07
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 1e-06
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 4e-10
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 4e-10
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 5e-09
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 7e-06
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 5e-10
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 6e-09
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 3e-07
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 1e-06
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 7e-06
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 2e-04
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 5e-10
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 7e-10
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 5e-07
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 3e-06
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 8e-10
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 8e-08
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 1e-09
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 2e-09
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 1e-09
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 1e-06
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 2e-06
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 1e-09
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 1e-09
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 1e-09
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 1e-07
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 1e-06
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 7e-06
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 3e-04
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-09
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-08
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 1e-05
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 2e-09
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 8e-09
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 2e-09
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 3e-07
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 2e-09
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 2e-05
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 3e-09
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 3e-09
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 3e-09
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 2e-04
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 3e-09
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 4e-07
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 4e-09
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 3e-06
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 5e-09
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-07
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 6e-07
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 7e-09
3s35_X122 Vascular endothelial growth factor receptor 2; ant 1e-08
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 2e-08
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 2e-07
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 7e-05
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 2e-08
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 4e-08
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 2e-08
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 2e-08
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 3e-08
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 2e-07
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 8e-06
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 6e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-08
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 3e-08
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 5e-08
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 5e-08
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 5e-08
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 6e-08
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 7e-08
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 2e-07
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 8e-08
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 4e-07
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 1e-07
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 1e-07
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 7e-05
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 1e-07
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 2e-07
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 2e-07
2v9t_A117 Roundabout homolog 1; structural protein-receptor 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 2e-07
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 3e-07
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 4e-07
1wwb_X103 Protein (brain derived neurotrophic factor recepto 5e-07
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 1e-06
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 4e-06
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 1e-06
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 9e-05
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 1e-06
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 1e-06
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 3e-05
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 3e-06
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 3e-06
1he7_A126 High affinity nerve growth factor receptor; transf 3e-06
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 3e-06
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 4e-06
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 7e-05
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 4e-06
3mjg_X289 Beta-type platelet-derived growth factor receptor; 5e-06
3mjg_X289 Beta-type platelet-derived growth factor receptor; 2e-04
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 6e-06
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 6e-06
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 7e-06
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 9e-06
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 1e-04
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 1e-05
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-05
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 5e-04
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 2e-05
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 2e-05
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 2e-05
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 4e-05
1oww_A98 FN, fibronectin first type III module, CIG; fibron 4e-05
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 6e-05
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 8e-05
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 8e-05
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 2e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
1waa_A93 Titin; metal binding protein, calmodulin-binding, 3e-04
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 3e-04
2fbo_J250 V1V2;, variable region-containing chitin-binding p 3e-04
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 5e-04
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
 Score =  233 bits (596), Expect = 7e-67
 Identities = 99/733 (13%), Positives = 190/733 (25%), Gaps = 167/733 (22%)

Query: 98  DPVRRVPPQFSIPPPALLEVMLDSPLNLSCV-------AVGSPMPFVKWRKGQNIELTPD 150
           DP   + P+  +       V L S     CV              ++ W+   +  +  +
Sbjct: 3   DPCGYISPESPV-------VQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTN-HFTIPKE 54

Query: 151 DKLPVGRNVLTL---DRVTESENYTCIAASVLGVIETSTIVKVQCKYAPLLTLPVAPLDV 207
               + R   ++   D  + +   TC   +   + +    + +     P       P ++
Sbjct: 55  QYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPP-----EKPKNL 109

Query: 208 KISEVTATSVRLDWTYPSETLL--YYVIQYK-PKAANTPYSEISGIITTYYTVRNLSPYT 264
                    +R +W    ET L   + ++ +                T+     +   + 
Sbjct: 110 SCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFV 169

Query: 265 EYEFYIIAVNNLGRGPPSSPAVITTGETEPGTAPRDVQVRPLSSSTMVIQWDEPETPNGQ 324
             E ++ A N LG+                       +V+P            P   +  
Sbjct: 170 NIEVWVEAENALGKVTSD-----------HINFDPVYKVKPNP----------PHNLSVI 208

Query: 325 ITAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGE 384
            + +    + L  T           Y I                      QY        
Sbjct: 209 NSEELSSILKLTWTNPSIKSVIILKYNI----------------------QYRTKDASTW 246

Query: 385 QAAKHHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGE 444
                        ++++  L P T Y   +      G+G  +                  
Sbjct: 247 SQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDW---------------- 290

Query: 445 QALYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYEPGTA----PRDVQVRPLSSSTMVI 500
                                   +      T +  P  A     +          T+ +
Sbjct: 291 ------------------------SEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQL 326

Query: 501 QWDE--PETPNGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQA 558
            W    P   NG+I  Y+V  T+ +S      +   V+  +LT       +  Y   +  
Sbjct: 327 VWKTLPPFEANGKILDYEVTLTRWKS----HLQNYTVNATKLTV---NLTNDRYLATLTV 379

Query: 559 FTSVGPGPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWN 618
              VG    +A + +       + P        ++  + + W+ P  S +    Y L W 
Sbjct: 380 RNLVGKSD-AAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKK---YILEW- 434

Query: 619 DTYAKPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKAKHHRRIGLVETYS 678
                                                L                +  TY 
Sbjct: 435 -----------------------------------CVLSDKAPCITDWQQEDGTVHRTYL 459

Query: 679 LTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYVPGAPPQNVSCEPLSSTSIRISWE 738
              L  +  Y I +      G G+    I    KQ  P   P  V  + +      + W+
Sbjct: 460 RGNLAESKCYLITVTPVYADGPGSP-ESIKAYLKQAPPSKGP-TVRTKKVGKNEAVLEWD 517

Query: 739 PPPVERSNGHIVYYKLQFVETGRSDSEASIVTLKNQTSFVLDELKKWTEYRIWVLAGTSI 798
             PV+  NG I  Y + +     +++  ++ +  + T + L  L   T Y + + A T  
Sbjct: 518 QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDS--SHTEYTLSSLTSDTLYMVRMAAYTDE 575

Query: 799 GDGPSSYPITIRT 811
           G        T  T
Sbjct: 576 GGKDGPE-FTFTT 587


>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 98 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query904
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 100.0
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 100.0
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 100.0
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 100.0
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 100.0
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 100.0
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 100.0
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 100.0
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 100.0
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 100.0
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 100.0
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.97
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.97
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.97
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.96
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.96
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.96
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.96
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.96
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.95
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.95
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.94
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.94
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.93
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.92
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.91
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.91
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.9
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.9
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.9
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.89
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.89
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.89
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.89
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.89
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.89
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.88
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.88
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.88
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.88
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.88
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.87
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.87
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.86
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.86
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.86
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.85
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.85
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.84
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.84
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.83
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.83
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.83
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.83
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.83
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.82
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.82
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.81
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.81
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 99.81
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.8
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 99.8
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.8
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 99.79
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 99.78
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.77
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.77
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.76
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.76
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.75
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 99.74
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.73
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.72
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 99.69
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.68
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.65
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.65
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.65
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.62
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.62
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.62
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.61
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.61
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.61
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.6
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 99.6
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.6
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.6
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.6
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.59
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 99.58
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.58
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.57
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.57
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.57
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.56
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.56
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 99.55
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.55
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.55
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.54
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.54
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.54
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.53
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.52
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.52
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 99.51
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.5
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.5
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 99.5
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.5
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.5
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.5
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.49
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.49
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.49
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.48
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.47
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.47
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.47
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.47
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 99.47
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.47
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.47
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.47
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 99.47
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.46
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.46
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.46
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.46
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.46
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.46
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.46
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.46
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.45
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.45
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.45
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.45
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.45
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.45
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.44
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.44
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.44
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.44
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.44
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.44
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 99.44
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.43
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.43
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.43
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.43
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.43
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.43
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.43
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.42
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.42
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.42
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.42
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 99.41
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.41
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.41
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.41
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.41
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.41
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.41
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.41
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.4
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.4
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.4
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.4
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.4
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.4
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.4
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.4
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.4
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.39
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.39
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.39
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.39
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.39
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.39
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.39
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 99.39
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.38
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.38
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.38
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.38
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.38
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.38
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.37
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.37
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.37
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.37
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.37
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.37
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.36
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.36
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.36
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.36
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.36
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.36
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.36
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.35
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.35
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.35
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 99.35
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.35
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.35
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.35
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.35
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.34
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.34
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.34
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.34
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.34
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.34
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.34
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.33
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.33
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.33
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.33
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 99.33
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.33
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.33
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 99.33
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.33
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.33
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.32
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 99.32
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.32
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.32
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.32
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.32
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.32
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.32
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.32
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.32
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.32
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.32
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.31
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.31
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.31
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.31
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.31
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.31
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.3
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.3
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.3
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.3
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.3
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.3
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.3
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.3
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 99.29
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.29
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.29
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.29
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.29
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.29
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.29
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.29
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.29
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.28
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.28
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.28
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.28
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.28
1he7_A126 High affinity nerve growth factor receptor; transf 99.28
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.28
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.28
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.27
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.27
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.27
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.27
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.27
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.27
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.27
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.27
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.26
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.26
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 99.26
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.26
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.26
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.26
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.26
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.26
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.25
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.25
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.25
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.25
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.25
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.25
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.25
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.25
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.25
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.25
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.25
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.25
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.24
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.24
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.24
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.24
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 99.24
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.24
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.23
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.23
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.23
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.23
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.23
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.23
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.23
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.23
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.23
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.23
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.22
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.22
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.22
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.21
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.21
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 99.21
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.21
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.21
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.2
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.19
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.19
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 99.19
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.18
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.18
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.18
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.18
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.18
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.18
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.18
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 99.18
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.18
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.17
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.17
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.17
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.17
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.17
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.17
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.17
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.17
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.17
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.17
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 99.16
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.16
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.16
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 99.16
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.16
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.16
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.15
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.15
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.15
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.15
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 99.15
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.15
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.14
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.14
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.14
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.14
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.14
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.13
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.13
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.13
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 99.13
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.13
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.13
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.13
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.13
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.12
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.12
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.11
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 99.11
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.11
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.11
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.11
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.11
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 99.1
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 99.1
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.1
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.09
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.09
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.09
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.09
1gl4_B98 Basement membrane-specific heparan sulfate proteog 99.09
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.09
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.09
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.09
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.08
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.08
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 99.08
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 99.08
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 99.08
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 99.08
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.08
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.07
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.07
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.07
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.07
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.07
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 99.07
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 99.07
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 99.07
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.06
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.06
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.06
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 99.06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.06
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.06
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.06
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 99.06
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.05
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.05
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.05
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.05
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.05
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 99.04
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.04
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.04
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 99.04
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.03
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 99.03
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.03
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.03
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.02
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.02
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.02
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.02
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.02
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.02
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.01
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.01
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 99.01
2v9t_A117 Roundabout homolog 1; structural protein-receptor 99.01
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.01
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.01
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.0
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.0
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.0
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 99.0
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 98.99
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 98.99
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 98.99
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.99
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 98.98
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 98.98
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 98.98
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 98.98
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 98.97
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 98.97
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 98.97
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 98.97
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 98.97
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.97
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 98.97
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 98.96
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 98.96
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 98.96
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 98.96
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 98.96
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 98.96
2ens_A96 Advanced glycosylation END product-specific recept 98.96
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 98.95
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 98.95
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 98.95
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 98.95
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 98.95
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 98.95
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 98.94
3s35_X122 Vascular endothelial growth factor receptor 2; ant 98.94
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 98.93
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 98.93
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 98.93
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 98.93
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 98.92
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.92
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 98.92
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 98.92
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 98.92
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 98.92
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 98.91
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 98.91
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 98.91
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.9
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 98.9
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 98.9
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 98.9
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 98.89
3ux9_B256 SCFV antibody; five helices, long loop connecting 98.89
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 98.88
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 98.87
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 98.87
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 98.87
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 98.87
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 98.86
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 98.86
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 98.86
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 98.86
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.2e-49  Score=456.42  Aligned_cols=548  Identities=19%  Similarity=0.238  Sum_probs=395.8

Q ss_pred             CCCCceEEecCCCeEEEEEEc-------cCCCCeEEEeeCCccccCCCCcee--ecceEEEEeee-cCCeEEEEEEEec-
Q psy8771         110 PPPALLEVMLDSPLNLSCVAV-------GSPMPFVKWRKGQNIELTPDDKLP--VGRNVLTLDRV-TESENYTCIAASV-  178 (904)
Q Consensus       110 ~~~~~~~~~~g~~~~l~C~~~-------g~p~p~i~W~k~~~~~~~~~~~~~--~~~~~l~i~~l-~d~g~Y~c~a~n~-  178 (904)
                      -|.+ .++..|++++|.|.+.       |.|.+.|.|+++ +..+.......  .....|.|.++ ...+.|.|.+... 
T Consensus         9 ~p~~-~~v~~G~~v~l~C~~~~~~~~~~~~~~~~i~W~~~-~~~i~~~~~~~~~~~~~~l~i~~~~~~~~~y~C~~~~~~   86 (589)
T 3l5h_A            9 SPES-PVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTN-HFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFG   86 (589)
T ss_dssp             SCSC-CCCCSSSCCCCCC-CCTTTTTTTTCCTTTCCCBCS-SSBSCGGGCBCCSSSCCBCCCCCCCSSCCCCCCC-CCTT
T ss_pred             ecCC-CEEeCCCCEEEEEEEeCccCccccccccceEEEeC-CEECChHHccccCCcEeEEEEecCCCcceeeEEecccCC
Confidence            3456 7789999999999998       677889999999 66564432111  23557899999 3456688988642 


Q ss_pred             -CcceEEEEEEEEEeecCCCCCCCCCCcceEEEeecCCeEEEEEeCC--CccceEEEEEEEeCCCCCCeEEeecceeceE
Q psy8771         179 -LGVIETSTIVKVQCKYAPLLTLPVAPLDVKISEVTATSVRLDWTYP--SETLLYYVIQYKPKAANTPYSEISGIITTYY  255 (904)
Q Consensus       179 -~g~~~~~~~l~v~~~~~~~~~~P~~p~~l~~~~~~~~sv~l~W~~~--~~~~~~y~v~~~~~~~~~~~~~~~~~~~~~~  255 (904)
                       .+.....+.|.+.       .+|.+|.+|++...+..+++|+|+++  ......|.|.++..+...............+
T Consensus        87 ~~~~~~~~~~l~v~-------~pP~~P~nl~c~~~~~~~~~~~W~~~~~~~~~~~y~l~~~~~~~~~~~c~~~~~~~~~c  159 (589)
T 3l5h_A           87 QLEQNVYGITIISG-------LPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSC  159 (589)
T ss_dssp             CC-CCCCCCCCCC--------CCCCCCEEEEEEEETTSCEEEEEECCSCCSSCEEEEECCBCSSSBCCCEECBTTBSSCC
T ss_pred             CcccEEEeEEEecc-------CCCCCCEeeEEEECCCceEEEEECCCCcCCcCceEEEEEEEcCCCcccCCCCCCCcEEE
Confidence             1223345556666       78999999999999999999999997  4457899999875432222222222334667


Q ss_pred             EEc-CCCCCCeEEEEEEEEcCCCCCCCCCCeEEecCCCCCCCCCCceEe--cccCCCeeEEEecCCCCCCceeeEEEEEe
Q psy8771         256 TVR-NLSPYTEYEFYIIAVNNLGRGPPSSPAVITTGETEPGTAPRDVQV--RPLSSSTMVIQWDEPETPNGQITAKHHRR  332 (904)
Q Consensus       256 ~i~-~L~p~~~Y~~~v~a~n~~g~s~~s~~~~~~t~~~~p~~~p~~l~~--~~~~~~~v~l~W~~p~~~~~~~~~~~~~~  332 (904)
                      .+. +|.+++.|.|+|.|.|..|.+. +....+......++.+|.++.+  .....+++.|+|++|...++.+.      
T Consensus       160 ~~~~~l~~~~~Y~~~v~a~n~~G~~~-s~~~~~~~~~~~~p~pP~~~~~~~~~~~~~~v~l~W~~p~~~~~~~~------  232 (589)
T 3l5h_A          160 TVDYSTVYFVNIEVWVEAENALGKVT-SDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIIL------  232 (589)
T ss_dssp             BCCSCCCSSSCEEECEEEEESSCCBC-CCCEEECGGGSEECCCCCSCEEECTTTCTTCEEEECCCCGGGGTSCE------
T ss_pred             EECCCCchheeEEEEEEEEeCCCCcc-cccEEEccccEEEcCCCceEEEEecCCCCCeEEEEeCCCCCCCeeeE------
Confidence            777 8999999999999999999864 4455565555556789999998  56788999999998876544332      


Q ss_pred             eceeEEEEEcCCCCCcEEEEEEEEEcCCCCCCCCCCcceeeccCCCCCCCCcccccccccceeeeEEEEeccccCcEEEE
Q psy8771         333 IGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQAAKHHRRIGLVETYSLTGLYPNTLYYI  412 (904)
Q Consensus       333 ~~~~~~~~~~~L~~~~~Y~v~v~a~~~~g~~~~s~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~  412 (904)
                                      .|.++.+......   +..                      .                      
T Consensus       233 ----------------~Y~v~~~~~~~~~---w~~----------------------~----------------------  249 (589)
T 3l5h_A          233 ----------------KYNIQYRTKDAST---WSQ----------------------I----------------------  249 (589)
T ss_dssp             ----------------EEEEEEEETTCSC---CBC----------------------C----------------------
T ss_pred             ----------------EEEEEECCCCCCC---cEE----------------------E----------------------
Confidence                            3555444321100   000                      0                      


Q ss_pred             EEeeecCCCCCCCCCCcceEeeccCCCCceeeeeccCCeEEEEEEEEeeCCCCCCC---CCCceeeecCCCCCCCCCCeE
Q psy8771         413 WLAAQSPRGEGATTPPIPVRTKQYGKTPGFGEQALYPNTLYYIWLAAQSPRGEGAT---TPPIPVRTKQYEPGTAPRDVQ  489 (904)
Q Consensus       413 ~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~L~p~~~Y~~~v~a~~~~g~~~~---s~~~~~~t~~~~p~~~p~~l~  489 (904)
                                     .   .....+....+.+.+|.|++.|.|+|+|.+..|.+.+   |....+.|....|..+|..+.
T Consensus       250 ---------------~---~~~~~~~~~~~~i~~L~p~t~Y~~~V~a~~~~g~g~~S~~S~~~~~~T~~~~P~~~p~~~~  311 (589)
T 3l5h_A          250 ---------------P---PEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWY  311 (589)
T ss_dssp             ---------------C---TTSSCSCCSEEEECSCCSSCCEEEEEEEEESSSCSCCCCCCCCBCCCCCCCCCCSCCCEEE
T ss_pred             ---------------c---cccCcCceeEEEECCCCCCCEEEEEEEEEeCCCCCccCCCCCccccccCccCCCCCCcEEE
Confidence                           0   0000123456789999999999999999999987655   566777888777767787665


Q ss_pred             EE----ecCCceEEEEecC--CCCCCCceeeEEEEEEeCCCCCCcceEEEeecCceEEEEcCCCCCCeEEEEEEEEeCCC
Q psy8771         490 VR----PLSSSTMVIQWDE--PETPNGQITGYKVYYTQDQSLPMSAWETQVVDNNQLTTISDLTPHTIYTIRVQAFTSVG  563 (904)
Q Consensus       490 v~----~~~~~~~~l~W~~--p~~~~~~i~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~t~Y~~~V~a~~~~g  563 (904)
                      ..    ..+.+++.|+|++  +.+.+|.+.+|.|+|+.....    +.. .......+.  .|.+++.|.|+|+|.|..|
T Consensus       312 ~v~~~~~~~~~~v~l~W~p~~~~~~~g~i~~Y~v~~~~~~~~----~~~-~~~~~~~~~--~l~~~~~Y~~~V~A~n~~G  384 (589)
T 3l5h_A          312 KIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSH----LQN-YTVNATKLT--VNLTNDRYLATLTVRNLVG  384 (589)
T ss_dssp             ECCSCSSTTSCCEEEEECCCCTTTSSSCCCEEEEEECCTTSC----CCB-CCCSSSCCE--ECCCSSCCCEEEEEEBTTB
T ss_pred             EeecCcCCCcceEEEEEeeCCchhccCceeeEEEEEecCCCC----cee-eccCCceEE--EEeCCCCEEEEEEEEeCCc
Confidence            43    4567899999997  455678999999999776532    211 112233333  3889999999999999999


Q ss_pred             CCCCCCcEEEecCCCCCCCCCCceEEecCCCeEEEEEeCCCCCCCCceEEEEEeccCCCCCcceEEEeeccceEEEeccC
Q psy8771         564 PGPLSAPVLVKTQQGVPSQPRDLRAVDIQETAVTLAWSKPTHSGENIISYELYWNDTYAKPRDLRAVDIQETAVTLAWSK  643 (904)
Q Consensus       564 ~~~~S~~~~~~t~~~~p~~p~~~~~~~~~~~~~~l~W~~~~~~~~~~~~y~v~~~~~~~~p~~l~~~~~~~~~~~l~w~~  643 (904)
                      .|+.+...........|.++.++.+... .+++.|+|.++..                                      
T Consensus       385 ~~~~s~~~~~~~~~~~~~p~~~l~~~~~-~~si~l~W~~p~~--------------------------------------  425 (589)
T 3l5h_A          385 KSDAAVLTIPACDFQATHPVMDLKAFPK-DNMLWVEWTTPRE--------------------------------------  425 (589)
T ss_dssp             CCCCCCCCCCCTTCCCCSCCCSCEEEEC-SSSEEEECCCCSS--------------------------------------
T ss_pred             cCCCeEEEeecccccCCCCcceEEEEEC-CCeEEEEEECCCC--------------------------------------
Confidence            9987754322221123455678887765 6789999988742                                      


Q ss_pred             CCCCCCceeeEEEEEEeCCcccc-----ceEEecccceEEEeCCCCCcEEEEEEEEEcCCCCCCCCCCeeEEecCCCCCC
Q psy8771         644 PTHSGENIISYELYWNDTYAKAK-----HHRRIGLVETYSLTGLYPNTLYYIWLAAQSPRGEGATTPPIPVRTKQYVPGA  718 (904)
Q Consensus       644 ~~~~~~~~~~y~v~~~~~~~~~~-----~~~~~~~~~~~~l~~L~p~t~Y~v~V~a~~~~G~~~~s~~~~~~t~~~~p~~  718 (904)
                            .+.+|.|+|+..+....     ..........+.+.+|.|++.|.|+|+|++..|.|..+ .+.+.|.+.+|..
T Consensus       426 ------~i~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~t~Y~~~V~A~~~~g~g~~~-~~~~~t~~~~P~~  498 (589)
T 3l5h_A          426 ------SVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPE-SIKAYLKQAPPSK  498 (589)
T ss_dssp             ------CCSCBCCEEEEECSSSCCCEEECCBCSSCCEEECCSCCCSSSEEEEEECBEETTEECCCE-EEEEESSCCCCSS
T ss_pred             ------CccEEEEEEEECCCCCCCccCcEEeeCCcceEEehhccccCcEEEEEEEEEeCCcccCCE-EEEEEeccCCCCC
Confidence                  57888888887765322     11222233467779999999999999999999988765 5677888888886


Q ss_pred             CCCCcEEEecCCCEEEEEecCCCCCCCCccEEEEEEEEEEccCCCCccEEEEec-CcceEEecCCCCCceEEEEEEEeeC
Q psy8771         719 PPQNVSCEPLSSTSIRISWEPPPVERSNGHIVYYKLQFVETGRSDSEASIVTLK-NQTSFVLDELKKWTEYRIWVLAGTS  797 (904)
Q Consensus       719 ~P~~l~~~~~~~~~v~l~W~~~~~~~~~g~~~~Y~v~~~~~~~~~~~~~~~~~~-~~~~~~i~~L~p~t~Y~~~V~a~~~  797 (904)
                      +| ++.+...+.+++.|+|++++.+..+|.+.+|.|+|+..++..+   ...+. ..+.++|.+|.|++.|.|+|+|.|.
T Consensus       499 pp-~l~~~~~~~~sv~l~W~~~~~~~~~g~i~~Y~v~~~~~~~~~~---~~~~~~~~~~~~~~~L~p~t~Y~~~V~A~n~  574 (589)
T 3l5h_A          499 GP-TVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNET---AVNVDSSHTEYTLSSLTSDTLYMVRMAAYTD  574 (589)
T ss_dssp             CC-CCCEECCCSSCBEEBCCCCCHHHHCSCEEEEEECCBCSSCCCC---CEEECTTCCBCCBCSCCSSCCEECCEEEEET
T ss_pred             CC-eEEEeecccceEEEEecCCCHHHcCccceeEEEEEEeCCCCeE---EEEeCCcccEEEecCCCCCCEEEEEEEEEeC
Confidence            55 6899999999999999997546778999999999988765433   23344 8889999999999999999999999


Q ss_pred             CCCCCCCCcEEeecC
Q psy8771         798 IGDGPSSYPITIRTH  812 (904)
Q Consensus       798 ~g~g~~s~~~~~~t~  812 (904)
                      .| |..|..+.++|.
T Consensus       575 ~G-~~~S~~~~~~T~  588 (589)
T 3l5h_A          575 EG-GKDGPEFTFTTP  588 (589)
T ss_dssp             TE-EEECCCCEECCC
T ss_pred             CC-CCCCCCeEEecC
Confidence            99 889999999885



>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 904
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 5e-21
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 4e-18
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 5e-12
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 3e-09
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 1e-08
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 6e-05
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 4e-20
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 1e-16
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 3e-12
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 2e-10
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 3e-09
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 8e-04
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 7e-19
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 4e-17
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 3e-12
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 8e-10
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-08
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-06
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 2e-18
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 4e-16
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 1e-13
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 4e-13
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 6e-11
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 9e-08
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 4e-17
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 9e-17
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 3e-14
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 1e-12
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 8e-12
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 0.001
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 6e-17
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-14
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-10
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 3e-08
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-06
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 3e-05
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 1e-16
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 1e-15
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 1e-13
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 9e-13
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 2e-09
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 2e-04
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 1e-16
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 4e-16
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 5e-16
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 2e-12
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 4e-10
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 3e-04
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 3e-16
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 7e-14
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 5e-13
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 5e-12
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 7e-09
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 2e-07
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 7e-07
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 0.003
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 4e-16
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 1e-15
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 8e-12
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 6e-08
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 6e-08
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 1e-06
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 7e-16
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 4e-11
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 5e-09
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 8e-07
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 4e-05
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 4e-15
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 1e-07
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 5e-06
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 1e-05
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 0.003
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 7e-15
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 6e-09
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-07
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 4e-06
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.003
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 2e-14
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 2e-10
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 3e-08
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 3e-06
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 0.002
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 5e-14
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 4e-10
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 7e-09
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 2e-04
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 1e-13
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 2e-11
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 7e-11
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 2e-04
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 4e-04
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 1e-13
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 2e-13
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 3e-13
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 5e-07
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 3e-05
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 0.003
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 2e-13
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 4e-07
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 1e-06
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 3e-04
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 2e-13
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 3e-06
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 8e-05
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 6e-04
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 3e-13
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 3e-11
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 3e-10
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 8e-07
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 4e-06
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 3e-13
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 2e-07
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 3e-07
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 4e-06
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 2e-04
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 4e-13
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 1e-09
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 2e-08
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 1e-07
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 6e-04
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 5e-13
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 3e-12
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 4e-11
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 2e-07
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 1e-06
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 9e-13
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 5e-10
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 1e-08
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 7e-08
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 4e-04
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 2e-12
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 3e-12
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 3e-10
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 5e-06
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 6e-06
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 4e-04
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-12
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 3e-11
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-10
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 4e-08
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-05
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 2e-12
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 3e-08
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 6e-08
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 9e-08
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 3e-04
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-12
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 1e-11
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 7e-10
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 4e-06
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 3e-04
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 5e-04
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 2e-12
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 2e-12
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 5e-12
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 6e-07
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 9e-07
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 3e-12
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 7e-07
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 1e-06
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 6e-06
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 0.001
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 3e-12
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 4e-11
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 2e-05
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 1e-04
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 0.004
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 3e-12
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 4e-10
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 1e-08
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 8e-06
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 3e-12
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 5e-11
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 1e-10
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 2e-06
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 0.001
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 4e-12
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 1e-10
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 4e-09
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 3e-05
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 4e-04
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 5e-12
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 3e-07
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 5e-07
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 1e-04
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 6e-12
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 6e-07
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 3e-06
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 4e-04
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 2e-11
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 3e-06
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 1e-05
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 0.001
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 2e-11
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 7e-09
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 2e-07
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 7e-05
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 3e-11
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-10
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-07
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-07
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 6e-11
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 3e-08
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 2e-06
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 8e-05
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 6e-11
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 6e-11
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 4e-06
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 6e-06
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 0.004
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 8e-11
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 1e-09
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 5e-07
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 3e-06
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 9e-05
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 9e-11
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 1e-10
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 2e-10
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 1e-07
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 6e-05
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 1e-10
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 1e-06
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 3e-05
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 2e-04
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 8e-04
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 3e-10
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 1e-08
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 2e-08
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 4e-06
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 3e-10
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 4e-07
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 1e-06
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 1e-04
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 5e-04
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 4e-10
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 2e-08
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 1e-05
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 1e-05
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 5e-10
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 4e-09
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 1e-06
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 6e-04
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 6e-10
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 1e-08
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 1e-06
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 3e-05
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 0.001
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 6e-10
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 2e-08
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 5e-08
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 7e-04
d1cs6a391 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall 7e-10
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 9e-10
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 3e-09
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 0.003
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 0.004
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 3e-09
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 1e-08
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 6e-07
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 8e-09
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 3e-04
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 5e-04
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1e-08
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 5e-04
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 0.001
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 1e-08
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 0.001
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 0.004
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 1e-08
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 3e-08
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 6e-07
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 2e-04
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 2e-08
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 1e-07
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 2e-07
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 0.004
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 3e-08
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 2e-07
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 3e-05
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 4e-08
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 3e-06
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 3e-04
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 6e-08
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 4e-06
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 9e-05
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 9e-08
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 6e-07
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 0.001
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 1e-07
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 4e-06
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 3e-04
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 1e-07
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-04
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 2e-07
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 4e-07
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 6e-07
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 7e-05
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 2e-07
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 2e-07
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 6e-06
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 4e-05
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 2e-07
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 3e-07
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 5e-06
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 1e-04
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-07
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-05
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.001
d3dara197 b.1.1.4 (A:153-249) Fibroblast growth factor recep 2e-07
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 3e-07
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 4e-05
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 1e-04
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 6e-07
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 7e-07
d1gl4b_89 b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu 1e-06
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 1e-06
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 1e-06
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 1e-06
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 1e-06
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 1e-05
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 0.004
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 2e-06
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 4e-04
d1erna2105 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor 2e-06
d1erna2105 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor 0.002
d2gysa2114 b.1.2.1 (A:104-217) Common beta-chain in the GM-CS 2e-06
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 3e-06
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 4e-06
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 5e-06
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 6e-06
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 8e-06
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 1e-04
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 5e-04
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 2e-05
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 4e-05
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 1e-04
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 2e-05
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 3e-05
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 3e-04
d1tnna_91 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 4e-05
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 7e-05
d1cs6a197 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus 7e-05
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 9e-05
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 3e-04
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 0.001
d1wiua_93 b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el 1e-04
d1v5ja_108 b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId 1e-04
d1v5ja_108 b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId 6e-04
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 1e-04
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 0.002
d3d85d394 b.1.2.1 (D:212-305) The p40 domain of interleukin- 2e-04
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 2e-04
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 2e-04
d2b5ic195 b.1.2.1 (C:130-224) Cytokine receptor common gamma 5e-04
d2gysa4100 b.1.2.1 (A:317-416) Common beta-chain in the GM-CS 2e-04
d2gysa4100 b.1.2.1 (A:317-416) Common beta-chain in the GM-CS 5e-04
d1rhfa191 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor 4e-04
d1x5ia1113 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ 6e-04
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 8e-04
d1iray3107 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor 0.001
d1biha397 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr 0.002
d2oz4a384 b.1.1.4 (A:367-450) Intercellular adhesion molecul 0.003
d1gxea_130 b.1.1.4 (A:) Cardiac myosin binding protein C, dif 0.003
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 0.003
d2crya1115 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR 0.004
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Neogenin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 87.2 bits (215), Expect = 5e-21
 Identities = 40/112 (35%), Positives = 57/112 (50%)

Query: 707 IPVRTKQYVPGAPPQNVSCEPLSSTSIRISWEPPPVERSNGHIVYYKLQFVETGRSDSEA 766
           + VRT   VP A PQN+S E  +S SI I W+PP     NG I  YK+++ +  R     
Sbjct: 2   VAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVT 61

Query: 767 SIVTLKNQTSFVLDELKKWTEYRIWVLAGTSIGDGPSSYPITIRTHEDDPSE 818
             +    Q S +++ L + TEY   V A T  G GP++  ++  T E D  E
Sbjct: 62  ETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLDE 113


>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query904
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.6
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.52
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.52
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.51
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.49
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.49
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.48
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.46
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.45
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.45
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.45
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.43
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.41
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.41
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.4
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.4
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.4
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.39
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.39
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.39
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.39
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.38
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.38
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.38
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.38
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.37
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.37
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.36
d2crza197 Fibronectin type-III domain containing protein 3a, 99.36
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.36
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.36
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.36
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.35
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.35
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.35
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.35
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.35
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.34
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.33
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.33
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.33
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.33
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.33
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.32
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.32
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.32
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.31
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.31
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.3
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.3
d2crza197 Fibronectin type-III domain containing protein 3a, 99.3
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.3
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.29
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.29
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.29
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.29
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.28
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.28
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.28
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.28
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.28
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.27
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.27
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.27
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.27
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.26
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.26
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.25
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.25
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.24
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.24
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.24
d2avga1110 Cardiac myosin binding protein C, different domain 99.23
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.23
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.22
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.22
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.21
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.21
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.21
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.21
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.21
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.2
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.2
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.2
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.2
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.2
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.2
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.19
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.19
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.19
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.18
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.18
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.18
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.18
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.17
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.17
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.17
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.16
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.16
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.15
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.15
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.15
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.15
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.15
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.15
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.15
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.14
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.14
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.14
d1gxea_130 Cardiac myosin binding protein C, different domain 99.14
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.14
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.14
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.14
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.13
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.13
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.13
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.13
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.13
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.13
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.13
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.13
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.12
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.12
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.11
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.11
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.11
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.11
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.11
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.11
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.11
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.1
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.1
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.1
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.1
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.1
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.09
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.09
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.09
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.07
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.07
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.07
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.07
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.07
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.06
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.06
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.05
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.05
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.05
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.05
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.05
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.04
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.04
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.04
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.04
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.03
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.03
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.03
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.03
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.02
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.02
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.02
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.02
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.01
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.0
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.0
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.0
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 98.98
d1pd6a_94 Cardiac myosin binding protein C, different domain 98.96
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.96
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.95
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.95
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 98.94
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 98.93
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.93
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 98.92
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 98.91
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.91
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 98.9
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.9
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 98.87
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.86
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.84
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 98.83
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.82
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.81
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.79
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.78
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.75
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.74
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.72
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.69
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.68
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 98.65
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.63
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.62
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 98.61
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.58
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.45
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.38
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.3
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.26
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.25
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.23
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 97.95
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 97.72
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 97.62
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.48
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 97.45
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 97.45
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.42
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.36
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 97.35
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 97.3
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 97.3
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 97.29
d1ospl1107 Immunoglobulin light chain kappa variable domain, 97.24
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 97.24
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 97.24
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 97.23
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 97.22
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 97.21
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 97.2
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 97.19
d1mexl1107 Immunoglobulin light chain kappa variable domain, 97.19
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.18
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 97.13
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 97.11
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 97.11
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 97.09
d1op3k1106 Immunoglobulin light chain kappa variable domain, 97.05
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 97.03
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 97.02
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.01
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 97.0
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 96.98
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 96.93
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 96.92
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 96.91
d1jhll_108 Immunoglobulin light chain kappa variable domain, 96.89
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 96.88
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 96.84
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 96.84
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 96.83
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 96.82
d8faba1103 Immunoglobulin light chain lambda variable domain, 96.8
d2rhea_114 Immunoglobulin light chain lambda variable domain, 96.78
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 96.78
d1d5il1107 Immunoglobulin light chain kappa variable domain, 96.77
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 96.76
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 96.76
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 96.74
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 96.7
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 96.66
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 96.66
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 96.65
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 96.62
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 96.6
d2gsia1111 Immunoglobulin light chain kappa variable domain, 96.59
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 96.59
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 96.58
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 96.56
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 96.55
d1mjul1112 Immunoglobulin light chain kappa variable domain, 96.52
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 96.52
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 96.51
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 96.5
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 96.48
d1lgva1112 Immunoglobulin light chain lambda variable domain, 96.46
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 96.46
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 96.45
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 96.44
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 96.41
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 96.34
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 96.32
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 96.3
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 96.3
d1w72l1109 Immunoglobulin light chain lambda variable domain, 96.29
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 96.28
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 96.26
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 96.25
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 96.24
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 96.24
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 96.21
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 96.21
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 96.18
d1oaql_110 Immunoglobulin light chain lambda variable domain, 96.17
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 96.17
d1nfde1108 Immunoglobulin light chain lambda variable domain, 96.17
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 96.17
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 96.16
d1j05a_111 Immunoglobulin light chain kappa variable domain, 96.14
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 95.99
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 95.99
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 95.89
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 95.85
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 95.85
d1hnfa1101 CD2, first domain {Human (Homo sapiens) [TaxId: 96 95.82
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 95.8
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 95.79
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 95.78
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 95.7
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 95.68
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 95.68
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 95.59
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 95.57
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 95.5
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 95.47
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 95.46
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 95.36
d1q0xl2102 Immunoglobulin light chain lambda constant domain, 95.35
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 95.25
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 95.25
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 95.25
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 95.12
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 95.08
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 95.05
d1hxmb2107 T-cell antigen receptor {Human (Homo sapiens), del 95.01
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 94.94
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 94.78
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 94.75
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 94.71
d2c4fu1116 Extracellular region of human tissue factor {Human 94.7
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 94.61
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 94.55
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 94.55
d1o0va1104 Immunoglobulin heavy chain epsilon constant domain 94.55
d1xiwa_91 CD3 epsilon chain ectodomain fragment {Human (Homo 94.54
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 94.53
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 94.52
d1nfde2104 Immunoglobulin light chain lambda constant domain, 94.45
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 94.4
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 94.27
d1hyrc194 Class I MHC homolog, alpha-3 domain {Human (Homo s 94.22
d1fltx_95 Second domain of the Flt-1 receptor {Human (Homo s 94.22
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 94.19
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 94.11
d2hfta1106 Extracellular region of human tissue factor {Human 93.98
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 93.94
d1mjul2107 Immunoglobulin light chain kappa constant domain, 93.93
d3d85d187 The p40 domain of interleukin-12 (IL-12 beta chain 93.9
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 93.83
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 93.79
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 93.74
d1mjuh2102 Immunoglobulin heavy chain gamma constant domain 1 93.73
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 93.66
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 93.64
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 93.6
d2c4fu1116 Extracellular region of human tissue factor {Human 93.58
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 93.55
d2hfta1106 Extracellular region of human tissue factor {Human 93.51
d1cqka_101 Immunoglobulin heavy chain gamma constant domain 3 93.46
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 93.45
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 93.4
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 93.4
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 93.34
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 93.33
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 93.31
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 93.3
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 93.19
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 93.12
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 93.06
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 93.03
d1l6xa2102 Immunoglobulin heavy chain gamma constant domain 3 93.01
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 92.98
d1igtb4102 Immunoglobulin heavy chain gamma constant domain 3 92.97
d1jbja2100 CD3 epsilon chain ectodomain fragment {Mouse (Mus 92.96
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 92.94
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 92.92
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 92.91
d1a21a1103 Extracellular region of human tissue factor {Rabbi 92.9
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 92.87
d2p49b1121 Camelid IG heavy chain variable domain, VHh {Camel 92.86
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 92.85
d1u58a198 Immunomodulatory protein m144, alpha-3 domain {Mur 92.84
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 92.82
d1kcvh2101 Immunoglobulin heavy chain gamma constant domain 1 92.79
d1i1ca2102 Immunoglobulin heavy chain gamma constant domain 3 92.77
d1rz7h1119 Immunoglobulin heavy chain variable domain, VH {Hu 92.76
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 92.7
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 92.63
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 92.62
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 92.58
d1i3ua_127 Camelid IG heavy chain variable domain, VHh {Llama 92.56
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 92.52
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 92.46
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 92.45
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 92.44
d1hxma286 T-cell antigen receptor {Human (Homo sapiens), gam 92.38
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 92.35
d1dlfh_120 Immunoglobulin heavy chain variable domain, VH {Mo 92.18
d1a21a1103 Extracellular region of human tissue factor {Rabbi 92.16
d1lmka1126 Immunoglobulin heavy chain variable domain, VH {Mo 92.04
d1n0xh1127 Immunoglobulin heavy chain variable domain, VH {Hu 92.02
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 92.02
d1rhhb1130 Immunoglobulin heavy chain variable domain, VH {Hu 92.01
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 91.92
d2fx7h1127 Immunoglobulin heavy chain variable domain, VH {Hu 91.85
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 91.82
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 91.82
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 91.72
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 91.71
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 91.71
d2nxyd1128 Immunoglobulin heavy chain variable domain, VH {Hu 91.7
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 91.68
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 91.68
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 91.65
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 91.58
d1dn0b2105 Immunoglobulin heavy chain mu constant domain 1, C 91.56
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 91.54
d1ow0a1101 Immunoglobulin heavy chain alpha constant domain 2 91.52
d1ad9b1120 Immunoglobulin heavy chain variable domain, VH {En 91.44
d1rzfh1133 Immunoglobulin heavy chain variable domain, VH {Hu 91.37
d1yedb1124 Immunoglobulin heavy chain variable domain, VH {Mo 91.35
d1rzga1130 Immunoglobulin heavy chain variable domain, VH {Hu 91.34
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 91.31
d1ogae2127 T-cell antigen receptor {Human (Homo sapiens), bet 91.3
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 91.13
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 91.13
d3cx5j1127 Immunoglobulin heavy chain variable domain, VH {Mo 91.12
d2fb4h1127 Immunoglobulin heavy chain variable domain, VH {Hu 91.08
d1lo4h1118 Immunoglobulin heavy chain variable domain, VH {Mo 91.03
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 90.99
d1op3h1125 Immunoglobulin heavy chain variable domain, VH {En 90.99
d2b1hh1124 Immunoglobulin heavy chain variable domain, VH {En 90.93
d1fp5a1103 Immunoglobulin heavy chain epsilon constant domain 90.76
d1q9rb1122 Immunoglobulin heavy chain variable domain, VH {Mo 90.76
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 90.72
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 90.52
d1i1ca1103 Immunoglobulin heavy chain gamma constant domain 2 90.49
d1fn4b1116 Immunoglobulin heavy chain variable domain, VH {Ra 90.48
d1jbja186 CD3 gamma chain ectodomain fragment {Mouse (Mus mu 90.22
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 89.95
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 89.86
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 89.84
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 89.75
d1pfca_111 Immunoglobulin heavy chain gamma constant domain 3 89.25
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 89.24
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 88.78
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 88.63
d1nfdf1121 Immunoglobulin heavy chain variable domain, VH {Ha 88.57
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 88.36
d3c2ah1131 Immunoglobulin heavy chain variable domain, VH {Hu 88.32
d1sy6a181 CD3 gamma chain ectodomain fragment {Human (Homo s 88.29
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 88.24
d1l6xa1105 Immunoglobulin heavy chain gamma constant domain 2 88.22
d1igtb3119 Immunoglobulin heavy chain gamma constant domain 2 88.14
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 88.14
d1c5ch2103 Immunoglobulin heavy chain gamma constant domain 1 88.12
d1b2wh1117 Immunoglobulin heavy chain variable domain, VH {En 87.81
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 87.68
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 87.5
d1xiwb_74 CD3 delta chain ectodomain fragment {Human (Homo s 87.42
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 87.31
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 87.16
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 87.07
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 85.81
d2fbjh2102 Immunoglobulin heavy chain alpha constant domain 1 85.24
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 84.37
d1gxea_130 Cardiac myosin binding protein C, different domain 84.15
d1i1ra1100 Cytokine receptor gp130 cytokine-binding domains { 84.03
d2avga1110 Cardiac myosin binding protein C, different domain 83.85
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 83.66
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 83.09
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 82.85
d2ifga192 High affinity nerve growth factor receptor TrkA, d 82.78
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 81.3
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 81.21
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 80.26
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 80.26
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 80.12
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 80.08
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Axonin-1
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.60  E-value=2e-15  Score=120.72  Aligned_cols=85  Identities=28%  Similarity=0.507  Sum_probs=79.9

Q ss_pred             CeEEcCCCCceEEecCCCeEEEEEEccCCCCeEEEeeCCccccCCCCceeecceEEEEeee--cCCeEEEEEEEecCcce
Q psy8771         105 PQFSIPPPALLEVMLDSPLNLSCVAVGSPMPFVKWRKGQNIELTPDDKLPVGRNVLTLDRV--TESENYTCIAASVLGVI  182 (904)
Q Consensus       105 P~~~~~~~~~~~~~~g~~~~l~C~~~g~p~p~i~W~k~~~~~~~~~~~~~~~~~~l~i~~l--~d~g~Y~c~a~n~~g~~  182 (904)
                      |.|+..|.+ +.+..|+++.|.|.+.|.|.|.|+|+|+ +..+..+.++.+.++.|.|.++  +|+|.|+|.|.|..|..
T Consensus         2 P~f~~~~~~-~~v~~G~~~~l~C~~~g~P~p~v~W~k~-g~~i~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~a~N~~G~~   79 (89)
T d1cs6a4           2 PDWLDVITD-TEADIGSDLRWSCVASGKPRPAVRWLRD-GQPLASQNRIEVSGGELRFSKLVLEDSGMYQCVAENKHGTV   79 (89)
T ss_dssp             EEEEECCCC-EEEETTCCEEEECEEEEESCCEEEEEET-TEECCCCSSEEEETTEEEESSCCGGGCEEEEEEEEETTEEE
T ss_pred             CCeEEECCC-EEECCCCcEEEEEEEEEEcCCEEEEEEe-eccccccceeeeeeeeEEEEeecccCCEEEEEEEEeCCCEE
Confidence            789999999 9999999999999999999999999999 8888888888888899999999  69999999999999999


Q ss_pred             EEEEEEEEE
Q psy8771         183 ETSTIVKVQ  191 (904)
Q Consensus       183 ~~~~~l~v~  191 (904)
                      .+++.|.|+
T Consensus        80 ~~~~~l~V~   88 (89)
T d1cs6a4          80 YASAELTVQ   88 (89)
T ss_dssp             EEEEEEEEE
T ss_pred             EEEEEEEEE
Confidence            999999886



>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} Back     information, alignment and structure
>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d85d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1ow0a1 b.1.1.2 (A:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fn4b1 b.1.1.1 (B:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jbja1 b.1.1.4 (A:101-186) CD3 gamma chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin heavy chain variable domain, VH {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3c2ah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1sy6a1 b.1.1.4 (A:1-81) CD3 gamma chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1c5ch2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b2wh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ra1 b.1.2.1 (A:2-101) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure