Psyllid ID: psy8773

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770---
MKKKIYFIEGVLTIKFHLKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNISLRAHDVSTHSMTLSWSPPIKLNPVKYKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNIRRRQPRKYPESSAVTRPLMSGEIMTSHAPSDPVEMRRLNFQTPGMVSHPPIPISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGDGFIDFIGQVHKTKEQFGQDGPITVHCSRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGRDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPASSQMITRKDDPTVSLQDPYIAAKFSQRNIPYTFHLGNGQTYEGFVNKKLVRGLKYRIFVRAIVDTPQKHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGDVRKDPCTSTSRSSCPWSAIPGDNQYKPSTRISVTTQMAAPQPLVKPDFYGVVNGEEIQVILPQASEEYGPISHYYLIVVPEDKMTYDKQPDQFLTDEMITRKDDPTVSLQDPYIAAKSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGKTEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGIEGSDYINASFIDGYRLRSAYIATQGPLADTTEDFWRMLWEHNSTIVVMLTKLKEMGRYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSLLSLHINLTQSEWGREKPVAQLSFCSVLIAYLVLFSQEKCHQYWPSERSIRYEWFVVEPIAEYNMPQYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTEHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGDVPPVHVIVEHNSPGLLWIIGPIIAALALSICLVLLFILKSSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAKEQYQFCYHAALEYLGSFDHYTN
cccEEEEEEcEEEEEEEEEEEEEccccccccccccEEEcccccEEcccccccEEEEccccccccEEEEEEEEEcccccccEEEEEcccccccccEEEEEEEEEEEEEcccccEEEEEcccccEEccccccEEEEccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHccccccccccHHcccccccccccccccccccccccEEEEEcccccccccccccccccccccccEEEccccccccHHHHHHHHccccccEEEEEcccEEccccccccccccccccEEEcEEEEEEEEEEEccEEEEEEEEEEccccccEEEEEEEcccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccEEEccccccccHHHHHHHHHcccccEEEEccccccccccccEEEccccEEEEEEEEEccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHccccccEEEEccccccHHcHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccccHHHccccccccccccccccccccccEEEEEccccccccEEcccccccccccccEEEccccccccccccccccccccccEEEEEcccEEccccccccccccccccEEEcEEEEEEEEEEEccEEEEEEEEEEccccccEEEEEEEcccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEcEEEccccccccccccEEEEEcccccEEEcccccccccccEEEEEEEcccccccccccccccccccEEEEccccccccccccccccccEEEEEEEEEEcccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEcccccccccccccEEcccccccEEEEEcccEEcccEEEEEEEEEEccccccEEEEEEccccccccccccccHHHHHHHHHHHHccccccccccEEEEccccccccHHHHHHHHHccccccccEEEEEEEEEEEcccccccccccccccEEEEcEEEEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHcccccccccEEEEccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHcHHHHHHHHHHccccccccccccccccccccccccccEEEEccccccEEEEcEEEEHHHHHHHHHHHHHcccccccccccccccEEEEEEEcccccccEEEEEEEHHHHHHHHHHHHHHHcccccccc
cccEEEEEEEEEEEEEEEEEEEcHHHHHHHccccccEEEccccEEEEcccccccEccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccEEEEEccccccEEEcccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccHcccccccccccccccccccEccccccccccccccccEEEEccccccccEEEEcccccccHHHHHHHHHHccccEEEEccccccccccccccccccccccEEccEEccccccEEcccEEEEEEEEEcccccEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHccccccccEEEEccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcEEcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccHHHHHHHHccccccccccccccccccccccccEEEEEcccccEEEEcccccccEEEEEcccccccEEEEcccccHEEcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcccccccccHHHEEEcccccccccccHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcEEcHHHHHHHHHHHcccccccHcccccccccccccHcccccccccccccccccccEccccccccccccccccEEEEccccccccEEEEcccccccHHHHHHHHHHccccEEEEccccccccccccccccccccccEEccEEccccccEEcccEEEEEEEEEcccccEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHcccccccccEEEccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcEEcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEcccccccccccccHHHHHHHHHccccccccccccccccEEEEEEccccccccEEEEEEccHHHcccccccHHHHHHHHHccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHcccEcccHcHHHHHHcccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccccHHHHHHcccccccccHHHEEEcccccccccccEEEEEEEEEccEEEEEEEEccccHHHHHHHHHHHHHccccEEEEccccEEccEccccccccccccccEEEEEEEEEEccccccccccccccHHHHHHHHHHHcccccccccEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEccccccccccccccccccccccEEccEEccccccEEcccEEEEEEEEEcccccEEEEEEEEEEccccccccccccccHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcEEcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccEcccccEEcEccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEcccccHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccc
MKKKIYFIEGVLTIKFHLKISLDAVKEFVdsqgitqtqivprrtlfleptetectiselspfttySVNISLRAhdvsthsmtlswsppiklnpvkyKISLDAVKEFVdsqgitqtqivprrtlfleptetectiselspfttysvnirrrqprkypessavtrplmsgeimtshapsdpvemrrlnfqtpgmvshppipiSRLAQHIENLkandnlkfsqeyesiepgqqftwdhsSMEMNKAKNRYANVIAYDHSRVilstvdgipgsdyinanycdgyrkhnayvatqgplqeTLGDFWRMVWELRSVTIVMMTKLEErtrikcdqywpsrgtetygHITVTLQDVQELASYCIRTFminkgadsERREIKQLQftawpdhgvpehpapFLLFLRRVRamnpgtnslessgvnlpvgplivhcsagvgrtgCFIVIDAMIERIkhdktvdiYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLcgnteipaRSLHVHIQKLMsmevgdtstgmELEFKKlsniraepsrfisaslpcnkhknrlvhilpvessrvcltpvrgdgfiDFIGQVHKTkeqfgqdgpitVHCSRLAQHIEnlkandnlkfsqeyesiepgqqftwdhsSMEMNKAKNRYANVIAYDHSRvilstvdgipgrdgfIDFIGQVHKTkeqfgqdgpitvhcsagvgrtgVFITLSIVLERMQYEGVIDLFQTVRILRtqrpamvqtesiepgqqftwdhsSMEMNKAKNRYANVIAYDHSRVilstvdgipgsdyinanycdgyrkhnayvatqgplqeTLGDFWRMVWELRSVTIVMMTKLEErtrikcdqywpsrgtetygHITVTLQDVQELASYCIRTFminkgadsERREIKQLQftawpdhgvpehpapFLLFLRRVRamnpgtnslessgvnlpvgplivhcsagvgrtgCFIVIDAMIERIkhdktvdiYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLcgnteipassqmitrkddptvslqdpyiaakfsqrnipytfhlgngqtyegfVNKKLVRGLKYRIFVRAIvdtpqkhlytsspfsEQLALdmrevppgpplkrpdpnipgdvrkdpctstsrsscpwsaipgdnqykpstrisvttqmaapqplvkpdfygvvngeEIQVILpqaseeygpishYYLIVvpedkmtydkqpdqfltdemitrkddptvslqdpyiAAKSLHVHIQKLMsmevgdtstgmELEFKKlsniraepsrfisaslpcnkhknrlvhilpvessrvcltpvrgktefkklsniraepsrfisaslpcnkhknrlvhilpvessrvcltpvrgiegsdyinasfidgyrlrsayiatqgpladtTEDFWRMLWEHNSTIVVMLTKLKEMGRYVLrefkvtdardatSRTLRQFqlidwpeqgvpksgdgfIDFIGQVHKTkeqfgqdgpitvHCSLLSLHINltqsewgrekpvaQLSFCSVLIAYLVLFSQekchqywpsersiryewfvvepiaeynmpqyvlrefkvtdardatSRTLRQFqlidwpeqgvpksgdgfIDFIGQVHKTkeqfgqdgpitvhcsagvgrtgVFITLSIVLERMQYEGVIDLFQTVRILRtqrpamvqtehlytsspfseQLALdmrevppgpplkrpdpnipgdvppvhvivehnspgllwIIGPIIAALALSICLVLLFILKSSlessgvnlpvgplivhcsagvgrtgcFIVIDAKEQYQFCYHAALEYlgsfdhytn
MKKKIYFIEGVLTIKFHLKISLDAVKEFVdsqgitqtqivprrtlfLEPTEtectiselspfTTYSVNISLRAHDVSTHsmtlswsppiklNPVKYKISLDAVKEFVdsqgitqtqivprrtlfleptetectiselspfttysvnirrrqprkypessavtrplmsgeimtshapsdpVEMRRLNFQTPGMVSHPPIPISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMtkleertrikcdqywpsrGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQftawpdhgvpEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSrfisaslpcnkHKNRLVHILPVESSRVCLTPVRGDGFIDFIGQVHKTKEQFGQDGPITVHCSRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGRDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQrpamvqtesiepgqqftwDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMtkleertrikcdqywpsrGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQftawpdhgvpEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPASSQMITRKDDPTVSLQDPYIAAKFSQRNIPYTFHLGNGQTYEGFVNKKLVRGLKYRIFVRAIvdtpqkhlytssPFSEQLALDMREVPPGpplkrpdpnipgdvrkdpctstsrsscpwsaipgdnqyKPSTRISVTTQMAAPQPLVKPDFYGVVNGEEIQVILPqaseeygpISHYYLIVVPEDKMTYDKQPDQFLTDEMITRKDDPTVSLQDPYIAAKSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSrfisaslpcnkHKNRlvhilpvessrvcltpvrgktefkklsniraepsrfisaslpcnkHKNRlvhilpvessrvcltpvrgiegsdyinASFIDGYRLRSAYIATQGPLADTTEDFWRMLWEHNSTIVVMLTKLKEMGRYVLRefkvtdardatsrtlrqfqlidwpeqgvpKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSLLSLHINLTQSEWGREKPVAQLSFCSVLIAYLVLFSQEKCHQYWPSERSIRYEWFVVEPIAEYNMPQYVLREFKVTDARDATSRTLRqfqlidwpeqgvpKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTEHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGDVPPVHVIVEHNSPGLLWIIGPIIAALALSICLVLLFILKSSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAKEQYQFCYHAALEYLgsfdhytn
MKKKIYFIEGVLTIKFHLKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNISLRAHDVSTHSMTLSWSPPIKLNPVKYKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNIRRRQPRKYPESSAVTRPLMSGEIMTSHAPSDPVEMRRLNFQTPGMVSHPPIPISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGDGFIDFIGQVHKTKEQFGQDGPITVHCSRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGRDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPASSQMITRKDDPTVSLQDPYIAAKFSQRNIPYTFHLGNGQTYEGFVNKKLVRGLKYRIFVRAIVDTPQKHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGDVRKDPCTSTSRSSCPWSAIPGDNQYKPSTRISVTTQMAAPQPLVKPDFYGVVNGEEIQVILPQASEEYGPISHYYLIVVPEDKMTYDKQPDQFLTDEMITRKDDPTVSLQDPYIAAKSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGKTEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGIEGSDYINASFIDGYRLRSAYIATQGPLADTTEDFWRMLWEHNSTIVVMLTKLKEMGRYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSLLSLHINLTQSEWGREKPVAQLSFCSVLIAYLVLFSQEKCHQYWPSERSIRYEWFVVEPIAEYNMPQYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTEHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGDVPPVHVIVEHNSPGLLWIIGPIIAALALSICLVLLFILKSSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAKEQYQFCYHAALEYLGSFDHYTN
****IYFIEGVLTIKFHLKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNISLRAHDVSTHSMTLSWSPPIKLNPVKYKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNI************************************************************************************************KNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPG*****SSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSMEVGD******LEFKKLSNIR***SRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGDGFIDFIGQVHKTKEQFGQDGPITVHCSRLAQHIENLKANDNLKF************FTW**********KNRYANVIAYDHSRVILSTVDGIPGRDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMV***********TW**********KNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPG*****SSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPA************VSLQDPYIAAKFSQRNIPYTFHLGNGQTYEGFVNKKLVRGLKYRIFVRAIVDTPQKHLY*************************************************************************PLVKPDFYGVVNGEEIQVILPQASEEYGPISHYYLIVVPEDKMTYD*****FLT***I*******VSLQDPYIAAKSLHVHIQKLMSMEVG*******LEFK*L**I*****RFISASLPCNKHKNRLVHILPVESSRVCLTPVRGKTEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGIEGSDYINASFIDGYRLRSAYIATQGPLADTTEDFWRMLWEHNSTIVVMLTKLKEMGRYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSLLSLHINLTQSEWGREKPVAQLSFCSVLIAYLVLFSQEKCHQYWPSERSIRYEWFVVEPIAEYNMPQYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTEHLY*********************************PPVHVIVEHNSPGLLWIIGPIIAALALSICLVLLFILKSSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAKEQYQFCYHAALEYLGSFDH***
**KKIYFIEGVLTIKFHLKISLDAVKEFVD************************TISELSPFTTYSVNISLR*****THSMTLSWSPPIKLNPVKYKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYS****************************************************PIPISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQ**************ELEFKKLSNIRAE***********NKHKNRLVHILPVESSRVCLTPVRGDGFIDFIGQVHKTKEQFGQDGPITVHCSRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGRDGFIDFIGQVH***********ITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAM************NLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPASS**********************SQRNIPYTF*************KKLVRGLKYRIFVRAI************PFSEQLALDMREVPPGPPLKRPDPNIPGDVRKDPCTSTSRSSCPWSAIPGDNQYKPSTRISVTTQMAAPQPLVKPDFYGVVNGEEIQVILPQASEEYGPISHYYLIVVP************FLTDEM****************AAKSLHVHIQKLMSMEVGDTSTGMELEFKK**********************NRLVHILPV*********VRGKTEFKKLSNIRAEPSRFIS*SLPCNKHKNRLVHILPVESSRVCLTPVRGIEGSDYINASFIDGYRLRSAYIATQGPLADTTEDFWRMLWEHNSTIVVMLTKLKEMGRYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQ*GQDGPITVHCSLLSLHINLTQSEWGREKPVAQLSFCSVLIAYLVLFSQEKCHQYWPSERSIRYEWFVVEPIAEYNMPQYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHK*****GQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTEHLYTSSPFSEQLALDMRE*****************************PGLLWIIGPIIAALALSICLVLLFILK***********VGPLIVHCSAGVGRTGCFIVIDAKEQYQFCYHAALEYLGSFD*Y**
MKKKIYFIEGVLTIKFHLKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNISLRAHDVSTHSMTLSWSPPIKLNPVKYKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNIRR***********VTRPLMSGEIMTSHAPSDPVEMRRLNFQTPGMVSHPPIPISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGDGFIDFIGQVHKTKEQFGQDGPITVHCSRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGRDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPASSQMITRKDDPTVSLQDPYIAAKFSQRNIPYTFHLGNGQTYEGFVNKKLVRGLKYRIFVRAIVDTPQKHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGDVR************PWSAIPGDNQYKPSTRISVTTQMAAPQPLVKPDFYGVVNGEEIQVILPQASEEYGPISHYYLIVVPEDKMTYDKQPDQFLTDEMITRKDDPTVSLQDPYIAAKSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGKTEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGIEGSDYINASFIDGYRLRSAYIATQGPLADTTEDFWRMLWEHNSTIVVMLTKLKEMGRYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSLLSLHINLTQSEWGREKPVAQLSFCSVLIAYLVLFSQEKCHQYWPSERSIRYEWFVVEPIAEYNMPQYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTEHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGDVPPVHVIVEHNSPGLLWIIGPIIAALALSICLVLLFILKSSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAKEQYQFCYHAALEYLGSFDHYTN
*KKKIYFIEGVLTIKFHLKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNISLRAH****HSMTLSWSPPIKLNPVKYKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNIRRR****************************PVEMRRLNFQTPGMVSHPPIPISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSME****STGMELEFKKLSN*RAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGDGFIDFIGQVHKTKEQFGQDGPITVHCSRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGRDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPASSQMITRKDDPTVSLQDPYIAAKFSQRNIPYTFHLGNGQTYEGFVNKKLVRGLKYRIFVRAIVDTPQKHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGDVRKDPCTSTSRSSCPWSAIPGDNQYKPSTRISVTTQMAAPQPLVKPDFYGVVNGEEIQVILPQASEEYGPISHYYLIVVPEDKMTYDKQPDQFLTDEMITRKDDPTVSLQDPYIAAKSLHVHIQKLMSMEVGDTSTGMELEFKK****RAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGKTEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGIEGSDYINASFIDGYRLRSAYIATQGPLADTTEDFWRMLWEHNSTIVVMLTKLKEMGRYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSLLSLHINLTQSEWGREKPVAQLSFCSVLIAYLVLFSQEKCHQYWPSERSIRYEWFVVEPIAEYNMPQYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTEHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGDVPPVHVIVEHNSPGLLWIIGPIIAALALSICLVLLFILKSSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAKEQYQFCYHAALEYLGSFD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKIYFIEGVLTIKFHLKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNISLRAHDVSTHSMTLSWSPPIKLNPVKYKISLDAVKEFVDSQGITQTQIVPRRTLFLEPTETECTISELSPFTTYSVNIRRRQPRKYPESSAVTRPLMSGEIMTSHAPSDPVEMRRLNFQTPGMVSHPPIPISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGDGFIDFIGQVHKTKEQFGQDGPITVHCSRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGRDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPASSQMITRKDDPTVSLQDPYIAAKFSQRNIPYTFHLGNGQTYEGFVNKKLVRGLKYRIFVRAIVDTPQKHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGDVRKDPCTSTSRSSCPWSAIPGDNQYKPSTRISVTTQMAAPQPLVKPDFYGVVNGEEIQVILPQASEEYGPISHYYLIVVPEDKMTYDKQPDQFLTDEMITRKDDPTVSLQDPYIAAKSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGKTEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGIEGSDYINASFIDGYRLRSAYIATQGPLADTTEDFWRMLWEHNSTIVVMLTKLKEMGRYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSLLSLHINLTQSEWGREKPVAQLSFCSVLIAYLVLFSQEKCHQYWPSERSIRYEWFVVEPIAEYNMPQYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTEHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGDVPPVHVIVEHNSPGLLWIIGPIIAALALSICLVLLFILKSSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAKEQYQFCYHAALEYLGSFDHYTN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1773 2.2.26 [Sep-21-2011]
P166212029 Tyrosine-protein phosphat yes N/A 0.323 0.282 0.632 0.0
P234681912 Receptor-type tyrosine-pr no N/A 0.322 0.298 0.616 0.0
Q644871912 Receptor-type tyrosine-pr no N/A 0.322 0.298 0.616 0.0
B0V2N11907 Receptor-type tyrosine-pr no N/A 0.321 0.298 0.602 0.0
Q646051907 Receptor-type tyrosine-pr no N/A 0.316 0.294 0.601 0.0
A7MBJ41898 Receptor-type tyrosine-pr no N/A 0.308 0.288 0.616 0.0
A4IFW21909 Receptor-type tyrosine-pr no N/A 0.308 0.286 0.614 0.0
P105861907 Receptor-type tyrosine-pr no N/A 0.308 0.286 0.610 0.0
A2A8L51898 Receptor-type tyrosine-pr no N/A 0.308 0.288 0.609 0.0
Q133321948 Receptor-type tyrosine-pr no N/A 0.321 0.292 0.587 0.0
>sp|P16621|LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster GN=Lar PE=1 SV=2 Back     alignment and function desciption
 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/617 (63%), Positives = 463/617 (75%), Gaps = 43/617 (6%)

