Psyllid ID: psy8774
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 427 | ||||||
| 242003488 | 2014 | Receptor-type tyrosine-protein phosphata | 0.751 | 0.159 | 0.605 | 1e-119 | |
| 350427923 | 2025 | PREDICTED: tyrosine-protein phosphatase | 0.749 | 0.158 | 0.594 | 1e-114 | |
| 340724097 | 1926 | PREDICTED: tyrosine-protein phosphatase | 0.749 | 0.166 | 0.592 | 1e-114 | |
| 270004034 | 2156 | hypothetical protein TcasGA2_TC003342 [T | 0.751 | 0.148 | 0.613 | 1e-113 | |
| 189235110 | 2016 | PREDICTED: similar to receptor tyrosine | 0.751 | 0.159 | 0.613 | 1e-113 | |
| 383854788 | 2040 | PREDICTED: tyrosine-protein phosphatase | 0.749 | 0.156 | 0.594 | 1e-112 | |
| 380021984 | 1774 | PREDICTED: tyrosine-protein phosphatase | 0.749 | 0.180 | 0.592 | 1e-112 | |
| 157109352 | 2007 | receptor tyrosine phosphatase type r2a [ | 0.751 | 0.159 | 0.585 | 1e-111 | |
| 307201903 | 1374 | Tyrosine-protein phosphatase Lar [Harpeg | 0.749 | 0.232 | 0.577 | 1e-111 | |
| 195385007 | 2025 | GJ13567 [Drosophila virilis] gi|19414765 | 0.733 | 0.154 | 0.590 | 1e-111 |
| >gi|242003488|ref|XP_002422752.1| Receptor-type tyrosine-protein phosphatase F precursor, putative [Pediculus humanus corporis] gi|212505585|gb|EEB10014.1| Receptor-type tyrosine-protein phosphatase F precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 436 bits (1120), Expect = e-119, Method: Compositional matrix adjust.
Identities = 213/352 (60%), Positives = 268/352 (76%), Gaps = 31/352 (8%)
Query: 1 MLKEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLV-NSKNMSFLITNLERGV 59
++++EP V+IEL W++PTQTYGE++GY++K+G+++ LKE ++ S S +LERG+
Sbjct: 808 VMEKEPTVSIELEWTKPTQTYGELIGYKLKHGIKDQPLKEEIIKGSGKTSRSFVDLERGL 867
Query: 60 EYEFRIAGQNHIGYGQETVRYYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNG 119
EYEFRIAGQN +GYGQETV+Y+ TPEGPP+GPP NIS+ FQTPDVVCITW PP R RNG
Sbjct: 868 EYEFRIAGQNAVGYGQETVKYFLTPEGPPSGPPLNISYRFQTPDVVCITWVPPSRDQRNG 927
Query: 120 QIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSL 179
QI Y+++F KK+D + V RNTTQTKAVFSNLEE EY +++A T GPGP+S K+S+
Sbjct: 928 QITHYDIQFFKKMDHSTVPERNTTQTKAVFSNLEENTEYVFQIRAFTSQGPGPFSEKISI 987
Query: 180 MTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSI 239
T RDM+RAP+ V+A+ATS++SVEVWW+ VPA R K++GYQIFYTMTAVEDLDEW QKS
Sbjct: 988 KTERDMMRAPMNVEAVATSEESVEVWWEAVPA-RSKVIGYQIFYTMTAVEDLDEWQQKS- 1045
Query: 240 PLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGR 299
V LTESA+L +LEKF +YA+AVAART GLGR
Sbjct: 1046 ----------------------------VSLTESADLLNLEKFAQYAIAVAARTKVGLGR 1077
Query: 300 LSGKVTVKVKPEDVPLSLRAHDVSTHSMTLSWSPPIKLNPVKYKEVSEKIQE 351
LS KVTVK+KPEDVPL+LRAHDVSTHSMTLSWSPPI+LNP+ YK + ++E
Sbjct: 1078 LSEKVTVKIKPEDVPLNLRAHDVSTHSMTLSWSPPIRLNPINYKISFDAVKE 1129
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350427923|ref|XP_003494927.1| PREDICTED: tyrosine-protein phosphatase Lar-like, partial [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340724097|ref|XP_003400421.1| PREDICTED: tyrosine-protein phosphatase Lar-like, partial [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|270004034|gb|EFA00482.1| hypothetical protein TcasGA2_TC003342 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189235110|ref|XP_971078.2| PREDICTED: similar to receptor tyrosine phosphatase type r2a [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383854788|ref|XP_003702902.1| PREDICTED: tyrosine-protein phosphatase Lar-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380021984|ref|XP_003694835.1| PREDICTED: tyrosine-protein phosphatase Lar-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|157109352|ref|XP_001650632.1| receptor tyrosine phosphatase type r2a [Aedes aegypti] gi|108879038|gb|EAT43263.1| AAEL005284-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|307201903|gb|EFN81532.1| Tyrosine-protein phosphatase Lar [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|195385007|ref|XP_002051200.1| GJ13567 [Drosophila virilis] gi|194147657|gb|EDW63355.1| GJ13567 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 427 | ||||||
| FB|FBgn0000464 | 2029 | Lar "Leukocyte-antigen-related | 0.583 | 0.122 | 0.541 | 7.2e-70 | |
| UNIPROTKB|F2Z3B8 | 1266 | PTPRF "Receptor-type tyrosine- | 0.529 | 0.178 | 0.286 | 1.6e-17 | |
| UNIPROTKB|H0Y7Z9 | 1332 | PTPRF "Receptor-type tyrosine- | 0.529 | 0.169 | 0.286 | 1.7e-17 | |
| UNIPROTKB|H0Y6Z7 | 1553 | PTPRF "Receptor-type tyrosine- | 0.529 | 0.145 | 0.286 | 2.1e-17 | |
| ZFIN|ZDB-GENE-021031-1 | 1428 | neo1 "neogenin 1" [Danio rerio | 0.484 | 0.144 | 0.284 | 2.4e-17 | |
| UNIPROTKB|P10586 | 1907 | PTPRF "Receptor-type tyrosine- | 0.529 | 0.118 | 0.286 | 2.7e-17 | |
| UNIPROTKB|E2RE80 | 1897 | PTPRF "Uncharacterized protein | 0.529 | 0.119 | 0.290 | 3.5e-17 | |
| UNIPROTKB|E2RE81 | 1906 | PTPRF "Uncharacterized protein | 0.529 | 0.118 | 0.290 | 3.5e-17 | |
| UNIPROTKB|F1N897 | 1767 | PTPRF "Uncharacterized protein | 0.529 | 0.127 | 0.286 | 1.6e-16 | |
| UNIPROTKB|B7ZKN0 | 1450 | NEO1 "NEO1 protein" [Homo sapi | 0.601 | 0.177 | 0.270 | 5.4e-15 |
| FB|FBgn0000464 Lar "Leukocyte-antigen-related-like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 722 (259.2 bits), Expect = 7.2e-70, P = 7.2e-70
Identities = 136/251 (54%), Positives = 181/251 (72%)
Query: 1 MLKEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSFL-ITNLERGV 59
+++ EP V+IEL W +P QTYGE+ GYR+++GV++ LKE +++ M+ NLERGV
Sbjct: 821 IMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRFDNLERGV 880
Query: 60 EYEFRIAGQNHIGYGQETVRYYXXXXXXXXXXXANISHHFQTPDVVCITWDPPLRTHRNG 119
EYEFR+AG NHIG GQETV+ + +NI+ FQTPDV+C+TWDPP R HRNG
Sbjct: 881 EYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNG 940
Query: 120 QIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSL 179
I Y+V+FHKKID RN T KAVF+NLEE EY V+A TK G GP+S KL +
Sbjct: 941 IITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIV 1000
Query: 180 MTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSI 239
T RDM RAP+ ++A ATS+Q+ E+WW+PV + RGK+LGY+IFYTMTAVEDLD+W K++
Sbjct: 1001 ETERDMGRAPMSLQAEATSEQTAEIWWEPVTS-RGKLLGYKIFYTMTAVEDLDDWQTKTV 1059
Query: 240 PLTESSNIARI 250
LTES+++ +
Sbjct: 1060 GLTESADLVNL 1070
|
|
| UNIPROTKB|F2Z3B8 PTPRF "Receptor-type tyrosine-protein phosphatase F" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0Y7Z9 PTPRF "Receptor-type tyrosine-protein phosphatase F" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0Y6Z7 PTPRF "Receptor-type tyrosine-protein phosphatase F" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-021031-1 neo1 "neogenin 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P10586 PTPRF "Receptor-type tyrosine-protein phosphatase F" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RE80 PTPRF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RE81 PTPRF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N897 PTPRF "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7ZKN0 NEO1 "NEO1 protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 427 | |||
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 2e-11 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 2e-10 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 2e-09 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 4e-08 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 4e-08 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 3e-07 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 5e-07 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 8e-07 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 4e-04 |
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
Score = 59.2 bits (143), Expect = 2e-11
Identities = 23/82 (28%), Positives = 39/82 (47%)
Query: 90 GPPANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIHRNTTQTKAVF 149
PP+N+ T V ++W+PP G IV Y V++ ++ ++ + T
Sbjct: 2 SPPSNLRVTDVTSTSVTLSWEPPPDDGITGYIVGYRVEYREEGSEWKEVNVTPSSTSYTL 61
Query: 150 SNLEEGIEYSAEVQAITKAGPG 171
+ L+ G EY V+A+ AG G
Sbjct: 62 TGLKPGTEYEFRVRAVNGAGEG 83
|
One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins. Length = 83 |
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 427 | |||
| KOG4221|consensus | 1381 | 100.0 | ||
| KOG4221|consensus | 1381 | 100.0 | ||
| KOG3513|consensus | 1051 | 100.0 | ||
| KOG3513|consensus | 1051 | 99.95 | ||
| KOG0196|consensus | 996 | 99.79 | ||
| KOG0196|consensus | 996 | 99.71 | ||
| KOG4222|consensus | 1281 | 99.68 | ||
| KOG4222|consensus | 1281 | 99.56 | ||
| KOG4258|consensus | 1025 | 99.55 | ||
| KOG4258|consensus | 1025 | 99.41 | ||
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 99.29 | |
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 99.2 | |
| KOG4802|consensus | 516 | 98.85 | ||
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 98.71 | |
| KOG4802|consensus | 516 | 98.62 | ||
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 98.55 | |
| COG3401 | 343 | Fibronectin type 3 domain-containing protein [Gene | 98.52 | |
| PF10179 | 300 | DUF2369: Uncharacterised conserved protein (DUF236 | 98.5 | |
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 98.31 | |
| KOG3632|consensus | 1335 | 98.23 | ||
| KOG3632|consensus | 1335 | 98.08 | ||
| COG3401 | 343 | Fibronectin type 3 domain-containing protein [Gene | 98.0 | |
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 97.97 | |
| PF10179 | 300 | DUF2369: Uncharacterised conserved protein (DUF236 | 97.89 | |
| KOG4367|consensus | 699 | 97.56 | ||
| KOG4152|consensus | 830 | 97.46 | ||
| KOG4152|consensus | 830 | 97.38 | ||
| PF09294 | 106 | Interfer-bind: Interferon-alpha/beta receptor, fib | 97.35 | |
| PF09294 | 106 | Interfer-bind: Interferon-alpha/beta receptor, fib | 97.21 | |
| KOG4367|consensus | 699 | 97.12 | ||
| KOG4806|consensus | 454 | 96.85 | ||
| KOG4228|consensus | 1087 | 96.7 | ||
| PF01108 | 107 | Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH | 96.67 | |
| PF01108 | 107 | Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH | 96.55 | |
| COG4733 | 952 | Phage-related protein, tail component [Function un | 96.09 | |
| COG4733 | 952 | Phage-related protein, tail component [Function un | 95.64 | |
| KOG0613|consensus | 1205 | 95.36 | ||
| KOG0613|consensus | 1205 | 95.23 | ||
| PF09067 | 104 | EpoR_lig-bind: Erythropoietin receptor, ligand bin | 94.9 | |
| PF09067 | 104 | EpoR_lig-bind: Erythropoietin receptor, ligand bin | 94.53 | |
| PLN02533 | 427 | probable purple acid phosphatase | 92.29 | |
| PLN02533 | 427 | probable purple acid phosphatase | 90.83 | |
| PF09240 | 99 | IL6Ra-bind: Interleukin-6 receptor alpha chain, bi | 90.3 | |
| KOG4806|consensus | 454 | 90.19 | ||
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 89.89 | |
| PF07495 | 66 | Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi | 89.24 | |
| KOG1225|consensus | 525 | 88.5 | ||
| KOG4228|consensus | 1087 | 87.34 | ||
| KOG1225|consensus | 525 | 86.9 | ||
| PF09240 | 99 | IL6Ra-bind: Interleukin-6 receptor alpha chain, bi | 85.36 | |
| PF07495 | 66 | Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi | 84.46 |
| >KOG4221|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.2e-36 Score=294.06 Aligned_cols=358 Identities=27% Similarity=0.381 Sum_probs=282.7
Q ss_pred CCccceEEEEEeeCCCCCCCcceEeEEEEEEecCccceeEe-ecCcceEEEcCCCCCceEEEEEEEEeccCcCcccce-E
Q psy8774 3 KEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLV-NSKNMSFLITNLERGVEYEFRIAGQNHIGYGQETVR-Y 80 (427)
Q Consensus 3 ~~~~~~sv~l~W~~p~~~~~~i~~Y~v~~~~~~~~~~~~~~-~~~~~~~~~~~L~p~t~Y~~~V~a~~~~g~~~~~~~-~ 80 (427)
.-+..+.+.++|.+|...++++..|.+.|........+... .......++.+|.|.+.|.|+|+|.|..|.+.++.. .
T Consensus 437 ~~~~srfi~~tw~~p~~~~g~i~~~~v~~~~~~~~rer~~~tss~g~~~tv~nl~p~t~Y~~rv~A~n~~g~g~sS~pLk 516 (1381)
T KOG4221|consen 437 NLVSSRFIQLTWRPPAQISGNISTYTVFYKVEGDVRERLQNTSSPGIQVTVQNLSPLTMYFFRVRAKNEAGSGESSAPLK 516 (1381)
T ss_pred ccccceeEEEeecCccccCCCcceEEEEEecCCchhhhheeccCCceEEEeeecccceeEEEEEeccCcccCCccCCceE
Confidence 34567889999998888889999999999876654433333 222288999999999999999999999999986643 4
Q ss_pred EeCCCCCCCCCCeeeEEEeecCCEEEEEeeCCCCCCCCcceeEEEEEEEEccCCCceEEEeeeeeEEEEccCCCCcEEEE
Q psy8774 81 YTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSA 160 (427)
Q Consensus 81 ~~t~~~~p~~~p~~~~~~~~~~~~v~v~W~~p~~~~~~~~i~~Y~v~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~ 160 (427)
+.+..+ +++. ++....+..++.+.|++| .-.+++|.+|.+.|... +...+.....+..+++|++|.+.|.|.|
T Consensus 517 V~t~pE---gp~~-~~a~ats~~ti~v~WepP--~~~n~~I~~yk~~ys~~-~~~~~~~~~~n~~e~ti~gL~k~TeY~~ 589 (1381)
T KOG4221|consen 517 VTTQPE---GPVQ-LQAYATSPTTILVTWEPP--PFGNGPITGYKLFYSED-DTGKELRVENNATEYTINGLEKYTEYSI 589 (1381)
T ss_pred EecCCC---CCcc-ccccccCcceEEEEecCC--CCCCCCceEEEEEEEcC-CCCceEEEecCccEEEeecCCCccceEE
Confidence 444333 3344 888899999999999999 46788999999999987 4555666677899999999999999999
Q ss_pred EEEEeeCCCCCCCCCCeEEEcccccCC-CCCceEEEeeeCcEEEEEeeeCCCC--CCceeEEEEEEEecccccccccccc
Q psy8774 161 EVQAITKAGPGPWSPKLSLMTARDMVR-APLGVKALATSDQSVEVWWKPVPAG--RGKILGYQIFYTMTAVEDLDEWSQK 237 (427)
Q Consensus 161 ~V~a~~~~g~~~~s~~~~~~t~~~~p~-~p~~l~~~~~~~~si~v~W~~p~~~--~g~i~~Y~I~~~~~~~~~~~~~~~~ 237 (427)
+|.|+|.+|.|..|..+.+.|..+.|. ||.|+++...++++|.|+|.+|... +|.+.+|+|+|+.........+
T Consensus 590 ~vvA~N~~G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t~ng~itgYkIRy~~~~~~~~~~~--- 666 (1381)
T KOG4221|consen 590 RVVAYNSAGSGVSSADITVRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSETQNGQITGYKIRYRKLSREDEVNE--- 666 (1381)
T ss_pred EEEEecCCCCCCCCCceEEEeccCCCCCCCcceEEEecCCCeEEEEccCCCcccccceEEEEEEEecccCcccccce---
Confidence 999999999999999999999877775 5556999999999999999999863 6899999999997633222211
Q ss_pred cccccccccceeEEeeeccccccccccccccCCCCceeccCCCCCCeEEEEEEEEeccCCCCCccceEEeecCC------
Q psy8774 238 SIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKVKPE------ 311 (427)
Q Consensus 238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~p~t~Y~~~V~a~~~~G~g~~s~~~~~~t~~~------ 311 (427)
....++...+.+.+|+|++.|.|+|.|.+..|.|++|++..+.|.-.
T Consensus 667 ---------------------------t~v~~n~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w~~aeT~~~d~~e~v 719 (1381)
T KOG4221|consen 667 ---------------------------TVVKGNTTQYLFNGLEPNTQYRVRISAMTVNGTGPASEWVSAETPESDLDERV 719 (1381)
T ss_pred ---------------------------eecccchhhhHhhcCCCCceEEEEEEEeccCCCCCcccceeccCccccccccC
Confidence 22334778899999999999999999999999999999999998522
Q ss_pred -CCCcceEEeecCCCeEEEEecCCCcCCCc--eEEEEEehe---e-ecceeeeeeEEEEeecccccccceEEEEEeeccc
Q psy8774 312 -DVPLSLRAHDVSTHSMTLSWSPPIKLNPV--KYKEVSEKI---Q-ERRLQKYGQYRYFETRDESYIGKRVERMEVRGRK 384 (427)
Q Consensus 312 -~~P~~l~~~~~~~~~v~l~W~~P~~~~g~--~Y~i~~~~~---~-~~~l~~~t~y~~~~~~~~~~~~~~~~~v~a~~~~ 384 (427)
.+|..|.+. ....++.++|.||..++.. +|+|.|+.. . ....+-..+-+++....|.+...|.++++|.|..
T Consensus 720 p~~ps~l~~~-~g~~si~vsW~Pp~~~~~~vrgY~ig~r~g~~~p~~~tIrl~~~~s~y~l~~Le~~~~YvVkL~AfNn~ 798 (1381)
T KOG4221|consen 720 PGKPSELHVH-PGSNSIVVSWTPPPHPNIVVRGYKIGYRPGSGIPDTGTIRLDEKVSYYNLEQLEPNRDYVVKLRAFNNH 798 (1381)
T ss_pred CCCCceeeec-cCceeEEEEeCCCCChhhhhcceEEeeecccCCCCCccEEecceeeEEEEEecccCceEEEEEEEeccC
Confidence 233333333 5788999999999988653 999999421 1 1112222344556777799999999999999999
Q ss_pred CCCCcchhhhHHHH
Q psy8774 385 GRGRPKKRWMDCVN 398 (427)
Q Consensus 385 g~g~p~~~~~~~~~ 398 (427)
|.|.|..+...+.+
T Consensus 799 gdG~p~y~~~~tR~ 812 (1381)
T KOG4221|consen 799 GDGNPIYESVKTRS 812 (1381)
T ss_pred CCCcceeeeeeecc
Confidence 99999755555543
|
|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >KOG4258|consensus | Back alignment and domain information |
|---|
| >KOG4258|consensus | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >KOG4802|consensus | Back alignment and domain information |
|---|
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >KOG4802|consensus | Back alignment and domain information |
|---|
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >KOG4152|consensus | Back alignment and domain information |
|---|
| >KOG4152|consensus | Back alignment and domain information |
|---|
| >PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology | Back alignment and domain information |
|---|
| >PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >KOG4806|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R | Back alignment and domain information |
|---|
| >PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R | Back alignment and domain information |
|---|
| >COG4733 Phage-related protein, tail component [Function unknown] | Back alignment and domain information |
|---|
| >COG4733 Phage-related protein, tail component [Function unknown] | Back alignment and domain information |
|---|
| >KOG0613|consensus | Back alignment and domain information |
|---|
| >KOG0613|consensus | Back alignment and domain information |
|---|
| >PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors | Back alignment and domain information |
|---|
| >PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors | Back alignment and domain information |
|---|
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
| >PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology | Back alignment and domain information |
|---|
| >KOG4806|consensus | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology | Back alignment and domain information |
|---|
| >PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 427 | ||||
| 2edy_A | 103 | Solution Structures Of The Fn3 Domain Of Human Rece | 8e-07 | ||
| 3f7r_A | 249 | First Pair Of Fibronectin Type Iii Domains And Part | 1e-05 | ||
| 3f7p_C | 248 | Crystal Structure Of A Complex Between Integrin Bet | 1e-05 | ||
| 3f7q_A | 234 | First Pair Of Fibronectin Type Iii Domains And Part | 1e-05 | ||
| 2dn7_A | 107 | Solution Structures Of The 6th Fn3 Domain Of Human | 1e-05 | ||
| 1qg3_A | 195 | Crystal Structure Of A Tandem Pair Of Fibronectin T | 1e-05 | ||
| 1x5h_A | 132 | The Solution Structure Of The Third Fibronectin Typ | 1e-05 | ||
| 1x5h_A | 132 | The Solution Structure Of The Third Fibronectin Typ | 2e-05 | ||
| 1fnf_A | 368 | Fragment Of Human Fibronectin Encompassing Type-Iii | 5e-04 |
| >pdb|2EDY|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 103 | Back alignment and structure |
|
| >pdb|3F7R|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 249 | Back alignment and structure |
| >pdb|3F7P|C Chain C, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 248 | Back alignment and structure |
| >pdb|3F7Q|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 234 | Back alignment and structure |
| >pdb|2DN7|A Chain A, Solution Structures Of The 6th Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 107 | Back alignment and structure |
| >pdb|1QG3|A Chain A, Crystal Structure Of A Tandem Pair Of Fibronectin Type Iii Domains From The Cytoplasmic Tail Of Integrin Alpha6 Beta4 Length = 195 | Back alignment and structure |
| >pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 | Back alignment and structure |
| >pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 | Back alignment and structure |
| >pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 427 | |||
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 7e-46 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 8e-36 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 2e-12 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 5e-44 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 8e-35 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 1e-26 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 7e-43 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 2e-33 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 1e-26 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 2e-10 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 4e-38 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 8e-31 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 1e-30 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 3e-30 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 8e-22 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 2e-37 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 1e-32 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 1e-27 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 3e-09 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 5e-36 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 9e-32 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 2e-18 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 8e-16 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 7e-35 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 2e-27 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 1e-20 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 8e-09 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 2e-34 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 4e-19 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 1e-09 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 2e-34 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 4e-30 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 3e-16 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 1e-07 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 3e-33 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 1e-32 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 3e-26 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 2e-15 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 9e-31 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 5e-30 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 9e-22 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 8e-12 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 8e-11 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 1e-30 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 1e-29 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 6e-16 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 2e-29 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 6e-21 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 1e-11 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 1e-27 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 2e-12 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 4e-11 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 5e-27 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 1e-16 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 5e-11 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 2e-26 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 5e-19 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 1e-10 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 3e-09 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 2e-25 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 1e-13 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 2e-09 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 3e-25 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 6e-21 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 3e-10 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-06 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 8e-24 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 1e-20 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 5e-12 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 1e-23 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 1e-21 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 8e-14 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 3e-23 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 4e-18 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 7e-13 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 1e-07 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 8e-23 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 6e-22 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 5e-13 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 3e-07 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 1e-22 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 3e-19 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 1e-11 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 7e-22 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 4e-17 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 1e-09 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 1e-21 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 3e-15 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 3e-13 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 8e-05 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 5e-21 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 6e-18 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 3e-11 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 6e-21 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 2e-13 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 3e-07 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 1e-20 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 4e-14 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 1e-13 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 2e-20 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 5e-17 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 5e-11 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 4e-20 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 2e-14 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 2e-12 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 7e-20 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 1e-14 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 2e-12 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 7e-20 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 2e-14 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 3e-13 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 1e-19 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 2e-16 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 7e-15 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 1e-06 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 4e-19 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 2e-10 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 3e-09 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 5e-19 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 9e-18 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 2e-13 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 3e-05 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 9e-19 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 6e-16 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 1e-10 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 3e-18 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 2e-10 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 1e-07 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 7e-07 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 3e-18 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 7e-10 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 5e-07 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 1e-17 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 4e-12 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 2e-10 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 2e-17 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 4e-15 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 9e-09 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 3e-17 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 2e-14 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 5e-17 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 4e-16 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 2e-08 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 4e-05 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 2e-16 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 2e-16 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 2e-14 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 7e-04 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 3e-16 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 8e-16 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 5e-09 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-16 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-13 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 2e-13 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 9e-16 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 1e-12 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 2e-10 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 1e-15 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 2e-08 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 2e-08 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 1e-15 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 3e-13 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 1e-15 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 6e-13 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 1e-12 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 2e-15 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 2e-10 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-15 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-12 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-11 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 6e-15 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-14 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 4e-13 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 8e-15 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 2e-14 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 3e-09 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 2e-14 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 1e-13 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 1e-12 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 2e-14 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 6e-12 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 3e-14 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 2e-11 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 3e-14 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 7e-13 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 2e-11 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 2e-13 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 2e-05 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 2e-13 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 2e-12 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 6e-08 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 5e-13 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 4e-08 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 1e-05 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 6e-13 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 2e-08 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-07 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 1e-12 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 3e-12 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 4e-04 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 1e-12 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 7e-11 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 2e-12 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 4e-12 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 6e-12 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 2e-12 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 1e-07 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 1e-05 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 8e-12 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 5e-11 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 4e-07 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 1e-11 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 1e-06 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 1e-11 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 8e-06 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 3e-05 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 1e-11 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 7e-09 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 2e-05 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 2e-11 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 7e-08 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 3e-11 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 2e-09 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 3e-11 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 5e-06 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 3e-11 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 5e-04 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 5e-11 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 1e-06 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 6e-11 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 5e-10 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 2e-10 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 2e-10 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 2e-09 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 2e-10 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 1e-07 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 5e-07 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 3e-10 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 3e-07 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 2e-06 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 4e-10 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 4e-08 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 2e-06 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 4e-10 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 4e-07 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 5e-10 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 9e-10 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 6e-06 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 5e-10 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 3e-09 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 5e-06 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 6e-10 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 6e-05 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 7e-10 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 1e-08 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 7e-10 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 2e-09 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 3e-04 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 9e-10 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 4e-08 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 1e-09 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 8e-09 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 1e-09 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 2e-07 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 4e-07 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 1e-09 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 3e-09 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 3e-09 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 5e-06 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 3e-09 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 1e-07 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 3e-04 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 4e-09 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 6e-06 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 8e-06 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 4e-09 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 2e-04 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 9e-09 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 4e-08 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 1e-08 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 3e-08 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 3e-07 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 1e-08 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 1e-08 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 4e-05 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 6e-04 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 2e-08 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 4e-06 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 2e-05 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 2e-08 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 2e-05 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 2e-08 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 9e-08 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 4e-08 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 2e-06 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 4e-08 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 4e-08 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 7e-08 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 1e-05 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 7e-04 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 2e-07 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 9e-05 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 2e-04 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 3e-07 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 2e-05 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 3e-07 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 4e-07 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 2e-06 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 5e-07 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 5e-06 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 1e-04 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 5e-07 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 7e-07 | |
| 2csp_A | 130 | RIM-BP2, RIM binding protein 2; FN3 domain, struct | 1e-06 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 1e-06 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 4e-06 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 1e-06 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 2e-06 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 1e-06 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 2e-06 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 2e-06 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 2e-06 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 8e-04 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 2e-06 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 4e-06 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 3e-06 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 3e-06 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 3e-05 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 3e-06 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 8e-06 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 6e-05 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 4e-06 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 4e-04 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 5e-06 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 6e-06 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 6e-06 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 1e-04 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 2e-04 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 2e-04 |
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
Score = 168 bits (425), Expect = 7e-46
Identities = 50/384 (13%), Positives = 105/384 (27%), Gaps = 47/384 (12%)
Query: 9 TIELVWSQPTQT-YGEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAG 67
+ + + + G I+ V+Y + + S+ I +L+ EYE +
Sbjct: 277 YLWIQLNANSINGDGPIVAREVEYC-TASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLL 335
Query: 68 QNHIGYGQ----ETVRYYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNGQIVL 123
G +R T P P + + I W+P
Sbjct: 336 TRPGEGGTGSPGPALRTRTKCADPM-RGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYN 394
Query: 124 YNVKFHKKIDANN------VIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKL 177
V + ++ + + +NL S ++ + G S +L
Sbjct: 395 LTVHYCYQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKE-SQEL 453
Query: 178 SLMTARDM-VRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQ 236
+ T D+ P +T ++ + + W+ G I Y+I Y + D +
Sbjct: 454 IVQTDEDLPGAVPTESIQGSTFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLS 513
Query: 237 KSIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNG 296
+ L T Y+ + A T G
Sbjct: 514 NQ-----------------------SGRVSKLGNETHFLFFGLYPGTTYSFTIRASTAKG 550
Query: 297 LGRLSGK--VTVKVKPEDVPLSLRAH-DVSTHSMTLSWSPPIKLNP------VKYKEVSE 347
G + T P L + + +++T+ P + +E
Sbjct: 551 FGPPATNQFTTKISAPSMPAYELETPLNQTDNTVTVMLKPAHSRGAPVSVYQIVVEEERP 610
Query: 348 KIQERRLQKYGQYRYFETRDESYI 371
+ ++ + Y + +
Sbjct: 611 RRTKKTTEILKCYPVPIHFQNASL 634
|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 427 | |||
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 100.0 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 100.0 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 100.0 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 100.0 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 100.0 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 100.0 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 100.0 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 100.0 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 100.0 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 100.0 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 100.0 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 99.98 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 99.98 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 99.97 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 99.97 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 99.97 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 99.97 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 99.96 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 99.95 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 99.95 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 99.95 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 99.94 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 99.94 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 99.94 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 99.93 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 99.93 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 99.93 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 99.93 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 99.92 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 99.92 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 99.92 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 99.92 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 99.91 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 99.9 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 99.9 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 99.9 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 99.9 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 99.9 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 99.9 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 99.9 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 99.89 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 99.89 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 99.89 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 99.88 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 99.88 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 99.88 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 99.87 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 99.87 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 99.87 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 99.86 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 99.86 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 99.85 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 99.84 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 99.84 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 99.84 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 99.83 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 99.82 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 99.82 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 99.81 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 99.79 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 99.78 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 99.77 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 99.77 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 99.76 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 99.73 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.73 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 99.73 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 99.73 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 99.71 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.71 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 99.7 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 99.7 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 99.7 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 99.69 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 99.69 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 99.68 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 99.68 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.68 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 99.66 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.65 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 99.65 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 99.64 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 99.64 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 99.63 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 99.63 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 99.63 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.62 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.62 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 99.62 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 99.61 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 99.61 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 99.61 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 99.61 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 99.6 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 99.6 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 99.6 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 99.6 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 99.6 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 99.59 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 99.59 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.59 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 99.58 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 99.58 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 99.57 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.57 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 99.57 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 99.57 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 99.57 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 99.57 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 99.57 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 99.56 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 99.56 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.56 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 99.56 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 99.56 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.56 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 99.55 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.55 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.54 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 99.54 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 99.54 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 99.54 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 99.53 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 99.53 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 99.53 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 99.53 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 99.53 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 99.53 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.53 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.53 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 99.52 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 99.52 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 99.52 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.52 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 99.52 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 99.52 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 99.52 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 99.51 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.5 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 99.5 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 99.5 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 99.5 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 99.49 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.49 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 99.49 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 99.49 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 99.49 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.49 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 99.49 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.48 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.48 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 99.48 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.47 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 99.47 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 99.47 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.47 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 99.47 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.46 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 99.46 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.46 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.46 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 99.46 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 99.45 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 99.45 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 99.44 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.44 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 99.44 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.44 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 99.43 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 99.43 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.43 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 99.43 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 99.43 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 99.42 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 99.42 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 99.42 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 99.42 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.41 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 99.41 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 99.41 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 99.41 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 99.4 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 99.4 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 99.4 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 99.39 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 99.38 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 99.38 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 99.37 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.37 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 99.37 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 99.37 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 99.36 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 99.36 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 99.36 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 99.36 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 99.35 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 99.35 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 99.35 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 99.35 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 99.35 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 99.34 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 99.34 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 99.34 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 99.33 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 99.32 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 99.32 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 99.31 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 99.3 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 99.3 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 99.29 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 99.28 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 99.28 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 99.28 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.28 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 99.27 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 99.26 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 99.26 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 99.26 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 99.26 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 99.25 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 99.25 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 99.25 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 99.24 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 99.23 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 99.23 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 99.2 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 99.19 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 99.19 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 99.19 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 99.18 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 99.18 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 99.18 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 99.17 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 99.17 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 99.17 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 99.17 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 99.15 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 99.15 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 99.14 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 99.14 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 99.12 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.1 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 99.1 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 99.09 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 99.09 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 99.09 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 99.07 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 99.06 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.01 | |
| 3og6_B | 226 | Interleukin 28 receptor, alpha (interferon, lambd | 99.0 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 99.0 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 99.0 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 99.0 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 98.99 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 98.98 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 98.98 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 98.95 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 98.95 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 98.92 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 98.9 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 98.89 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 98.88 | |
| 1fyh_B | 229 | Interferon-gamma receptor alpha chain; cytokine-re | 98.81 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 98.79 | |
| 3og6_B | 226 | Interleukin 28 receptor, alpha (interferon, lambd | 98.77 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 98.76 | |
| 1q38_A | 89 | Fibronectin; amyloid fibril, anastellin, extracell | 98.73 | |
| 1fyh_B | 229 | Interferon-gamma receptor alpha chain; cytokine-re | 98.68 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 98.68 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 98.57 | |
| 3csg_A | 461 | MBP, maltose-binding protein monobody YS1 fusion, | 98.56 | |
| 3s9d_B | 199 | Interferon alpha/beta receptor 2; human, type I in | 98.55 | |
| 2hft_A | 218 | Human tissue factor; coagulation factor; 1.69A {Ho | 98.54 | |
| 3csg_A | 461 | MBP, maltose-binding protein monobody YS1 fusion, | 98.52 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 98.51 | |
| 1oww_A | 98 | FN, fibronectin first type III module, CIG; fibron | 98.47 | |
| 3s9d_B | 199 | Interferon alpha/beta receptor 2; human, type I in | 98.44 | |
| 1wft_A | 123 | 1700129L13RIK protein; FN3 domain, similar to HOST | 98.38 | |
| 1wft_A | 123 | 1700129L13RIK protein; FN3 domain, similar to HOST | 98.38 | |
| 1oww_A | 98 | FN, fibronectin first type III module, CIG; fibron | 98.21 | |
| 1q38_A | 89 | Fibronectin; amyloid fibril, anastellin, extracell | 98.18 | |
| 2hft_A | 218 | Human tissue factor; coagulation factor; 1.69A {Ho | 98.13 | |
| 3bes_R | 250 | Interferon-gamma binding protein C4R; orthopoxviru | 97.59 | |
| 2csp_A | 130 | RIM-BP2, RIM binding protein 2; FN3 domain, struct | 97.22 | |
| 3b4n_A | 344 | Endo-pectate lyase; pectin, galacturonic acid, rig | 97.21 | |
| 2csp_A | 130 | RIM-BP2, RIM binding protein 2; FN3 domain, struct | 97.21 | |
| 3bes_R | 250 | Interferon-gamma binding protein C4R; orthopoxviru | 97.13 | |
| 3cxe_C | 120 | Granulocyte-macrophage colony-stimulating factor s | 96.9 | |
| 3pdd_A | 190 | Glycoside hydrolase, family 9; CBHA, beta-sandwich | 96.79 | |
| 3pdd_A | 190 | Glycoside hydrolase, family 9; CBHA, beta-sandwich | 96.62 | |
| 3b4n_A | 344 | Endo-pectate lyase; pectin, galacturonic acid, rig | 96.34 | |
| 2uvf_A | 608 | Exopolygalacturonase; GH28, pectin, cell WALL, hyd | 96.15 | |
| 4go6_A | 45 | HCF N-terminal chain 1; tandem fibronectin repeat, | 95.46 | |
| 2uvf_A | 608 | Exopolygalacturonase; GH28, pectin, cell WALL, hyd | 94.82 | |
| 3cxe_C | 120 | Granulocyte-macrophage colony-stimulating factor s | 94.36 | |
| 4go6_A | 45 | HCF N-terminal chain 1; tandem fibronectin repeat, | 93.34 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 92.55 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 91.34 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 89.22 | |
| 1xzw_A | 426 | Purple acid phosphatase; hydrolase; HET: NAG FUC M | 88.07 | |
| 4gns_A | 290 | Chitin biosynthesis protein CHS5; FN3, BRCT, tetra | 87.46 | |
| 2qfp_A | 424 | Purple acid phosphatase; binuclear, Fe-Zn, hydrola | 86.93 | |
| 2w91_A | 653 | Endo-beta-N-acetylglucosaminidase D; hydrolase, N- | 86.79 | |
| 4gns_A | 290 | Chitin biosynthesis protein CHS5; FN3, BRCT, tetra | 86.77 | |
| 2qfp_A | 424 | Purple acid phosphatase; binuclear, Fe-Zn, hydrola | 86.67 | |
| 2w91_A | 653 | Endo-beta-N-acetylglucosaminidase D; hydrolase, N- | 85.65 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 84.32 | |
| 1xzw_A | 426 | Purple acid phosphatase; hydrolase; HET: NAG FUC M | 83.19 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 82.11 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 81.02 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 80.11 |
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-37 Score=294.08 Aligned_cols=340 Identities=17% Similarity=0.220 Sum_probs=260.7
Q ss_pred Cccce-EEEEEeeCCCCCCCcceEeEEEEEEecCc---cceeEeecCcceEEEcCCCCCceEEEEEEEEeccCcCcccce
Q psy8774 4 EEPEV-TIELVWSQPTQTYGEILGYRVKYGVREHT---LKENLVNSKNMSFLITNLERGVEYEFRIAGQNHIGYGQETVR 79 (427)
Q Consensus 4 ~~~~~-sv~l~W~~p~~~~~~i~~Y~v~~~~~~~~---~~~~~~~~~~~~~~~~~L~p~t~Y~~~V~a~~~~g~~~~~~~ 79 (427)
..+++ +|.|+|+++. .+.+.+|+|+|+..++. .+........+++.+.+|.|++.|.|+|+|.+..|.+.....
T Consensus 13 ~~~~~~sv~l~W~~~~--~~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~a~~~~g~s~~~~~ 90 (375)
T 3t1w_A 13 ANPDTGVLTVSWERST--TPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISD 90 (375)
T ss_dssp EETTTTEEEEEEECCS--CSSCCEEEEEEEETTCTTSCCEEEEEETTCCEEEECCCCTTCCEEEEEEEEETTEECCCEEE
T ss_pred ecCCCeEEEEEEeCCC--CCCeeeEEEEEEECCCCCCcceeEEcCCCccEEEEcCCcCCCEEEEEEEEEcCCCCCCcEEe
Confidence 45667 9999999986 35789999999986543 233333677899999999999999999999998887765443
Q ss_pred EEeCCCCCCCCCCeeeEEEeecCCEEEEEeeCCCCCCCCcceeEEEEEEEEccCCCceEE--EeeeeeEEEEccCCCCcE
Q psy8774 80 YYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIH--RNTTQTKAVFSNLEEGIE 157 (427)
Q Consensus 80 ~~~t~~~~p~~~p~~~~~~~~~~~~v~v~W~~p~~~~~~~~i~~Y~v~~~~~~~~~~~~~--~~~~~~~~~i~~L~p~t~ 157 (427)
. +....| +|.++.+...+.+++.|+|+++. ++.+.+|.|+|+..+....... .....+++.|.+|.|++.
T Consensus 91 ~--~~~~~p--~p~~l~~~~~~~~si~l~W~~~~----~~~i~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~ 162 (375)
T 3t1w_A 91 T--IIPEVP--QLTDLSFVDITDSSIGLRWTPLN----SSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGID 162 (375)
T ss_dssp E--ECCCCC--CCSCCEEECCCSSEEEEECCCCC----CTTEEEEEEEEEESSSCCSCEEEEECTTCCEEEEECCCTTCE
T ss_pred e--EcCCCC--CCceEEEEecCCCeEEEEEECCC----CCCceEEEEEEEECCCCCceeEEEcCCCcceEEEeCCCCCCE
Confidence 3 333444 37899999999999999999873 3689999999998744333332 334588999999999999
Q ss_pred EEEEEEEeeCCCCCCCCCCeEEEcccccCCCCCceEEEeeeCcEEEEEeeeCCCCCCceeEEEEEEEecccccccccccc
Q psy8774 158 YSAEVQAITKAGPGPWSPKLSLMTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQK 237 (427)
Q Consensus 158 Y~~~V~a~~~~g~~~~s~~~~~~t~~~~p~~p~~l~~~~~~~~si~v~W~~p~~~~g~i~~Y~I~~~~~~~~~~~~~~~~ 237 (427)
|.|+|+|.|..|.|..+. ..+.+ .+.+|.++.+...+.+++.|+|++|. ++.+.+|.|+|+..+... .+.
T Consensus 163 Y~~~V~a~~~~g~s~~s~-~~~~t---~~~~p~~l~~~~~~~~si~l~W~~p~--~~~i~~Y~v~~~~~~~~~--~~~-- 232 (375)
T 3t1w_A 163 YDISVITLINGGESAPTT-LTQQT---AVPPPTDLRFTNIGPDTMRVTWAPPP--SIDLTNFLVRYSPVKNEE--DVA-- 232 (375)
T ss_dssp EEEEEEEEETTEECCCEE-EEEEC---CCCCCEEEEEESCCSSCEEEEEECCS--SCCCCEEEEEEEEGGGTT--CCE--
T ss_pred EEEEEEEEeCCcccCCee-eeeec---CCCCCceeEEEecccCEEEEEEcCCC--CCCccEEEEEEEeCCCCC--CcE--
Confidence 999999999999886554 34444 34588999999999999999999975 467999999999863221 110
Q ss_pred cccccccccceeEEeeeccccccccccccccCCCCceeccCCCCCCeEEEEEEEEeccCCCCCccceEEeecCCCCCcce
Q psy8774 238 SIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKVKPEDVPLSL 317 (427)
Q Consensus 238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~p~t~Y~~~V~a~~~~G~g~~s~~~~~~t~~~~~P~~l 317 (427)
........++++|.+|.|++.|.|+|+|++..|.|..+. ..+.| ++.+|.++
T Consensus 233 --------------------------~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~~~~g~s~~~~-~~~~t-~p~~P~~l 284 (375)
T 3t1w_A 233 --------------------------ELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLR-GRQKT-GLDSPTGI 284 (375)
T ss_dssp --------------------------EEEECTTCCEEEECSCCTTCEEEEEEEEEETTEECCCEE-EEEEC-CCCCCEEE
T ss_pred --------------------------EEEcCCCcCEEEeCCCCCCCEEEEEEEEEcCCCcCCcee-eEEec-CCCCCCcc
Confidence 122334568999999999999999999999998887664 44555 55688899
Q ss_pred EEeecCCCeEEEEecCCCcCCCceEEEEEeheee-c---ceeeeeeEEEEeecccccccceEEEEEeecccCCCCcchh
Q psy8774 318 RAHDVSTHSMTLSWSPPIKLNPVKYKEVSEKIQE-R---RLQKYGQYRYFETRDESYIGKRVERMEVRGRKGRGRPKKR 392 (427)
Q Consensus 318 ~~~~~~~~~v~l~W~~P~~~~g~~Y~i~~~~~~~-~---~l~~~t~y~~~~~~~~~~~~~~~~~v~a~~~~g~g~p~~~ 392 (427)
++...+.+++.|+|++|. ....+|.|.+..... . .......-..+....|.+...|.|+|+|.+..|.|+|...
T Consensus 285 ~~~~~~~~sv~l~W~~p~-~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~~~~G~s~p~s~ 362 (375)
T 3t1w_A 285 DFSDITANSFTVHWIAPR-ATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIG 362 (375)
T ss_dssp EEESCCSSCEEEEEECCS-SCCSEEEEEEEETTCCSSCEEEEEETTCCEEEECSCCTTCEEEEEEEEEETTEECCCEEE
T ss_pred EeeeccCCEEEEEECCCC-cceeeEEEEEEECCCCCcceeEEcCCCccEEEECCCCCCCEEEEEEEEECCCCCCCceee
Confidence 998889999999999985 344599998864332 1 1111111223467889999999999999999999999763
|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* | Back alignment and structure |
|---|
| >3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* | Back alignment and structure |
|---|
| >1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R | Back alignment and structure |
|---|
| >3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* | Back alignment and structure |
|---|
| >3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* | Back alignment and structure |
|---|
| >2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... | Back alignment and structure |
|---|
| >3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* | Back alignment and structure |
|---|
| >1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... | Back alignment and structure |
|---|
| >3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} | Back alignment and structure |
|---|
| >2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A | Back alignment and structure |
|---|
| >2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} | Back alignment and structure |
|---|
| >3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A | Back alignment and structure |
|---|
| >3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A | Back alignment and structure |
|---|
| >3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A | Back alignment and structure |
|---|
| >2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* | Back alignment and structure |
|---|
| >4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* | Back alignment and structure |
|---|
| >3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 | Back alignment and structure |
|---|
| >4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* | Back alignment and structure |
|---|
| >2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* | Back alignment and structure |
|---|
| >4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* | Back alignment and structure |
|---|
| >2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* | Back alignment and structure |
|---|
| >1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 427 | ||||
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 5e-17 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 1e-11 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 6e-05 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 0.002 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 6e-17 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 2e-06 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 3e-06 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 4e-16 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 2e-07 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 3e-04 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 2e-14 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 1e-07 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 4e-06 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 3e-14 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 3e-08 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 1e-06 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 5e-14 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 8e-09 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 6e-07 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 3e-13 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 1e-06 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 5e-05 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 9e-13 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 5e-07 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 5e-05 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 1e-11 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 2e-11 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 3e-06 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 4e-06 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 3e-11 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 7e-07 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 3e-04 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 3e-11 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 3e-06 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 1e-10 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 1e-07 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 0.003 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 7e-10 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 9e-10 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 2e-06 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 1e-05 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 9e-10 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 1e-04 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 1e-09 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 3e-07 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 1e-09 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 0.001 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 2e-09 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 3e-09 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 1e-07 | |
| d2cspa1 | 117 | b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho | 4e-09 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 1e-08 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 0.001 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 1e-08 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 6e-08 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 5e-07 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 1e-08 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 1e-08 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 2e-05 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 2e-08 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 3e-04 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 2e-08 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 4e-04 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 3e-08 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 4e-04 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 0.002 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 6e-08 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 7e-08 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 8e-08 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 1e-07 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 1e-04 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 2e-07 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 2e-07 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 2e-07 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 2e-06 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 2e-07 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 2e-04 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 5e-