Query: 148  RRRQPRKYPESSAVTRPLMSGEIMTSHAPSDPVEMRRLNFQTPGMVSHPPIPISRLAQHI 207
            RRRQP K P+ +AVTRPLM+ ++     PSDPV+MRRLNFQTPGM+SHPPIPIS  A HI
Sbjct: 1404 RRRQPCKTPDQAAVTRPLMAADLGAGPTPSDPVDMRRLNFQTPGMISHPPIPISEFANHI 1463

Query: 208  ENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIP 267
            E LK+NDN KFSQEYESIEPGQQFTWD+S++E NK+KNRYANV AYDHSRV L  V+G+ 
Sbjct: 1464 ERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVV 1523

Query: 268  GSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCD 327
            GSDYINANYCDGYRKHNAYVATQGPLQET  DFWRM WEL++ TIVMMT+LEERTRIKCD
Sbjct: 1524 GSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCD 1583

Query: 328  QYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPE 387
            QYWP+RGTETYG I VT+ + QELA+Y IRTF + +   ++RREIKQLQFTAWPDHGVP+
Sbjct: 1584 QYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPD 1643

Query: 388  HPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKH 447
            HPAPFL FLRR RA+ P  +           GP+IVHCSAGVGRTGC+IVID+M+ER+KH
Sbjct: 1644 HPAPFLQFLRRCRALTPPES-----------GPVIVHCSAGVGRTGCYIVIDSMLERMKH 1692

Query: 448  DKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSM 507
            +K +DIYGHVTCLRAQRNYMVQTEDQY+FIHDA+LEA++CG TE+PAR+LH H+QKL+  
Sbjct: 1693 EKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLIT 1752

Query: 508  EVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRG-- 565
            E G+T +GME+EFKKLSN++ + S+F++A+LPCNKHKNRLVHILP ESSRV LTP+ G  
Sbjct: 1753 EPGETISGMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIE 1812

Query: 566  ----------DG------FIDFIGQVHKTKEQFGQDGPITVHCSRLAQHIENLKANDNLK 609
                      DG      +I   G V    E F +   +  H S +   +  LK     K
Sbjct: 1813 GSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRM--LWEHNSTIVVMLTKLKEMGREK 1870

Query: 610  FSQ----------EYESIEPGQQFTWDHSSM-EMNKAKNRYANVIAYDHSRVILSTVDGI 658
              Q          +Y  ++P  ++      + E      R  +       + I     G+
Sbjct: 1871 CFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGV 1930

Query: 659  PGR-DGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLF 717
            P   +GFIDFIGQVHKTKEQFGQDGPITVHCSAGVGR+GVFITLSIVLERMQYEGV+D+F
Sbjct: 1931 PKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVF 1990

Query: 718  QTVRILRTQRPAMVQTE 734
            QTVRILR+QRPAMVQTE
Sbjct: 1991 QTVRILRSQRPAMVQTE 2007
Possible cell adhesion receptor. It possesses an intrinsic protein tyrosine phosphatase activity (PTPase). It controls motor axon guidance.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|P23468|PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens GN=PTPRD PE=1 SV=2 Back     alignment and function description
>sp|Q64487|PTPRD_MOUSE Receptor-type tyrosine-protein phosphatase delta OS=Mus musculus GN=Ptprd PE=1 SV=3 Back     alignment and function description
>sp|B0V2N1|PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus GN=Ptprs PE=1 SV=1 Back     alignment and function description
>sp|Q64605|PTPRS_RAT Receptor-type tyrosine-protein phosphatase S OS=Rattus norvegicus GN=Ptprs PE=1 SV=2 Back     alignment and function description
>sp|A7MBJ4|PTPRF_BOVIN Receptor-type tyrosine-protein phosphatase F OS=Bos taurus GN=PTPRF PE=2 SV=1 Back     alignment and function description
>sp|A4IFW2|PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio GN=ptprf PE=2 SV=1 Back     alignment and function description
>sp|P10586|PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens GN=PTPRF PE=1 SV=2 Back     alignment and function description
>sp|A2A8L5|PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus GN=Ptprf PE=1 SV=1 Back     alignment and function description
>sp|Q13332|PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens GN=PTPRS PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1773
345481062 2068 PREDICTED: tyrosine-protein phosphatase 0.336 0.288 0.670 0.0
383854788 2040 PREDICTED: tyrosine-protein phosphatase 0.336 0.292 0.669 0.0
340724097 1926 PREDICTED: tyrosine-protein phosphatase 0.336 0.309 0.667 0.0
3072019031374 Tyrosine-protein phosphatase Lar [Harpeg 0.336 0.434 0.666 0.0
3320205711785 Tyrosine-protein phosphatase Lar [Acromy 0.336 0.333 0.663 0.0
350427923 2025 PREDICTED: tyrosine-protein phosphatase 0.336 0.294 0.664 0.0
3071661431810 Tyrosine-protein phosphatase Lar [Campon 0.336 0.329 0.661 0.0
328786146 2029 PREDICTED: tyrosine-protein phosphatase 0.336 0.294 0.661 0.0
3800219841774 PREDICTED: tyrosine-protein phosphatase 0.336 0.336 0.658 0.0
189235110 2016 PREDICTED: similar to receptor tyrosine 0.324 0.285 0.654 0.0
>gi|345481062|ref|XP_001604845.2| PREDICTED: tyrosine-protein phosphatase Lar-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/641 (67%), Positives = 487/641 (75%), Gaps = 44/641 (6%)

Query: 148  RRRQPRKYPESSAVTRPLMSGEIMTSHAPSDPVEMRRLNFQTPGMVSHPPIPISRLAQHI 207
            +RRQP K P+ +AVTRPLMS +I ++HAPSDPVEMRRLNFQTPGM+SHPPIPIS L+ HI
Sbjct: 1444 KRRQPCKAPDQTAVTRPLMSADISSNHAPSDPVEMRRLNFQTPGMISHPPIPISELSNHI 1503

Query: 208  ENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIP 267
            E LKANDNLKFSQEYESIEPGQQFTWDHS+ME+N +KNRYANVIAYDHSRVIL TVDGIP
Sbjct: 1504 ERLKANDNLKFSQEYESIEPGQQFTWDHSNMEVNTSKNRYANVIAYDHSRVILQTVDGIP 1563

Query: 268  GSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCD 327
            GSDYINANYCDGYRK NAYVATQGPLQET  DFWRM WELRS TIVMMTKLEERTRIKCD
Sbjct: 1564 GSDYINANYCDGYRKQNAYVATQGPLQETFADFWRMCWELRSSTIVMMTKLEERTRIKCD 1623

Query: 328  QYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPE 387
            QYWP+RGTETYG + +T+ DVQELA+YCIRTF + +   SERREIKQLQFTAWPDHGVPE
Sbjct: 1624 QYWPTRGTETYGQMQITISDVQELATYCIRTFQVCRHGYSERREIKQLQFTAWPDHGVPE 1683

Query: 388  HPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKH 447
            HPAPFL FLRRVR +NP T+S          GPLIVHCSAGVGRTGCFIVID+M+ERIKH
Sbjct: 1684 HPAPFLQFLRRVRTLNP-TDS----------GPLIVHCSAGVGRTGCFIVIDSMLERIKH 1732

Query: 448  DKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSM 507
            +KT+DIYGHVTCLRAQRNYMVQTEDQY+FIHDALLEAV+CGNTE+PAR+LH HIQKLM  
Sbjct: 1733 EKTIDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVICGNTEVPARNLHSHIQKLMQP 1792

Query: 508  EVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVR--- 564
            E+ D  TGMELEFKKLSNI+++ +RFISA+LPCNKHKNRLVHILP E +RVCL P R   
Sbjct: 1793 EI-DNITGMELEFKKLSNIKSDSTRFISANLPCNKHKNRLVHILPYECTRVCLQPQRNIE 1851

Query: 565  GDGFID--FIGQVHKTKEQFGQDGPIT-----------VHCSRLAQHIENLKANDNLKFS 611
            G  +I+   I             GP++            H S +   +  LK     K  
Sbjct: 1852 GSDYINASLIDGYRYRSAYIATQGPLSDTTDDFWRMLWEHNSTIVVMLTKLKEMGREKCH 1911

Query: 612  QEYES----------IEPGQQFTWDHSSM-EMNKAKNRYANVIAYDHSRVILSTVDGIPG 660
              + S          ++P  ++      + E      R  +       + I     G+P 
Sbjct: 1912 LYWPSDRTIRYQCFVVDPIAEYNMPQYILREFKVTDARDGSSRTVRQFQFIDWPEQGVPK 1971

Query: 661  R-DGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQT 719
              DGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGV+D+FQT
Sbjct: 1972 SVDGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVVDIFQT 2031

Query: 720  VRILRTQRPAMVQTESIEPGQQFTWDHSSMEMNKAKNRYAN 760
            VRILRTQRPAMVQTE      QF +  +S+E   + + YAN
Sbjct: 2032 VRILRTQRPAMVQTED---QYQFCY-RASLEYLGSFDHYAN 2068

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383854788|ref|XP_003702902.1| PREDICTED: tyrosine-protein phosphatase Lar-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340724097|ref|XP_003400421.1| PREDICTED: tyrosine-protein phosphatase Lar-like, partial [Bombus terrestris] Back     alignment and taxonomy information
>gi|307201903|gb|EFN81532.1| Tyrosine-protein phosphatase Lar [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332020571|gb|EGI60979.1| Tyrosine-protein phosphatase Lar [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350427923|ref|XP_003494927.1| PREDICTED: tyrosine-protein phosphatase Lar-like, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|307166143|gb|EFN60392.1| Tyrosine-protein phosphatase Lar [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328786146|ref|XP_397010.3| PREDICTED: tyrosine-protein phosphatase Lar [Apis mellifera] Back     alignment and taxonomy information
>gi|380021984|ref|XP_003694835.1| PREDICTED: tyrosine-protein phosphatase Lar-like [Apis florea] Back     alignment and taxonomy information
>gi|189235110|ref|XP_971078.2| PREDICTED: similar to receptor tyrosine phosphatase type r2a [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1773
FB|FBgn00004642029 Lar "Leukocyte-antigen-related 0.233 0.204 0.717 4.5e-287
UNIPROTKB|F1NQ481918 F1NQ48 "Uncharacterized protei 0.241 0.223 0.688 8.6e-254
UNIPROTKB|F1NQ491911 F1NQ49 "Uncharacterized protei 0.241 0.223 0.688 8.6e-254
UNIPROTKB|F1MJR21776 PTPRD "Uncharacterized protein 0.239 0.239 0.680 1.6e-252
UNIPROTKB|F1PH171890 PTPRD "Uncharacterized protein 0.239 0.224 0.678 2e-252
UNIPROTKB|G3XAE21899 PTPRD "Receptor-type tyrosine- 0.239 0.223 0.680 2.6e-252
UNIPROTKB|P234681912 PTPRD "Receptor-type tyrosine- 0.239 0.222 0.680 2.6e-252
UNIPROTKB|G3XAD51890 PTPRD "Receptor-type tyrosine- 0.239 0.224 0.680 2.6e-252
UNIPROTKB|F5GWY71502 PTPRD "Receptor-type tyrosine- 0.244 0.288 0.669 5.3e-252
UNIPROTKB|F1LM721386 Ptprd "Protein Ptprd" [Rattus 0.239 0.306 0.680 6.8e-252
FB|FBgn0000464 Lar "Leukocyte-antigen-related-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1666 (591.5 bits), Expect = 4.5e-287, Sum P(5) = 4.5e-287
 Identities = 305/425 (71%), Positives = 360/425 (84%)

Query:   148 RRRQPRKYPESSAVTRPLMSGEIMTSHAPSDPVEMRRLNFQTPGMVSHPPIPISRLAQHI 207
             RRRQP K P+ +AVTRPLM+ ++     PSDPV+MRRLNFQTPGM+SHPPIPIS  A HI
Sbjct:  1404 RRRQPCKTPDQAAVTRPLMAADLGAGPTPSDPVDMRRLNFQTPGMISHPPIPISEFANHI 1463

Query:   208 ENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIP 267
             E LK+NDN KFSQEYESIEPGQQFTWD+S++E NK+KNRYANV AYDHSRV L  V+G+ 
Sbjct:  1464 ERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVV 1523

Query:   268 GSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCD 327
             GSDYINANYCDGYRKHNAYVATQGPLQET  DFWRM WEL++ TIVMMT+LEERTRIKCD
Sbjct:  1524 GSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCD 1583

Query:   328 QYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPE 387
             QYWP+RGTETYG I VT+ + QELA+Y IRTF + +   ++RREIKQLQFTAWPDHGVP+
Sbjct:  1584 QYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPD 1643

Query:   388 HPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKH 447
             HPAPFL FLRR RA+ P     ES       GP+IVHCSAGVGRTGC+IVID+M+ER+KH
Sbjct:  1644 HPAPFLQFLRRCRALTPP----ES-------GPVIVHCSAGVGRTGCYIVIDSMLERMKH 1692

Query:   448 DKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSM 507
             +K +DIYGHVTCLRAQRNYMVQTEDQY+FIHDA+LEA++CG TE+PAR+LH H+QKL+  
Sbjct:  1693 EKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLIT 1752

Query:   508 EVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGDG 567
             E G+T +GME+EFKKLSN++ + S+F++A+LPCNKHKNRLVHILP ESSRV LTP+ G  
Sbjct:  1753 EPGETISGMEVEFKKLSNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIE 1812

Query:   568 FIDFI 572
               D++
Sbjct:  1813 GSDYV 1817
GO:0006470 "protein dephosphorylation" evidence=NAS;IDA
GO:0005001 "transmembrane receptor protein tyrosine phosphatase activity" evidence=ISS
GO:0004725 "protein tyrosine phosphatase activity" evidence=NAS;IDA
GO:0005886 "plasma membrane" evidence=ISS;IDA
GO:0007411 "axon guidance" evidence=IMP;TAS
GO:0008045 "motor neuron axon guidance" evidence=IGI;NAS;IMP;TAS
GO:0016021 "integral to membrane" evidence=NAS
GO:0001700 "embryonic development via the syncytial blastoderm" evidence=NAS
GO:0048477 "oogenesis" evidence=IMP
GO:0007399 "nervous system development" evidence=IMP
GO:0007155 "cell adhesion" evidence=IMP
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0045467 "R7 cell development" evidence=IMP
GO:0008594 "photoreceptor cell morphogenesis" evidence=IMP
GO:0031290 "retinal ganglion cell axon guidance" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0030424 "axon" evidence=IDA
GO:0048841 "regulation of axon extension involved in axon guidance" evidence=IMP
GO:0048675 "axon extension" evidence=IMP
GO:0051124 "synaptic growth at neuromuscular junction" evidence=IMP
GO:0007412 "axon target recognition" evidence=IMP
GO:0032093 "SAM domain binding" evidence=IPI
GO:0005925 "focal adhesion" evidence=IDA
UNIPROTKB|F1NQ48 F1NQ48 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQ49 F1NQ49 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MJR2 PTPRD "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PH17 PTPRD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3XAE2 PTPRD "Receptor-type tyrosine-protein phosphatase delta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P23468 PTPRD "Receptor-type tyrosine-protein phosphatase delta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3XAD5 PTPRD "Receptor-type tyrosine-protein phosphatase delta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5GWY7 PTPRD "Receptor-type tyrosine-protein phosphatase delta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM72 Ptprd "Protein Ptprd" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.691
3rd Layer3.1.3.480.737

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1773
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 1e-112
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 1e-112
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 1e-106
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 1e-106
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 1e-106
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 1e-104
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 3e-60
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 2e-57
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 1e-52
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 5e-52
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 2e-51
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 2e-51
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 1e-50
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 3e-49
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 3e-48
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 5e-47
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 5e-47
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 7e-47
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 8e-44
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 8e-44
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 3e-40
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 3e-40
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 2e-34
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 2e-34
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 2e-34
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 2e-34
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 1e-31
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 1e-31
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 8e-27
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 1e-24
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 2e-24
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 2e-24
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 1e-23
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 2e-22
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 2e-22
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 2e-22
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 4e-21
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 2e-20
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 2e-20
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 7e-17
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 7e-17
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 1e-16
PHA02740298 PHA02740, PHA02740, protein tyrosine phosphatase; 4e-16
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 2e-15
PHA02740298 PHA02740, PHA02740, protein tyrosine phosphatase; 3e-14
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 2e-10
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 4e-10
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 4e-10
PHA02740298 PHA02740, PHA02740, protein tyrosine phosphatase; 1e-09
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 8e-09
PHA02740298 PHA02740, PHA02740, protein tyrosine phosphatase; 8e-09
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 1e-08
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 2e-08
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 4e-08
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 4e-08
smart0006083 smart00060, FN3, Fibronectin type 3 domain 1e-07
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 2e-07
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 4e-07
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 6e-07
pfam0004184 pfam00041, fn3, Fibronectin type III domain 6e-07
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 6e-07
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 6e-07
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 7e-07
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 1e-06
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 2e-06
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 9e-06
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 3e-04
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 4e-04
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 0.002
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 0.002
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information 
 Score =  356 bits (915), Expect = e-112
 Identities = 121/241 (50%), Positives = 156/241 (64%), Gaps = 12/241 (4%)

Query: 244 KNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRM 303
           KNRY +++ YDH+RV L   D   GSDYINA+Y DGY    AY+ATQGPL  T+ DFWRM
Sbjct: 2   KNRYKDILPYDHTRVKLKPDDD-EGSDYINASYIDGYNPPKAYIATQGPLPNTVEDFWRM 60

Query: 304 VWELRSVTIVMMTKLEERTRIKCDQYWPSR-GTETYGHITVTLQDVQELASYCIRTFMIN 362
           VWE +   IVM+T+L E+ R KC QYWP   G+ TYG ITVTL   ++L  Y +RT  ++
Sbjct: 61  VWEQKVPVIVMLTELVEKGREKCAQYWPEEEGSLTYGDITVTLVSEEKLDDYTVRTLKLS 120

Query: 363 KGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLI 422
                E R +   Q+T WPDHGVPE P   L  LR+VR       S          GP++
Sbjct: 121 NTGTGETRTVTHFQYTGWPDHGVPESPDSLLDLLRKVRKSQQQPGS----------GPIV 170

Query: 423 VHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALL 482
           VHCSAGVGRTG FI ID +++R++ +  VDI+  V  LR+QR  MVQTE+QY+F++ A+L
Sbjct: 171 VHCSAGVGRTGTFIAIDILLQRLEAEGVVDIFQTVKELRSQRPGMVQTEEQYIFLYRAIL 230

Query: 483 E 483
           E
Sbjct: 231 E 231

The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active. Length = 231
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1773
KOG4228|consensus1087 100.0
KOG4228|consensus1087 100.0
PHA02740298 protein tyrosine phosphatase; Provisional 100.0
PHA02742303 protein tyrosine phosphatase; Provisional 100.0
PHA02747312 protein tyrosine phosphatase; Provisional 100.0
PHA02742303 protein tyrosine phosphatase; Provisional 100.0
PHA02746323 protein tyrosine phosphatase; Provisional 100.0
KOG0790|consensus600 100.0
KOG0790|consensus600 100.0
PHA02738320 hypothetical protein; Provisional 100.0
PHA02740298 protein tyrosine phosphatase; Provisional 100.0
KOG0791|consensus374 100.0
PHA02747312 protein tyrosine phosphatase; Provisional 100.0
PHA02746323 protein tyrosine phosphatase; Provisional 100.0
PHA02738320 hypothetical protein; Provisional 100.0
KOG0792|consensus1144 100.0
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 100.0
KOG0792|consensus1144 100.0
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 100.0
KOG0791|consensus374 100.0
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 100.0
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 100.0
KOG0793|consensus1004 100.0
KOG0793|consensus1004 100.0
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 100.0
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 100.0
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 100.0
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 100.0
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 100.0
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 100.0
KOG0789|consensus415 100.0
KOG0789|consensus415 100.0
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.83
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.83
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.81
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.81
PTZ00242166 protein tyrosine phosphatase; Provisional 99.52
PTZ00242166 protein tyrosine phosphatase; Provisional 99.34
KOG2836|consensus173 99.32
PTZ00393241 protein tyrosine phosphatase; Provisional 99.24
KOG1720|consensus225 99.08
PTZ00393241 protein tyrosine phosphatase; Provisional 98.97
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 98.76
KOG1720|consensus225 98.71
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 98.56
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 98.56
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 98.48
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 98.28
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 98.2
KOG2836|consensus173 98.16
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 98.0
PRK12361 547 hypothetical protein; Provisional 97.84
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 97.79
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 97.09
PRK12361547 hypothetical protein; Provisional 96.96
KOG1719|consensus183 96.5
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 95.74
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 95.72
KOG1718|consensus198 95.65
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 95.06
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 95.03
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 94.97
KOG2283|consensus 434 94.6
KOG1716|consensus285 93.64
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 93.28
KOG2283|consensus434 93.19
COG5350172 Predicted protein tyrosine phosphatase [General fu 93.17
COG5350172 Predicted protein tyrosine phosphatase [General fu 92.42
KOG1718|consensus198 92.04
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 91.18
KOG0196|consensus996 90.81
KOG1717|consensus343 90.8
PLN02727 986 NAD kinase 90.58
KOG1716|consensus285 90.24
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 89.98
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 88.7
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 87.82
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 87.08
KOG4221|consensus1381 86.66
KOG1719|consensus183 86.37
>KOG4228|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.1e-134  Score=1269.20  Aligned_cols=561  Identities=56%  Similarity=0.952  Sum_probs=517.8

Q ss_pred             cccchhHHHHHHHHhcCCc--ccccccCCCCCCcccccchhhhhhcccccccccccCCceeEeeccCCCCCCCceeeEec
Q psy8773         711 EGVIDLFQTVRILRTQRPA--MVQTESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYC  788 (1773)
Q Consensus       711 ~~~~~~~~~~~~lr~~~~~--~~~~e~~~~~~~~t~~~s~~~~N~~KNRY~nIlpyD~SRV~Ls~~~g~~~sDYINASyI  788 (1773)
                      ..+.++.+++..++++...  ..++|+++.| +.+|+++..++|+.||||.||++|||+||+|...+|++++||||||||
T Consensus       523 I~v~dl~~~i~~~~~~~~~~F~~Eyesl~~~-~~~~~~s~~~en~~KNRY~nilayD~sRV~L~~i~Gd~~sDYINAnyI  601 (1087)
T KOG4228|consen  523 IPVADLLEHIERRKADDGYGFKQEYESLPEG-QFTWEHSNKKENKQKNRYENILAYDHSRVILPPIEGDPNSDYINANYI  601 (1087)
T ss_pred             ccHHHHHHHHHHhhcccccchHHHHhhcccc-CCccccCccccccccccCCcchhhhcceeeecccCCCccccceeeeee
Confidence            4577888999998886544  4568899999 899999999999999999999999999999999999999999999999


Q ss_pred             cCcCCCCceEEecCCCCCChhhhhhheeecCCcEEEEccCcccccccccccccCCCCceeeecEEEEEEEEEeecCEEEE
Q psy8773         789 DGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIR  868 (1773)
Q Consensus       789 dGy~~~~~yIaTQgPL~~Tv~DFWrMVwE~~v~vIVMLt~l~E~gk~KC~qYWP~~~~~~yG~~tVtl~~~~~~~~yiiR  868 (1773)
                      |||+.+++|||||||+++|++||||||||+++.+|||+|++.|.++.||.+||| ++.++||++.|++.+.....+|++|
T Consensus       602 dGy~e~n~yIaaQgP~~eTv~DFWRMVWEq~S~~IVMvTnl~E~~r~kC~qYWP-~~t~~yGdi~V~~~~~~~~a~y~iR  680 (1087)
T KOG4228|consen  602 DGYKEPNAYIAAQGPRPETVGDFWRMVWEQKSAGIVMVTNLEEFSRVKCAQYWP-EGTETYGDIKVTLVQTKPLAEYGIR  680 (1087)
T ss_pred             ecccccccceeccCCcccchHHHHHHheeccCCcEEEEecccccccccccccCC-CCccccccccccceeeeeeccceEE
Confidence            999999999999999999999999999999999999999999999999999999 7889999999999999999999999


Q ss_pred             EEEEEeCCCCceeEEEEEEeCCCCCCCCCCCChhHHHHHHHHHhhCCCCCCCcCCCCCCCCCCEEEEcCCCCccchhHhH
Q psy8773         869 TFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIV  948 (1773)
Q Consensus       869 tl~V~~~~~~~~R~V~hfhyt~WPD~gVP~s~~~lL~fl~~V~~~~~~~~~~~~~~~~~~~gPIVVHCSaGVGRTGtFIA  948 (1773)
                      +|.|...+....|.|+||||++|||||+|..+.++|.|+++|+..++..           .||||||||||+||||+|++
T Consensus       681 tf~l~~~g~~~~R~v~qfhFt~Wpd~gvPe~~t~lL~f~rrvk~~~p~~-----------aGPiVVHCSAGvGRTG~fi~  749 (1087)
T KOG4228|consen  681 TFALKKQGENPKREVRQFHFTAWPDHGVPETPTGLLKFRRRVKTFNPPD-----------AGPIVVHCSAGVGRTGCFIV  749 (1087)
T ss_pred             eeeccccCCCCCceeeeeeeccCCCCCCcccchHHHHHHHHhccCCCcC-----------CCCEEEECCCCCCCcceEEE
Confidence            9999998888899999999999999999999999999999999987543           69999999999999999999


Q ss_pred             HHHHHHHHhhCCCcchHHHHHHHHhccccccCChhhhhhHHHHHHHHHHcCCccccccccccccCCCCCcccCchhhhhh
Q psy8773         949 IDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPASSQMITRKDDPTVSLQDPYIAAK 1028 (1773)
Q Consensus       949 Id~lLeql~~e~~VDVf~~Vk~LR~QR~~mVQT~eQY~FiY~aLlEyl~~g~tei~~~~~~~~~~~~~~~~~~~~~~~~k 1028 (1773)
                      ||+|+++++.|+.+||++.|+.||.||+.||||.+||.|||+|++|+.+||+|++++++                     
T Consensus       750 iDaml~~~~~e~~vdiy~~v~~lR~QR~~mVQt~eQYiFi~~AllE~~~~G~T~i~~~~---------------------  808 (1087)
T KOG4228|consen  750 IDAMLDRLECEGKVDIYGHVKTLRRQRNNMVQTEEQYIFIHEALLEACLCGDTEVPAST---------------------  808 (1087)
T ss_pred             eHHHHHHHHhhCccceechhHHHHhccccccccHHHHHHHHHHHHHHHhcCCccccHHH---------------------
Confidence            99999999999999999999999999999999999999999999999999999998842                     


Q ss_pred             ccccCCccccccCCCcccccchhhhhhcccccceeeeccccCccccccCCCcchhhhhccccCCCCCCCCCCCCCCCCCC
Q psy8773        1029 FSQRNIPYTFHLGNGQTYEGFVNKKLVRGLKYRIFVRAIVDTPQKHLYTSSPFSEQLALDMREVPPGPPLKRPDPNIPGD 1108 (1773)
Q Consensus      1029 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~ 1108 (1773)
                                                                                                      
T Consensus       809 --------------------------------------------------------------------------------  808 (1087)
T KOG4228|consen  809 --------------------------------------------------------------------------------  808 (1087)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCccccccccccCCCCCCccCCccccccccchhhcccccccccCCcccceeeecc
Q psy8773        1109 VRKDPCTSTSRSSCPWSAIPGDNQYKPSTRISVTTQMAAPQPLVKPDFYGVVNGEEIQVILPQASEEYGPISHYYLIVVP 1188 (1773)
Q Consensus      1109 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1188 (1773)
                                                                                                      
T Consensus       809 --------------------------------------------------------------------------------  808 (1087)
T KOG4228|consen  809 --------------------------------------------------------------------------------  808 (1087)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccccccCCCCCccchhhhhccCCCCCccCCchhhhhhhhhhhhhhccccccCCCCchhHHHHhhccCCCCCCccccccCC
Q psy8773        1189 EDKMTYDKQPDQFLTDEMITRKDDPTVSLQDPYIAAKSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSRFISASL 1268 (1773)
Q Consensus      1189 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ef~~l~~~~~~~~~~~~~~~ 1268 (1773)
                                                            |+.|+++|.+++++.++++||+|||+|+...+....+     
T Consensus       809 --------------------------------------~~~~~~~l~~~~p~~~~t~le~EF~~L~~~~~~~~~~-----  845 (1087)
T KOG4228|consen  809 --------------------------------------LAPYSQKLKRIDPPENKTGLEEEFKTLNSCKPRTRMM-----  845 (1087)
T ss_pred             --------------------------------------HHHHHHHhccCCCCCCCcchHHHHHHHhhccccchhh-----
Confidence                                                  2233444445566678899999999999877664322     


Q ss_pred             cccccccccccccccccccccccccCCccchhccccccCCCccccccCCCcccCCCCCCCCCCCCCCceecccCCCCCCC
Q psy8773        1269 PCNKHKNRLVHILPVESSRVCLTPVRGKTEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGIEGS 1348 (1773)
Q Consensus      1269 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~knr~~~~~p~d~~rv~L~~~~~~~~s 1348 (1773)
                                                                  ++|++++|+.|||.++|+|+|++||+|.+.+|. +|
T Consensus       846 --------------------------------------------~~~~l~~N~~KNR~~~i~P~d~~rv~L~~~~G~-~s  880 (1087)
T KOG4228|consen  846 --------------------------------------------ICGNLPENKSKNRQVNILPYDRNRVILIPTHGE-SS  880 (1087)
T ss_pred             --------------------------------------------hccccchhcccccccccCCchhcccceeccCCC-cc
Confidence                                                        258999999999999999999999999999997 89


Q ss_pred             CcceeeeeccccCCCeEEEecCCCcccHHHHHHHHHhccccEEEEcccccccCceeeeeeeecccccccccceeeeeecC
Q psy8773        1349 DYINASFIDGYRLRSAYIATQGPLADTTEDFWRMLWEHNSTIVVMLTKLKEMGRYVLREFKVTDARDATSRTLRQFQLID 1428 (1773)
Q Consensus      1349 dYINAsfidGY~~~~~fI~TQ~Pl~~Tv~DFWrMV~e~~~~~IVmL~~~~e~~~~~~r~~~~~~~~~~~~~~v~q~~~~~ 1428 (1773)
                      |||||||||||+++++|||||+||++|++|||||||||+|++||||++++++                            
T Consensus       881 dYINAs~idgy~~~~~fivtq~PL~~T~~DFWrmi~d~~~tsiVmL~~l~~~----------------------------  932 (1087)
T KOG4228|consen  881 DYINASFIDGYRQPKAFIVTQGPLAETVEDFWRMIWDQNVTSIVMLTELKHP----------------------------  932 (1087)
T ss_pred             cccchhhhcccCCcceEEEecCCcccchHHHHHHhhccceeEEEEecccCcc----------------------------
Confidence            9999999999999999999999999999999999999999999999987643                            


Q ss_pred             CCCCCCCCCCCcchhhhhhhcccccccCCCCCeEEEecccccccccccccccccCcccccccchhhhhhhhhcccccccc
Q psy8773        1429 WPEQGVPKSGDGFIDFIGQVHKTKEQFGQDGPITVHCSLLSLHINLTQSEWGREKPVAQLSFCSVLIAYLVLFSQEKCHQ 1508 (1773)
Q Consensus      1429 Wp~~~~p~~~~~~~d~~~~v~~~~~~~~~~gpi~vhc~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~c~~ 1508 (1773)
                                                                                                 ++|+|
T Consensus       933 ---------------------------------------------------------------------------~~C~q  937 (1087)
T KOG4228|consen  933 ---------------------------------------------------------------------------EKCPQ  937 (1087)
T ss_pred             ---------------------------------------------------------------------------ccccc
Confidence                                                                                       58999


Q ss_pred             ccCCCCceeeEeEEEEEeeeecCCCeEEEEEEEEeCCCCCceEEeeEEecCCCCCCCCCChhhHHHH-HHHHHHHhhhcC
Q psy8773        1509 YWPSERSIRYEWFVVEPIAEYNMPQYVLREFKVTDARDATSRTLRQFQLIDWPEQGVPKSGDGFIDF-IGQVHKTKEQFG 1587 (1773)
Q Consensus      1509 ywp~~~~~~yG~~~V~~~se~~~~~yi~R~f~Vt~~~~~~~r~V~qfQ~~~WPd~gvP~s~~~lidl-I~~V~k~q~~~~ 1587 (1773)
                      |||.+++..||.|.|+.+++..+++|+.|+|.|++.+++.+|+|+||||++||..++|+.....+.+ +..+.++++. +
T Consensus       938 yw~~~g~~~yg~i~Ve~~~~~~~~~~t~r~f~i~n~~~~~~r~v~qfq~~~WP~~~~~p~~~~~~~~i~~~~~~~q~~-~ 1016 (1087)
T KOG4228|consen  938 YWPPEGSQRYGPIEVEDMNEHINPQYTAREFGVTNEREKQSRTVRQFQFTGWPEYGKPPQSKGPISKIPSVASKWQQL-G 1016 (1087)
T ss_pred             ccCCcCceecCcEEEEecccccchhhhhhhheeeeccccCceEEEEEEecCCcccCcCCCCcchhhhHHHHHHHHHhh-c
Confidence            9999999999999999999999999999999999999999999999999999987766665555544 4455555554 4


Q ss_pred             CCCCEEEEecCCCCcchhHHHHHHHHHhhcccCCcCHHHHHHHHHhcCCCCCCChhhhccccHHHHHHHHhhc
Q psy8773        1588 QDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTEHLYTSSPFSEQLALDMRE 1660 (1773)
Q Consensus      1588 ~~gPIvVHCs~G~GRTGvFcAl~~lleqlk~E~~VDVFQtVK~lR~~RPgmVqT~eQY~~~~f~Y~~~~ey~~ 1660 (1773)
                      .++|++|||++|+||+|+|||++++++||+.|+.|||||+||+||.+||+||++.+||+   |||+++++|++
T Consensus      1017 ~~~P~~Vhc~nG~~rsg~f~ai~~l~e~~~~e~~vDVfq~vk~Lr~~rp~mv~t~~QY~---fcYdv~~~y~~ 1086 (1087)
T KOG4228|consen 1017 ADGPIIVHCLNGVGRTGTFCAISILLERMRKEGVVDVFQTVKTLRFQRPGMVDTSDQYQ---FCYDVALEYLG 1086 (1087)
T ss_pred             CCCCEEEEEcCCCcceeehHHHHHHHHHHhhcCceeeehhhhhhhhcCccccCcHHHHH---HHHHHHHHhhc
Confidence            58999999999999999999999999999999999999999999999999999999999   99999999986

>KOG4228|consensus Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>KOG1718|consensus Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>KOG1718|consensus Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG1717|consensus Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1773
2fh7_A595 Crystal Structure Of The Phosphatase Domains Of Hum 0.0
2fh7_A595 Crystal Structure Of The Phosphatase Domains Of Hum 1e-122
2fh7_A595 Crystal Structure Of The Phosphatase Domains Of Hum 2e-80
2fh7_A595 Crystal Structure Of The Phosphatase Domains Of Hum 5e-73
2fh7_A595 Crystal Structure Of The Phosphatase Domains Of Hum 7e-10
3sr9_A583 Crystal Structure Of Mouse Ptpsigma Length = 583 0.0
3sr9_A583 Crystal Structure Of Mouse Ptpsigma Length = 583 1e-122
3sr9_A583 Crystal Structure Of Mouse Ptpsigma Length = 583 3e-79
3sr9_A583 Crystal Structure Of Mouse Ptpsigma Length = 583 1e-72
3sr9_A583 Crystal Structure Of Mouse Ptpsigma Length = 583 3e-06
1lar_A575 Crystal Structure Of The Tandem Phosphatase Domains 0.0
1lar_A575 Crystal Structure Of The Tandem Phosphatase Domains 1e-123
1lar_A575 Crystal Structure Of The Tandem Phosphatase Domains 7e-78
1lar_A575 Crystal Structure Of The Tandem Phosphatase Domains 6e-73
1lar_A575 Crystal Structure Of The Tandem Phosphatase Domains 1e-09
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 1e-140
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 1e-124
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 2e-30
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 7e-24
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 5e-06
2jjd_A599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 1e-112
2jjd_A599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 1e-73
2jjd_A599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 2e-36
2jjd_A 599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 3e-30
2jjd_A 599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 8e-05
2nlk_A627 Crystal Structure Of D1 And D2 Catalytic Domains Of 6e-93
2nlk_A627 Crystal Structure Of D1 And D2 Catalytic Domains Of 2e-73
2nlk_A627 Crystal Structure Of D1 And D2 Catalytic Domains Of 2e-27
2nlk_A 627 Crystal Structure Of D1 And D2 Catalytic Domains Of 4e-18
2nlk_A 627 Crystal Structure Of D1 And D2 Catalytic Domains Of 3e-05
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 3e-89
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 3e-83
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 1e-26
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 5e-25
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 2e-04
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 1e-84
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 3e-79
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 1e-26
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 7e-24
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 2e-04
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 3e-82
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 1e-76
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 1e-26
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 1e-24
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 4e-05
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 1e-79
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 5e-74
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 9e-31
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 4e-19
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 4e-79
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 9e-74
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-27
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 1e-17
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-05
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 1e-78
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-73
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 4e-27
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 1e-17
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 3e-05
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-78
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 4e-73
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 3e-27
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 5e-18
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 3e-05
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 4e-78
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 2e-73
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-27
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 4e-18
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 2e-05
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 2e-76
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 4e-73
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-27
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 7e-18
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-05
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 2e-75
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 8e-71
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 2e-25
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-17
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 4e-05
1ygr_A610 Crystal Structure Of The Tandem Phosphatase Domain 9e-68
1ygr_A610 Crystal Structure Of The Tandem Phosphatase Domain 2e-61
1ygr_A610 Crystal Structure Of The Tandem Phosphatase Domain 8e-24
1ygr_A 610 Crystal Structure Of The Tandem Phosphatase Domain 4e-16
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 2e-60
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 4e-58
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 4e-27
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 9e-04
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 3e-59
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 4e-54
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 2e-28
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 6e-19
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 7e-59
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 6e-57
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 1e-25
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 2e-25
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 2e-58
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 2e-56
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 4e-25
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 6e-25
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 7e-57
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 1e-54
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 3e-23
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 2e-17
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 5e-04
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 9e-57
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 1e-51
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 3e-25
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 1e-22
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 2e-56
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 8e-54
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 2e-22
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 3e-17
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 3e-56
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 9e-54
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 2e-22
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 3e-17
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 7e-56
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 2e-51
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 3e-25
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 2e-22
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 5e-54
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 1e-48
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 1e-24
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 2e-22
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 9e-54
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 9e-54
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 1e-37
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 2e-35
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 7e-04
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 6e-53
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 2e-51
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 3e-23
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 1e-21
3ps5_A595 Crystal Structure Of The Full-Length Human Protein 3e-50
3ps5_A595 Crystal Structure Of The Full-Length Human Protein 4e-48
3ps5_A595 Crystal Structure Of The Full-Length Human Protein 6e-21
3ps5_A595 Crystal Structure Of The Full-Length Human Protein 5e-20
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 8e-50
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 6e-49
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 6e-22
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 6e-21
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 9e-50
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 6e-49
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 4e-22
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 5e-21
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 9e-50
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 6e-49
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 4e-22
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 6e-21
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 1e-48
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 7e-48
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 6e-21
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 7e-20
1fpr_A284 Crystal Structure Of The Complex Formed Between The 1e-48
1fpr_A284 Crystal Structure Of The Complex Formed Between The 8e-48
1fpr_A284 Crystal Structure Of The Complex Formed Between The 6e-21
1fpr_A284 Crystal Structure Of The Complex Formed Between The 8e-20
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 1e-47
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 1e-47
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 3e-23
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 5e-17
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 1e-04
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 2e-47
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 2e-47
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 3e-23
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 2e-17
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 1e-04
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 2e-47
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 2e-47
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 5e-23
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 3e-17
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 1e-04
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 2e-47
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 2e-47
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 3e-23
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 3e-17
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 1e-04
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 1e-46
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 1e-46
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 5e-23
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 4e-17
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 1e-04
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 2e-46
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 2e-46
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 4e-22
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 5e-16
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 3e-46
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 3e-46
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 4e-22
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 5e-16
1wch_A315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 4e-46
1wch_A315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 2e-15
1wch_A315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 1e-13
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 8e-45
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 8e-45
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 8e-22
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 3e-15
2i75_A320 Crystal Structure Of Human Protein Tyrosine Phospha 1e-43
2i75_A320 Crystal Structure Of Human Protein Tyrosine Phospha 4e-43
2i75_A320 Crystal Structure Of Human Protein Tyrosine Phospha 3e-23
2i75_A320 Crystal Structure Of Human Protein Tyrosine Phospha 4e-21
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 2e-43
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 2e-43
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 1e-19
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 1e-15
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 7e-04
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 4e-43
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 2e-19
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 4e-16
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 4e-04
1gfy_A298 Residue 259 Is A Key Determinant Of Substrate Speci 6e-43
1gfy_A298 Residue 259 Is A Key Determinant Of Substrate Speci 8e-22
1gfy_A298 Residue 259 Is A Key Determinant Of Substrate Speci 1e-13
1c86_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 7e-43
1c86_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 8e-22
1c86_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 9e-14
1nwl_A298 Crystal Structure Of The Ptp1b Complexed With Sp734 7e-43
1nwl_A298 Crystal Structure Of The Ptp1b Complexed With Sp734 1e-21
1nwl_A298 Crystal Structure Of The Ptp1b Complexed With Sp734 9e-14
2bij_A305 Crystal Structure Of The Human Protein Tyrosine Pho 9e-43
2bij_A305 Crystal Structure Of The Human Protein Tyrosine Pho 9e-43
2bij_A305 Crystal Structure Of The Human Protein Tyrosine Pho 6e-19
2bij_A305 Crystal Structure Of The Human Protein Tyrosine Pho 3e-17
2shp_A525 Tyrosine Phosphatase Shp-2 Length = 525 2e-42
2shp_A525 Tyrosine Phosphatase Shp-2 Length = 525 3e-41
2shp_A525 Tyrosine Phosphatase Shp-2 Length = 525 9e-24
3b7o_A316 Crystal Structure Of The Human Tyrosine Phosphatase 2e-42
3b7o_A316 Crystal Structure Of The Human Tyrosine Phosphatase 4e-42
3b7o_A316 Crystal Structure Of The Human Tyrosine Phosphatase 5e-23
4i8n_A354 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-42
4i8n_A354 Crystal Structure Of Protein Tyrosine Phosphatase 1 7e-21
4i8n_A354 Crystal Structure Of Protein Tyrosine Phosphatase 1 9e-14
2cma_A327 Structural Basis For Inhibition Of Protein Tyrosine 2e-42
2cma_A327 Structural Basis For Inhibition Of Protein Tyrosine 6e-21
2cma_A327 Structural Basis For Inhibition Of Protein Tyrosine 7e-14
1nl9_A321 Potent, Selective Protein Tyrosine Phosphatase 1b I 2e-42
1nl9_A321 Potent, Selective Protein Tyrosine Phosphatase 1b I 6e-21
1nl9_A321 Potent, Selective Protein Tyrosine Phosphatase 1b I 7e-14
2nt7_A299 Crystal Structure Of Ptp1b-inhibitor Complex Length 2e-42
2nt7_A299 Crystal Structure Of Ptp1b-inhibitor Complex Length 8e-21
2nt7_A299 Crystal Structure Of Ptp1b-inhibitor Complex Length 8e-14
2azr_A299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 2e-42
2azr_A299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 8e-21
2azr_A299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 9e-14
1g7g_A298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 2e-42
1g7g_A298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 8e-21
1g7g_A298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 9e-14
2cm2_A304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 2e-42
2cm2_A304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 8e-21
2cm2_A304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 9e-14
1bzj_A297 Human Ptp1b Complexed With Tpicooh Length = 297 3e-42
1bzj_A297 Human Ptp1b Complexed With Tpicooh Length = 297 8e-21
1bzj_A297 Human Ptp1b Complexed With Tpicooh Length = 297 9e-14
1g7f_A298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 3e-42
1g7f_A298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 9e-21
1g7f_A298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 9e-14
3sme_A300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 3e-42
3sme_A300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 8e-21
3sme_A300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 9e-14
2fjm_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 3e-42
2fjm_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 9e-21
2fjm_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 1e-13
1q6j_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 3e-42
1q6j_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 9e-21
1q6j_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 9e-14
1l8g_A321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 3e-42
1l8g_A321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 8e-21
1l8g_A321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 1e-13
1ecv_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 4e-42
1ecv_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 8e-21
1ecv_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-13
1l8k_A314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 5e-42
1l8k_A314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 1e-17
1l8k_A314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 2e-15
3o5x_A276 Crystal Structure Of The Oncogenic Tyrosine Phospha 5e-42
3o5x_A276 Crystal Structure Of The Oncogenic Tyrosine Phospha 5e-42
3o5x_A276 Crystal Structure Of The Oncogenic Tyrosine Phospha 4e-23
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 6e-42
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 6e-42
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 8e-21
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 7e-14
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 6e-42
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 6e-42
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 8e-21
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 9e-14
1bzc_A321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 7e-42
1bzc_A321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 6e-21
1bzc_A321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 7e-14
1bzh_A298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 8e-42
1bzh_A298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 8e-21
1bzh_A298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 8e-14
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 8e-42
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 8e-42
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 9e-21
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 8e-14
2cjz_A305 Crystal Structure Of The C472s Mutant Of Human Prot 1e-41
2cjz_A305 Crystal Structure Of The C472s Mutant Of Human Prot 1e-41
2cjz_A305 Crystal Structure Of The C472s Mutant Of Human Prot 1e-17
2cjz_A305 Crystal Structure Of The C472s Mutant Of Human Prot 4e-16
2bv5_A282 Crystal Structure Of The Human Protein Tyrosine Pho 1e-41
2bv5_A282 Crystal Structure Of The Human Protein Tyrosine Pho 1e-41
2bv5_A282 Crystal Structure Of The Human Protein Tyrosine Pho 1e-17
2bv5_A282 Crystal Structure Of The Human Protein Tyrosine Pho 6e-16
1g1f_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-41
1g1f_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 9e-20
1g1f_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-12
1een_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-41
1een_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-19
1een_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-12
1aax_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-41
1aax_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-19
1aax_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-12
3qkp_A321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 3e-41
3qkp_A321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 9e-20
3qkp_A321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 1e-12
1oeo_X321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 3e-41
1oeo_X321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 1e-19
1oeo_X321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 2e-12
3eu0_A327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 3e-41
3eu0_A327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 1e-19
3eu0_A327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 2e-12
1ptv_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 3e-41
1ptv_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-19
1ptv_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-12
1ptu_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 3e-41
1ptu_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 9e-20
1ptu_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-12
1i57_A310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 4e-41
1i57_A310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 1e-19
1i57_A310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 1e-12
3a5k_A304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 4e-41
3a5k_A304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 8e-21
3a5k_A304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 2e-12
3zv2_A320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 4e-41
3zv2_A320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 2e-19
3zv2_A320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 2e-12
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 6e-41
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 3e-40
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 2e-23
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 3e-20
1pa1_A310 Crystal Structure Of The C215d Mutant Of Protein Ty 8e-41
1pa1_A310 Crystal Structure Of The C215d Mutant Of Protein Ty 3e-19
1pa1_A310 Crystal Structure Of The C215d Mutant Of Protein Ty 3e-12
2qcj_A313 Native Structure Of Lyp Length = 313 4e-40
2qcj_A313 Native Structure Of Lyp Length = 313 1e-39
2qcj_A313 Native Structure Of Lyp Length = 313 9e-23
2qcj_A313 Native Structure Of Lyp Length = 313 2e-17
1a5y_A330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 7e-40
1a5y_A330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 1e-19
1a5y_A330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 8e-12
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 7e-40
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 2e-39
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 7e-23
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 2e-17
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 7e-40
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 2e-39
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 7e-23
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 2e-17
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 8e-40
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 4e-39
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 3e-21
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 4e-18
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 5e-39
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 3e-38
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 1e-17
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 4e-14
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 7e-39
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 2e-38
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 1e-21
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 3e-16
2i1y_A301 Crystal Structure Of The Phosphatase Domain Of Huma 2e-38
2i1y_A301 Crystal Structure Of The Phosphatase Domain Of Huma 2e-38
2i1y_A301 Crystal Structure Of The Phosphatase Domain Of Huma 2e-23
2i1y_A301 Crystal Structure Of The Phosphatase Domain Of Huma 2e-20
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 9e-38
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 3e-37
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 3e-21
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 6e-16
2oc3_A303 Crystal Structure Of The Catalytic Domain Of Human 5e-35
2oc3_A303 Crystal Structure Of The Catalytic Domain Of Human 5e-35
2oc3_A303 Crystal Structure Of The Catalytic Domain Of Human 8e-20
2oc3_A303 Crystal Structure Of The Catalytic Domain Of Human 2e-15
4az1_A302 Crystal Structure Of The Trypanosoma Cruzi Protein 6e-27
4az1_A302 Crystal Structure Of The Trypanosoma Cruzi Protein 6e-27
4az1_A302 Crystal Structure Of The Trypanosoma Cruzi Protein 6e-10
4az1_A302 Crystal Structure Of The Trypanosoma Cruzi Protein 9e-09
3m4u_A306 Crystal Structure Of Trypanosoma Brucei Protein Tyr 8e-24
3m4u_A306 Crystal Structure Of Trypanosoma Brucei Protein Tyr 8e-24
3m4u_A306 Crystal Structure Of Trypanosoma Brucei Protein Tyr 9e-09
3m4u_A306 Crystal Structure Of Trypanosoma Brucei Protein Tyr 1e-06
1xxv_A306 Yersinia Yoph (Residues 163-468) Binds Phosphonodif 6e-05
1xxv_A306 Yersinia Yoph (Residues 163-468) Binds Phosphonodif 6e-05
1pa9_A284 Yersinia Protein-Tyrosine Phosphatase Complexed Wit 6e-05
1pa9_A284 Yersinia Protein-Tyrosine Phosphatase Complexed Wit 6e-05
1qz0_A306 Crystal Structure Of The Yersinia Pestis Phosphatas 6e-05
1qz0_A306 Crystal Structure Of The Yersinia Pestis Phosphatas 6e-05
1ypt_A305 Crystal Structure Of Yersinia Protein Tyrosine Phos 7e-05
1ypt_A305 Crystal Structure Of Yersinia Protein Tyrosine Phos 7e-05
3u96_A306 Crystal Structure Of Yophq357f(Catalytic Domain, Re 9e-05
3u96_A306 Crystal Structure Of Yophq357f(Catalytic Domain, Re 9e-05
1v3a_A173 Structure Of Human Prl-3, The Phosphatase Associate 3e-04
1r6h_A172 Solution Structure Of Human Prl-3 Length = 172 4e-04
3bm8_A305 Crystal Structure Of Yoph Mutant D356a Complexed Wi 6e-04
3bm8_A305 Crystal Structure Of Yoph Mutant D356a Complexed Wi 6e-04
3rz2_A189 Crystal Of Prl-1 Complexed With Peptide Length = 18 7e-04
3f99_A306 W354f Yersinia Enterocolitica Ptpase Apo Form Lengt 7e-04
3f99_A306 W354f Yersinia Enterocolitica Ptpase Apo Form Lengt 7e-04
1xxp_A306 Yersinia Yoph (Residues 163-468) C403s Binds Phosph 8e-04
1xxp_A306 Yersinia Yoph (Residues 163-468) C403s Binds Phosph 8e-04
1lyv_A306 High-Resolution Structure Of The Catalytically Inac 9e-04
1lyv_A306 High-Resolution Structure Of The Catalytically Inac 9e-04
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure 
Iteration: 1

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/571 (61%), Positives = 421/571 (73%), Gaps = 39/571 (6%)
Query: 192 MVSHPPIPISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVI 251
           M+SHPPIPI+ +A+H E LKAND+LK SQEYESI+PGQQFTW+HS++E+NK KNRYANVI
Sbjct: 6   MLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVI 65
Query: 252 AYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVT 311
           AYDHSRVIL  ++GI GSDYINANY DGYR+ NAY+ATQGPL ET GDFWRMVWE RS T
Sbjct: 66  AYDHSRVILQPIEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSAT 125
Query: 312 IVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERRE 371
           IVMMT+LEE++RIKCDQYWP+RGTETYG I VTL D  ELA++C+RTF ++K   SE+RE
Sbjct: 126 IVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKRE 185
Query: 372 IKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGR 431
           ++Q QFTAWPDHGVPE+P PFL FLRRV+  NP              GP++VHCSAGVGR
Sbjct: 186 VRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPD-----------AGPIVVHCSAGVGR 234
Query: 432 TGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTE 491
           TGCFIVIDAM+ERIK +KTVD+YGHVT +R+QRNYMVQTEDQY FIH+ALLEAV CGNTE
Sbjct: 235 TGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTE 294
Query: 492 IPARSLHVHIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHIL 551
           +PARSL+ +IQKL  +E G+  TGMELEFK+L+N +A  SRFISA+LPCNK KNRLV+I+
Sbjct: 295 VPARSLYAYIQKLAQVEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIM 354
Query: 552 PVESSRVCLTPVR---GDGFID--FIGQVHKTKEQFGQDGPIT-----------VHCSRL 595
           P ES+RVCL P+R   G  +I+  FI    + K      GP+             + S +
Sbjct: 355 PYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTI 414
Query: 596 AQHIENLKANDNLKFSQ----------EYESIEPGQQFTWDHSSM-EMNKAKNRYANVIA 644
              +  L+     K  Q          +Y  ++P  ++      + E      R      
Sbjct: 415 VVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRT 474
Query: 645 YDHSRVILSTVDGIPGR-DGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSI 703
               +       G+P   +GFIDFIGQVHKTKEQFGQDGPI+VHCSAGVGRTGVFITLSI
Sbjct: 475 VRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSI 534
Query: 704 VLERMQYEGVIDLFQTVRILRTQRPAMVQTE 734
           VLERM+YEGV+D+FQTV++LRTQRPAMVQTE
Sbjct: 535 VLERMRYEGVVDIFQTVKMLRTQRPAMVQTE 565
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 Back     alignment and structure
>pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 Back     alignment and structure
>pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 Back     alignment and structure
>pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 Back     alignment and structure
>pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 Back     alignment and structure
>pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 Back     alignment and structure
>pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 Back     alignment and structure
>pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 Back     alignment and structure
>pdb|1XXV|A Chain A, Yersinia Yoph (Residues 163-468) Binds Phosphonodifluoromethyl-Phe Containing Hexapeptide At Two Sites Length = 306 Back     alignment and structure
>pdb|1XXV|A Chain A, Yersinia Yoph (Residues 163-468) Binds Phosphonodifluoromethyl-Phe Containing Hexapeptide At Two Sites Length = 306 Back     alignment and structure
>pdb|1PA9|A Chain A, Yersinia Protein-Tyrosine Phosphatase Complexed With Pncs (Yop51,Pasteurella X,Ptpase,Yop51delta162) (Catalytic Domain, Residues 163-468) Mutant With Cys 235 Replaced By Arg (C235r) Length = 284 Back     alignment and structure
>pdb|1PA9|A Chain A, Yersinia Protein-Tyrosine Phosphatase Complexed With Pncs (Yop51,Pasteurella X,Ptpase,Yop51delta162) (Catalytic Domain, Residues 163-468) Mutant With Cys 235 Replaced By Arg (C235r) Length = 284 Back     alignment and structure
>pdb|1QZ0|A Chain A, Crystal Structure Of The Yersinia Pestis Phosphatase Yoph In Complex With A Phosphotyrosyl Mimetic-Containing Hexapeptide Length = 306 Back     alignment and structure
>pdb|1QZ0|A Chain A, Crystal Structure Of The Yersinia Pestis Phosphatase Yoph In Complex With A Phosphotyrosyl Mimetic-Containing Hexapeptide Length = 306 Back     alignment and structure
>pdb|1YPT|A Chain A, Crystal Structure Of Yersinia Protein Tyrosine Phosphatase At 2.5 Angstroms And The Complex With Tungstate Length = 305 Back     alignment and structure
>pdb|1YPT|A Chain A, Crystal Structure Of Yersinia Protein Tyrosine Phosphatase At 2.5 Angstroms And The Complex With Tungstate Length = 305 Back     alignment and structure
>pdb|3U96|A Chain A, Crystal Structure Of Yophq357f(Catalytic Domain, Residues 163-468) In Complex With Pncs Length = 306 Back     alignment and structure
>pdb|3U96|A Chain A, Crystal Structure Of Yophq357f(Catalytic Domain, Residues 163-468) In Complex With Pncs Length = 306 Back     alignment and structure
>pdb|1V3A|A Chain A, Structure Of Human Prl-3, The Phosphatase Associated With Cancer Metastasis Length = 173 Back     alignment and structure
>pdb|1R6H|A Chain A, Solution Structure Of Human Prl-3 Length = 172 Back     alignment and structure
>pdb|3BM8|A Chain A, Crystal Structure Of Yoph Mutant D356a Complexed With Irreversible Inhibitor Pvsn Length = 305 Back     alignment and structure
>pdb|3BM8|A Chain A, Crystal Structure Of Yoph Mutant D356a Complexed With Irreversible Inhibitor Pvsn Length = 305 Back     alignment and structure
>pdb|3RZ2|A Chain A, Crystal Of Prl-1 Complexed With Peptide Length = 189 Back     alignment and structure
>pdb|3F99|A Chain A, W354f Yersinia Enterocolitica Ptpase Apo Form Length = 306 Back     alignment and structure
>pdb|3F99|A Chain A, W354f Yersinia Enterocolitica Ptpase Apo Form Length = 306 Back     alignment and structure
>pdb|1XXP|A Chain A, Yersinia Yoph (Residues 163-468) C403s Binds Phosphotyrosyl Peptide At Two Sites Length = 306 Back     alignment and structure
>pdb|1XXP|A Chain A, Yersinia Yoph (Residues 163-468) C403s Binds Phosphotyrosyl Peptide At Two Sites Length = 306 Back     alignment and structure
>pdb|1LYV|A Chain A, High-Resolution Structure Of The Catalytically Inactive Yersinia Tyrosine Phosphatase C403a Mutant In Complex With Phosphate Length = 306 Back     alignment and structure
>pdb|1LYV|A Chain A, High-Resolution Structure Of The Catalytically Inactive Yersinia Tyrosine Phosphatase C403a Mutant In Complex With Phosphate Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1773
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-177
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-144
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-143
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-114
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 4e-72
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 5e-63
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-62
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-49
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 6e-24
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 2e-14
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 5e-12
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 4e-07
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 6e-06
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-176
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-142
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-135
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-116
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-70
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 5e-62
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 2e-57
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-47
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-21
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 8e-15
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-09
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 3e-09
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 3e-04
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-169
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-137
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-135
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-110
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 3e-67
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-58
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-52
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 2e-47
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 8e-29
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 3e-20
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-12
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 1e-11
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-08
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-168
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-139
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-136
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-110
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-61
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 5e-61
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 2e-54
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 2e-47
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-21
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 2e-11
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 5e-11
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 9e-11
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 4e-06
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 1e-166
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 1e-151
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 6e-67
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 1e-53
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 3e-27
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 5e-24
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 2e-13
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 1e-10
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 1e-165
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 1e-151
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 4e-68
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 1e-53
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 2e-27
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 3e-25
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 1e-13
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 1e-10
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 1e-161
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 1e-144
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 4e-64
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 1e-49
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 3e-27
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 8e-24
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 3e-13
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 2e-10
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 1e-160
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 1e-143
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 2e-66
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 7e-57
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 4e-29
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 2e-21
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 3e-13
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 2e-09
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 8e-04
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 1e-160
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 1e-147
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 2e-63
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 1e-52
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 2e-27
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 1e-21
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 5e-15
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 3e-13
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 1e-157
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 1e-141
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 2e-66
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 2e-53
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 5e-26
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 1e-20
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 3e-13
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 8e-09
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 1e-154
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 1e-138
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 4e-65
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 5e-52
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 4e-27
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 2e-22
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 9e-16
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 7e-10
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 1e-154
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 1e-137
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 1e-63
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 5e-53
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 9e-27
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 2e-15
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 4e-14
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 4e-08
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 1e-152
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 1e-137
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 1e-65
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 7e-55
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 2e-29
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 8e-21
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 1e-13
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 2e-08
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 7e-04
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 1e-151
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 1e-142
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 1e-67
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 4e-53
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 2e-26
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 1e-19
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 4e-13
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 2e-11
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 1e-149
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 1e-135
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 3e-65
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 9e-50
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 4e-26
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 2e-21
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 1e-13
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 3e-09
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 1e-149
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 1e-139
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 6e-65
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 5e-55
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 6e-29
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 6e-16
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 1e-12
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 3e-06
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 1e-148
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 1e-143
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 4e-64
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 4e-50
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 2e-25
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 3e-17
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 3e-13
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 2e-07
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 1e-147
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 1e-139
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 1e-62
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 3e-54
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 2e-27
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 9e-16
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 4e-13
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 3e-07
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 1e-146
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 1e-131
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 1e-61
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 4e-53
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 7e-29
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 1e-19
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 1e-15
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 9e-09
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 8e-04
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 1e-144
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 1e-139
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 1e-65
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 5e-53
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 5e-27
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 2e-16
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 2e-12
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 4e-06
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 1e-144
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 1e-138
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 2e-62
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 1e-54
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 1e-27
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 5e-14
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 7e-13
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 5e-08
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 1e-143
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 1e-135
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 9e-62
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 7e-54
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 2e-27
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 5e-15
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 9e-14
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 7e-10
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 1e-140
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 1e-137
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 2e-63
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 1e-53
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 4e-28
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 1e-13
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 3e-13
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 3e-06
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 1e-140
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 1e-129
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 3e-63
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 8e-56
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 6e-49
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 5e-36
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 8e-29
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 3e-23
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 1e-12
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 6e-10
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 6e-07
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 1e-06
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 4e-05
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 1e-140
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 1e-134
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 4e-65
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 1e-53
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 3e-29
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 7e-16
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 4e-15
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 1e-09
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 8e-04
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 1e-139
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 1e-139
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 2e-61
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 6e-55
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 6e-48
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 2e-35
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 3e-28
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 3e-22
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 9e-13
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 1e-09
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 4e-07
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 9e-07
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 6e-05
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 2e-04
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 1e-139
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 1e-132
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 5e-63
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 4e-54
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 6e-28
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 4e-17
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 9e-15
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 5e-14
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 1e-139
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 1e-131
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 6e-61
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 7e-53
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 5e-28
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 8e-18
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 8e-18
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 1e-16
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 1e-137
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 1e-137
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 4e-72
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 1e-62
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 4e-32
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 2e-18
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 3e-10
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 6e-07
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 4e-04
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 1e-135
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 1e-127
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 4e-56
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 4e-45
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 2e-25
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 3e-14
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 2e-13
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 2e-05
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 1e-134
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 1e-133
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 4e-60
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 6e-55
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 2e-33
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 4e-28
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 5e-17
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 4e-14
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 7e-14
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 2e-06
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 2e-05
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 1e-04
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 1e-113
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 1e-110
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 1e-46
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 1e-35
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 3e-23
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 5e-11
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 5e-10
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 1e-111
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 1e-106
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 3e-42
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 6e-38
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 3e-20
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 7e-13
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 1e-08
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 1e-17
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 1e-17
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 2e-13
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 9e-13
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 1e-04
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 4e-11
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-06
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-10
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 5e-10
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-05
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-10
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-10
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 7e-10
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 5e-06
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-10
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 7e-10
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-09
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 7e-06
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 6e-10
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-09
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-05
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 8e-10
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-05
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 9e-05
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 2e-09
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 5e-09
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 3e-06
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 9e-09
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-08
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 6e-08
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 1e-07
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-07
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 2e-07
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-07
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 2e-07
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 2e-07
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 2e-07
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 4e-04
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 3e-07
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 3e-07
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 3e-07
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 3e-07
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-07
3t04_D103 Monobody 7C12; engineered binding protein, antibod 5e-07
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 8e-07
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 8e-07
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 1e-06
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 1e-06
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-06
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 2e-06
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 2e-06
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 3e-06
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 3e-05
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 3e-05
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 2e-06
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-06
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-06
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 2e-06
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 3e-06
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 9e-06
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 3e-06
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 3e-06
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 3e-06
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 3e-06
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 4e-06
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 4e-06
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 4e-06
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 4e-06
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 2e-04
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 5e-06
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 7e-06
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 3e-05
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 7e-06
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 7e-06
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 5e-05
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 5e-05
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 8e-06
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 1e-05
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 1e-05
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 1e-05
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 1e-05
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 2e-05
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 2e-04
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 2e-05
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 3e-05
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 3e-05
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 4e-05
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 4e-05
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 4e-05
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 6e-04
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 4e-05
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 5e-05
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 5e-05
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 5e-05
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 6e-05
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 7e-05
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 7e-05
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 8e-05
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 8e-05
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 9e-05
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 6e-04
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-04
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 4e-04
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 1e-04
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 2e-04
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 2e-04
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-04
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 2e-04
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 3e-04
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 3e-04
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 4e-04
1x4x_A106 Fibronectin type-III domain containing protein 3A; 4e-04
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 4e-04
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 5e-04
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 6e-04
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 6e-04
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 6e-04
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 6e-04
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 6e-04
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 6e-04
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
 Score =  547 bits (1412), Expect = e-177
 Identities = 256/373 (68%), Positives = 311/373 (83%), Gaps = 11/373 (2%)

Query: 200 ISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVI 259
           I+ LA +IE LKAND LKFSQEYESI+PGQQFTW++S++E+NK KNRYANVIAYDHSRVI
Sbjct: 2   ITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVI 61

Query: 260 LSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLE 319
           L+++DG+PGSDYINANY DGYRK NAY+ATQGPL ET+GDFWRMVWE R+ T+VMMT+LE
Sbjct: 62  LTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLE 121

Query: 320 ERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTA 379
           E++R+KCDQYWP+RGTET G I VTL D  ELA+Y +RTF ++K   SE+RE++Q QF A
Sbjct: 122 EKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQFMA 181

Query: 380 WPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVID 439
           WPDHGVPE+P P L FLRRV+A NP              GP++VHCSAGVGRTGCFIVID
Sbjct: 182 WPDHGVPEYPTPILAFLRRVKACNPLDA-----------GPMVVHCSAGVGRTGCFIVID 230

Query: 440 AMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHV 499
           AM+ER+KH+KTVDIYGHVTC+R+QRNYMVQTEDQY+FIH+ALLEA  CG+TE+PAR+L+ 
Sbjct: 231 AMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNLYA 290

Query: 500 HIQKLMSMEVGDTSTGMELEFKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVC 559
           HIQKL  +  G++ T MELEFK L++ +A  SRFISA+LPCNK KNRLV+I+P E +RVC
Sbjct: 291 HIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVC 350

Query: 560 LTPVRGDGFIDFI 572
           L P+RG    D+I
Sbjct: 351 LQPIRGVEGSDYI 363
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1773
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 100.0
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 100.0
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 100.0
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 100.0
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 100.0
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 100.0
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 100.0
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 100.0
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 100.0
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 100.0
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 100.0
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 100.0
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 100.0
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 100.0
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 100.0
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 100.0
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 100.0
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 100.0
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 100.0
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 100.0
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 100.0
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 100.0
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 100.0
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 100.0
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 100.0
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 100.0
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 100.0
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 100.0
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 100.0
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 100.0
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 100.0
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 100.0
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 100.0
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 100.0
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 100.0
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 100.0
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 100.0
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 100.0
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 100.0
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 100.0
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 100.0
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 100.0
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 100.0
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 100.0
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 100.0
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 100.0
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 100.0
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 100.0
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 100.0
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 100.0
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 100.0
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 100.0
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 100.0
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 100.0
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 100.0
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 100.0
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 100.0
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 100.0
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 100.0
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 100.0
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 100.0
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 100.0
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 100.0
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 100.0
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 100.0
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 100.0
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.95
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.92
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.87
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.81
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.8
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.76
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.63
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.58
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.51
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.39
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.32
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.3
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.21
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.18
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.16
2q05_A195 Late protein H1, dual specificity protein phosphat 99.16
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.14
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.14
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.06
2q05_A195 Late protein H1, dual specificity protein phosphat 99.05
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.04
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 98.98
3cm3_A176 Late protein H1, dual specificity protein phosphat 98.96
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 98.95
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 98.93
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 98.92
3n0a_A361 Tyrosine-protein phosphatase auxilin; phosphatase- 98.85
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 98.83
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 98.77
3v0d_A339 Voltage-sensor containing phosphatase; PTP, hydrol 98.74
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 98.74
2hcm_A164 Dual specificity protein phosphatase; structural g 98.67
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 98.66
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 98.65
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 98.61
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 98.53
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 98.53
3n0a_A361 Tyrosine-protein phosphatase auxilin; phosphatase- 98.53
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 98.51
2oud_A177 Dual specificity protein phosphatase 10; A central 98.51
3v0d_A339 Voltage-sensor containing phosphatase; PTP, hydrol 98.5
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 98.48
1xri_A151 AT1G05000; structural genomics, protein structure 98.45
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 98.44
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 98.4
1xri_A151 AT1G05000; structural genomics, protein structure 98.37
2hxp_A155 Dual specificity protein phosphatase 9; human phos 98.37
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 98.36
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 98.36
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 98.36
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 98.3
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 98.29
3emu_A161 Leucine rich repeat and phosphatase domain contain 98.26
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 98.26
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 98.24
2hcm_A164 Dual specificity protein phosphatase; structural g 98.21
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 98.17
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 98.14
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 98.13
2oud_A177 Dual specificity protein phosphatase 10; A central 98.11
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 98.06
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 98.05
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 98.05
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 98.02
2hxp_A155 Dual specificity protein phosphatase 9; human phos 97.93
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 97.93
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 97.92
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 97.89
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 97.86
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 97.86
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 97.85
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 97.78
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 97.72
3emu_A161 Leucine rich repeat and phosphatase domain contain 97.58
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 97.52
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 97.47
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 97.25
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 96.97
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 96.14
2f46_A156 Hypothetical protein; structural genomics, joint c 95.72
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 95.66
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 95.27
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 95.22
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 94.97
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 94.96
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 94.91
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 94.75
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 94.64
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 94.36
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 94.11
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 94.03
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 93.98
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 93.96
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 93.87
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 93.78
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 93.4
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 93.38
2f46_A156 Hypothetical protein; structural genomics, joint c 93.12
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 93.07
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 92.89
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 92.45
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 92.37
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 92.01
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 91.77
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 90.83
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 90.03
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 87.82
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 86.98
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 86.83
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 86.72
3k2m_C101 Monobody HA4; engineered binding protein, antibody 86.64
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 85.84
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 84.7
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 84.68
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 84.33
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 83.41
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 81.99
3t04_D103 Monobody 7C12; engineered binding protein, antibod 81.86
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 80.81
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 80.76
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 80.71
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 80.38
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 80.25
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
Probab=100.00  E-value=9.9e-134  Score=1268.40  Aligned_cols=570  Identities=59%  Similarity=1.018  Sum_probs=532.6

Q ss_pred             HHHHHHHHHHHhhCCchhHHHHHhhcCCCCcccccccccccccccCCCCCCCCCCCcceEecCCCCCCCCCeEEeeecCC
Q psy8773         200 ISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDG  279 (1773)
Q Consensus       200 ~~~~~~~v~~l~a~~~~~f~~Efe~I~~~~~~t~~~s~~~~N~~KNRY~nIlpyD~SRV~L~~~~~~~~sDYINANyI~G  279 (1773)
                      +++|.+|+++|+++++.+|.+||++|.++...++.++.+++|+.||||.||+|||||||+|+..++.+++||||||||+|
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~E~~~i~~~~~~~~~~~~~~~N~~kNRy~~i~~~d~tRV~L~~~~~~~~~dYInAn~i~~   81 (575)
T 1lar_A            2 ITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDG   81 (575)
T ss_dssp             HHHHHHHHHHHSSTTTHHHHHHHHHCCCCCCCCCHHHHSTTTGGGCSSTTCCCCTTTBCCCCCCTTSTTTTCCSEEEEEE
T ss_pred             HHHHHHHHHHHhhCccccHHHHHHhcccCCCcchhhhcccccccccCCCCcCCCcCceeeecCCCCCCCCCceEEEEecc
Confidence            68999999999999999999999999987777888999999999999999999999999999988888899999999999


Q ss_pred             CCCcccEEEeCCCCcCCHHHHHHHHHHcCCcEEEEcccccccCcccccccCCCCCCceeeeEEEEEEEEEEecceEEEEE
Q psy8773         280 YRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTF  359 (1773)
Q Consensus       280 ~~~~~kyIaTQgPl~~Tv~DFWrMVWEq~v~iIVMLT~l~E~gr~KC~qYWP~~~~~~yG~~~Vt~~~~~~~~~y~iRtf  359 (1773)
                      +..+++|||||||+++|++|||+||||+++.+|||||++.|+|+.||++|||.++...||.++|++.++....+|++|+|
T Consensus        82 ~~~~~~yIatQgPl~~T~~dFW~Mvwe~~~~~IVmlt~~~E~~~~kc~~YwP~~~~~~~g~~~V~~~~~~~~~~~~~r~l  161 (575)
T 1lar_A           82 YRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTF  161 (575)
T ss_dssp             TTEEEEEEEECCCCTTTHHHHHHHHHHTTCCEEEECSCSEETTEECCCCCSCSSSEEEETTEEEEEEEEEECSSEEEEEE
T ss_pred             CCCCceeEecCCCCcchHHHHHHHHhhcCCCEEEEcccceeCCccccccccCCCCCceeeeEEEEEEEEEecCCeEEEEE
Confidence            99999999999999999999999999999999999999999999999999999988899999999999999999999999


Q ss_pred             EEeeCCCCceEEEEEEEecCCCCCCCCCChHHHHHHHHHHHhhCCCCCCccCCCCCCCCCCEEEEcCCCCCCceeehhHH
Q psy8773         360 MINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVID  439 (1773)
Q Consensus       360 ~I~~~~~~esR~V~hfhYt~WPD~GVP~~~~~lL~Fi~~Vr~~~~~~~~~~~~~~~~~~gPIVVHCSAGVGRTGtFIaID  439 (1773)
                      .|...+.+++|.|+||||++|||||+|.++..+++|++.|+..+...           .+|||||||||+|||||||++|
T Consensus       162 ~l~~~~~~~~r~V~h~~y~~WpD~gvP~~~~~~l~~~~~v~~~~~~~-----------~~pivVHCsaGvGRTGtfiaid  230 (575)
T 1lar_A          162 ALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLD-----------AGPMVVHCSAGVGRTGCFIVID  230 (575)
T ss_dssp             EEEETTSCCEEEEEEEEECCSCSSSCCSCSHHHHHHHHHHHHHSCTT-----------CCCEEEESSSSSSHHHHHHHHH
T ss_pred             eeecCCCCccEEEEEEEeCCCCCCCcccCHHHHHHHHHHHHHhcCCC-----------CCCEEEEecCCCcceeEEEEhH
Confidence            99998888999999999999999999999999999999999875422           5899999999999999999999


Q ss_pred             HHHHHHhcCCccCHHHHHHHHHHhcccCCCCHHHHHHHHHHHHHHHHcCCccccccchHHHHHHhhcccCCCCCchhHHH
Q psy8773         440 AMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSMEVGDTSTGMELE  519 (1773)
Q Consensus       440 ~ll~~l~~e~~VdV~~iV~~LR~qR~~mVQT~eQY~FIy~aLlE~i~~g~tei~~~~l~~~i~~L~~~~~~~~~tg~e~E  519 (1773)
                      +++++++.++.+|++++|..||+||++||||.+||.|||++|++++.+|+|++++.+|..++++|...+++++.+++++|
T Consensus       231 ~~l~~l~~~~~v~i~~~v~~lR~qR~~~Vqt~~Qy~fi~~~ll~~~~~g~T~Ip~~~L~~~v~~L~~~~~~~~~~~~~~E  310 (575)
T 1lar_A          231 AMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNLYAHIQKLGQVPPGESVTAMELE  310 (575)
T ss_dssp             HHHHHHHHHSCCCHHHHHHHHHTTSTTSSCSHHHHHHHHHHHHHHHHHCCCCEEGGGHHHHHHHHTSCCTTCSSCHHHHH
T ss_pred             HHHHHHhccCCCCHHHHHHHHHhhhhccCCCHHHHHHhHHHHHHHhhhccccchhhhhhhHHHhhccccccchhhHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999988888889999999


Q ss_pred             HHHhcccCCCCccccccCCCccccCCcccccccccCccccccccCCCCcccccccccccccccCCCCCceecccchhhhh
Q psy8773         520 FKKLSNIRAEPSRFISASLPCNKHKNRLVHILPVESSRVCLTPVRGDGFIDFIGQVHKTKEQFGQDGPITVHCSRLAQHI  599 (1773)
Q Consensus       520 Fk~L~~~~~~~~~~~~a~~p~N~~KNR~~~ilP~~~~~v~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  599 (1773)
                      |+.|.......                                                                     
T Consensus       311 f~~l~~~~~~~---------------------------------------------------------------------  321 (575)
T 1lar_A          311 FKLLASSKAHT---------------------------------------------------------------------  321 (575)
T ss_dssp             HHTTTCC-------------------------------------------------------------------------
T ss_pred             HHHhhhcccCc---------------------------------------------------------------------
Confidence            99885311000                                                                     


Q ss_pred             hcccccccccccccccccccCCccccccchhhhhhhhccccccccccccceeeecccCCCCCCCccceeccccccccccC
Q psy8773         600 ENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGRDGFIDFIGQVHKTKEQFG  679 (1773)
Q Consensus       600 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~n~~~~~~~~~~~~~~~s~~~~~p~~~~~~d~~~~~~~~~~~~~  679 (1773)
                                                                                                      
T Consensus       322 --------------------------------------------------------------------------------  321 (575)
T 1lar_A          322 --------------------------------------------------------------------------------  321 (575)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCeeEeccCCCcccchhhhhhHHHhhhcccccchhHHHHHHHHhcCCcccccccCCCCCCcccccchhhhhhcccccc
Q psy8773         680 QDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVIDLFQTVRILRTQRPAMVQTESIEPGQQFTWDHSSMEMNKAKNRYA  759 (1773)
Q Consensus       680 ~~~pi~V~Cs~gvg~sg~f~tls~vl~~~~~~~~~~~~~~~~~lr~~~~~~~~~e~~~~~~~~t~~~s~~~~N~~KNRY~  759 (1773)
                                                                                    .++..+..++|+.||||.
T Consensus       322 --------------------------------------------------------------~~~~~~~~~~N~~kNRy~  339 (575)
T 1lar_A          322 --------------------------------------------------------------SRFISANLPCNKFKNRLV  339 (575)
T ss_dssp             --------------------------------------------------------------CCCTTTTSGGGGGGCSST
T ss_pred             --------------------------------------------------------------cceeeccCccccccCCCc
Confidence                                                                          001123446799999999


Q ss_pred             cccccCCceeEeeccCCCCCCCceeeEeccCcCCCCceEEecCCCCCChhhhhhheeecCCcEEEEccCccccccccccc
Q psy8773         760 NVIAYDHSRVILSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQ  839 (1773)
Q Consensus       760 nIlpyD~SRV~Ls~~~g~~~sDYINASyIdGy~~~~~yIaTQgPL~~Tv~DFWrMVwE~~v~vIVMLt~l~E~gk~KC~q  839 (1773)
                      ||+|||+|||+|++.++.+++||||||||+|+..+++|||||||+++|++|||+||||+++.+|||||++.|.|+.||++
T Consensus       340 ~i~p~d~sRV~L~~~~~~~~~dYInAs~i~g~~~~~~yIatQgPl~~T~~dFW~MVwe~~~~~IVmLt~~~E~g~~kc~~  419 (575)
T 1lar_A          340 NIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQ  419 (575)
T ss_dssp             TCCCCTTTBCCCCCBTTBTTTTCCSEEEECCSSSTTCEEEECCCCGGGHHHHHHHHHHTTCCEEEECSCSEETTEESSCC
T ss_pred             ceeccccceeeccCcCCCCCCCeeEEeeccCCCCccceEEecCCCcchHHHHHHHHHhcCCcEEEEccccccCCeecccc
Confidence            99999999999998888788999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCceeeecEEEEEEEEEeecCEEEEEEEEEeCCCCceeEEEEEEeCCCCCCCCCCCChhHHHHHHHHHhhCCCCCC
Q psy8773         840 YWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNS  919 (1773)
Q Consensus       840 YWP~~~~~~yG~~tVtl~~~~~~~~yiiRtl~V~~~~~~~~R~V~hfhyt~WPD~gVP~s~~~lL~fl~~V~~~~~~~~~  919 (1773)
                      |||.++...||.++|++.++....+|++|+|.|++..++++|.|+||||++|||+|+|.++..+++|++.|++.....  
T Consensus       420 YwP~~~~~~~g~~~V~~~~~~~~~~~~~r~~~v~~~~~~~~r~V~h~~y~~WPD~gvP~~~~~~l~~i~~v~~~~~~~--  497 (575)
T 1lar_A          420 YWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQF--  497 (575)
T ss_dssp             CSCSSSCEEETTEEEEEEEEEECSSEEEEEEEEEETTTTEEEEEEEEEECCSCSSSCCSSCHHHHHHHHHHHHHHHHT--
T ss_pred             cCCCCCCcceeeEEEEEEEEEEcCccEEEEEEEEecCCCCceEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHhhc--
Confidence            999988889999999999999999999999999998888999999999999999999999999999999998753211  


Q ss_pred             CcCCCCCCCCCCEEEEcCCCCccchhHhHHHHHHHHHhhCCCcchHHHHHHHHhccccccCChhhhhhHHHHHHHHHHcC
Q psy8773         920 LESSGVNLPVGPLIVHCSAGVGRTGCFIVIDAMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCG  999 (1773)
Q Consensus       920 ~~~~~~~~~~gPIVVHCSaGVGRTGtFIAId~lLeql~~e~~VDVf~~Vk~LR~QR~~mVQT~eQY~FiY~aLlEyl~~g  999 (1773)
                             ...+|||||||||+||||||||+++++++++.++.+||+++|+.||+||++||||.+||.|||+++++|+...
T Consensus       498 -------~~~~PivVHCsaGvGRTGtfiaid~~l~~l~~~~~vdv~~~v~~lR~qR~~~Vqt~~Qy~f~y~~~~~~~~~~  570 (575)
T 1lar_A          498 -------GQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSF  570 (575)
T ss_dssp             -------TCCSCEEEESSSSSSHHHHHHHHHHHHHHHHHHSEECHHHHHHHHTTTSTTSSCSHHHHHHHHHHHHHHHHTC
T ss_pred             -------CCCCcEEEEECCCCchHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHhhCchhcCCHHHHHHHHHHHHHHHHhh
Confidence                   1258999999999999999999999999999999999999999999999999999999999999999999876


Q ss_pred             C
Q psy8773        1000 N 1000 (1773)
Q Consensus      1000 ~ 1000 (1773)
                      +
T Consensus       571 ~  571 (575)
T 1lar_A          571 D  571 (575)
T ss_dssp             -
T ss_pred             c
Confidence            4
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1773
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 1e-119
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 5e-96
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 3e-36
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 6e-31
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 4e-24
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 1e-23
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 4e-96
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 1e-84
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 6e-38
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 1e-30
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 1e-29
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 8e-05
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 9e-96
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 3e-81
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 3e-38
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 1e-32
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 7e-26
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 8e-16
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 7e-05
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 4e-84
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 2e-82
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 2e-39
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 3e-27
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 6e-22
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 9e-83
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 9e-83
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 2e-50
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 1e-41
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 4e-33
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 2e-06
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 3e-81
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 3e-81
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 7e-41
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 1e-31
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 8e-23
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 0.002
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 1e-80
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 1e-76
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 5e-36
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-29
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 7e-26
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 2e-80
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 7e-77
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 3e-35
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 2e-33
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 1e-32
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 2e-06
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 6e-76
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 4e-73
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 4e-38
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 1e-27
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 6e-26
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 2e-10
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 0.003
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 7e-75
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-72
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 1e-31
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 1e-29
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 2e-26
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 2e-04
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 2e-73
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 1e-72
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 1e-31
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 2e-27
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 2e-24
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 3e-06
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 3e-72
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 3e-69
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 1e-27
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 1e-24
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 2e-22
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 2e-04
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 1e-69
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 1e-69
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 1e-32
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 2e-29
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 1e-14
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 3e-05
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 9e-32
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 9e-32
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 1e-16
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 4e-08
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 4e-04
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 3e-18
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 3e-18
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 4e-11
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 7e-10
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 3e-09
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 2e-16
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 2e-16
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 6e-11
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 1e-10
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 3e-12
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 3e-12
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 8e-08
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 1e-07
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 9e-07
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 1e-06
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 7e-06
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 7e-06
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 5e-06
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 7e-04
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 0.001
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 0.001
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-05
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 2e-04
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 4e-04
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 6e-04
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 0.001
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 0.002
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 0.003
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 0.004
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 0.004
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: RPTP Lar
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  376 bits (965), Expect = e-119
 Identities = 227/326 (69%), Positives = 275/326 (84%), Gaps = 11/326 (3%)

Query: 200 ISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVI 259
           I+ LA +IE LKAND LKFSQEYESI+PGQQFTW++S++E+NK KNRYANVIAYDHSRVI
Sbjct: 2   ITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVI 61

Query: 260 LSTVDGIPGSDYINANYCDGYRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLE 319
           L+++DG+PGSDYINANY DGYRK NAY+ATQGPL ET+GDFWRMVWE R+ T+VMMT+LE
Sbjct: 62  LTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLE 121

Query: 320 ERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTFMINKGADSERREIKQLQFTA 379
           E++R+KCDQYWP+RGTET G I VTL D  ELA+Y +RTF ++K   SE+RE++Q QF A
Sbjct: 122 EKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQFMA 181

Query: 380 WPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVID 439
           WPDHGVPE+P P L FLRRV+A NP              GP++VHCSAGVGRTGCFIVID
Sbjct: 182 WPDHGVPEYPTPILAFLRRVKACNPLDA-----------GPMVVHCSAGVGRTGCFIVID 230

Query: 440 AMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHV 499
           AM+ER+KH+KTVDIYGHVTC+R+QRNYMVQTEDQY+FIH+ALLEA  CG+TE+PAR+L+ 
Sbjct: 231 AMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNLYA 290

Query: 500 HIQKLMSMEVGDTSTGMELEFKKLSN 525
           HIQKL  +  G++ T MELEFK L++
Sbjct: 291 HIQKLGQVPPGESVTAMELEFKLLAS 316
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1773
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 100.0
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 100.0
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 100.0
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 100.0
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 100.0
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 100.0
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 100.0
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 100.0
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 100.0
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 100.0
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 100.0
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 100.0
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 100.0
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 100.0
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 100.0
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 100.0
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 100.0
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 100.0
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 100.0
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 100.0
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 100.0
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 100.0
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.88
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.8
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.78
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.76
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.39
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.33
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.32
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.26
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.19
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.05
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 98.81
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 98.74
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 98.25
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 98.1
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 97.95
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 97.57
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 97.43
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 97.24
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 97.14
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 96.8
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 90.95
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 89.19
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 88.98
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 88.96
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 88.83
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 88.3
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 87.85
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 87.33
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 86.94
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 86.46
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 85.79
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 85.61
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 85.6
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 85.46
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 85.31
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 85.17
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 83.66
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 82.97
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 82.66
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 82.56
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 82.52
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 82.37
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 81.97
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 81.81
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 81.71
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 81.59
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 81.54
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 80.59
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: RPTP Lar
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.9e-72  Score=660.14  Aligned_cols=314  Identities=72%  Similarity=1.233  Sum_probs=303.0

Q ss_pred             HHHHHHHHHHHhhCCchhHHHHHhhcCCCCcccccccccccccccCCCCCCCCCCCcceEecCCCCCCCCCeEEeeecCC
Q psy8773         200 ISRLAQHIENLKANDNLKFSQEYESIEPGQQFTWDHSSMEMNKAKNRYANVIAYDHSRVILSTVDGIPGSDYINANYCDG  279 (1773)
Q Consensus       200 ~~~~~~~v~~l~a~~~~~f~~Efe~I~~~~~~t~~~s~~~~N~~KNRY~nIlpyD~SRV~L~~~~~~~~sDYINANyI~G  279 (1773)
                      +++|.+|++++++++..+|.+||+.|+++...++.++..++|+.||||+||+|||||||+|+..++.+++||||||||+|
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~e~~~i~~~~~~~~~~~~~~~N~~KNR~~~i~p~D~sRV~L~~~~~~~~~~YInAs~v~g   81 (317)
T d1lara1           2 ITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDG   81 (317)
T ss_dssp             HHHHHHHHHHHSSTTTHHHHHHHHHCCCCCCCCCHHHHSTTTGGGCSSTTCCCCTTTBCCCCCCTTSTTTTCCSEEEEEE
T ss_pred             HHHHHHHHHHHhhCccchHHHHHHhCCCCCCcchhhccChhhhhhcCCCCCCCCcCcEEEecCCCCCCcccceeeeEeec
Confidence            67999999999999999999999999988888999999999999999999999999999999988888899999999999


Q ss_pred             CCCcccEEEeCCCCcCCHHHHHHHHHHcCCcEEEEcccccccCcccccccCCCCCCceeeeEEEEEEEEEEecceEEEEE
Q psy8773         280 YRKHNAYVATQGPLQETLGDFWRMVWELRSVTIVMMTKLEERTRIKCDQYWPSRGTETYGHITVTLQDVQELASYCIRTF  359 (1773)
Q Consensus       280 ~~~~~kyIaTQgPl~~Tv~DFWrMVWEq~v~iIVMLT~l~E~gr~KC~qYWP~~~~~~yG~~~Vt~~~~~~~~~y~iRtf  359 (1773)
                      +..+++|||||+|+++|++|||+||||+++.+|||||...|.++.+|.+|||..+++.||.+.|++.++....++++|+|
T Consensus        82 ~~~~~~fI~tQ~Pl~~T~~dFW~MV~e~~v~~IVmL~~~~e~~~~kc~~Ywp~~~~~~~g~~~v~~~~~~~~~~~~~r~l  161 (317)
T d1lara1          82 YRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTF  161 (317)
T ss_dssp             TTEEEEEEEECCCCTTTHHHHHHHHHHTTCCEEEECSCSEETTEECCCCCSCSSSEEEETTEEEEEEEEEECSSEEEEEE
T ss_pred             CCCCCEEEEECCCchHhHHHHHHHHHhcccceEEEeccccccCccccccCCCCCCceEeeeEEEEEEEEEECCCeEEEEE
Confidence            99999999999999999999999999999999999999999999999999999998899999999999999999999999


Q ss_pred             EEeeCCCCceEEEEEEEecCCCCCCCCCChHHHHHHHHHHHhhCCCCCCccCCCCCCCCCCEEEEcCCCCCCceeehhHH
Q psy8773         360 MINKGADSERREIKQLQFTAWPDHGVPEHPAPFLLFLRRVRAMNPGTNSLESSGVNLPVGPLIVHCSAGVGRTGCFIVID  439 (1773)
Q Consensus       360 ~I~~~~~~esR~V~hfhYt~WPD~GVP~~~~~lL~Fi~~Vr~~~~~~~~~~~~~~~~~~gPIVVHCSAGVGRTGtFIaID  439 (1773)
                      .|...+.+++|.|.||||++|||+|+|.++..|++|++.|+..+...           .+||||||++|+||||+|||+|
T Consensus       162 ~v~~~~~~~~r~V~h~~y~~Wpd~~~P~~~~~~l~~i~~v~~~~~~~-----------~~PivVHCs~GvGRtG~f~al~  230 (317)
T d1lara1         162 ALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLD-----------AGPMVVHCSAGVGRTGCFIVID  230 (317)
T ss_dssp             EEEETTSCCEEEEEEEEECCSCSSSCCSCSHHHHHHHHHHHHHSCTT-----------CCCEEEESSSSSSHHHHHHHHH
T ss_pred             EEEECCCCceEEEEEEEecCcccCCCCCCHHHHHHHHHHHHHhhcCC-----------CCcEEEEecccccceeeeehhH
Confidence            99988888899999999999999999999999999999999876533           6899999999999999999999


Q ss_pred             HHHHHHhcCCccCHHHHHHHHHHhcccCCCCHHHHHHHHHHHHHHHHcCCccccccchHHHHHHhhcccCCCCCchhHHH
Q psy8773         440 AMIERIKHDKTVDIYGHVTCLRAQRNYMVQTEDQYMFIHDALLEAVLCGNTEIPARSLHVHIQKLMSMEVGDTSTGMELE  519 (1773)
Q Consensus       440 ~ll~~l~~e~~VdV~~iV~~LR~qR~~mVQT~eQY~FIy~aLlE~i~~g~tei~~~~l~~~i~~L~~~~~~~~~tg~e~E  519 (1773)
                      +++++++.++.|||+++|..||+||++||||.+||.|||.+|+|++.+|+++++..++...+++|....+.+..|.|+.|
T Consensus       231 ~~~~~l~~~~~vdv~~~v~~lR~qR~~~V~t~~QY~fiy~~lle~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~t~~~~~  310 (317)
T d1lara1         231 AMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNLYAHIQKLGQVPPGESVTAMELE  310 (317)
T ss_dssp             HHHHHHHHHSCCCHHHHHHHHHTTSTTSSCSHHHHHHHHHHHHHHHHHCCCCEEGGGHHHHHHHHTSCCTTCSSCHHHHH
T ss_pred             hHHHHHhcCCCCCHHHHHHHHHhhcccccCCHHHHHHHHHHHHHHHHhCCCCCcHHHHHHHHHHhhcCCCCCCCChHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhc
Q psy8773         520 FKKLS  524 (1773)
Q Consensus       520 Fk~L~  524 (1773)
                      |+.|.
T Consensus       311 ~~~l~  315 (317)
T d1lara1         311 FKLLA  315 (317)
T ss_dssp             HHTTT
T ss_pred             HHHhc
Confidence            99985
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure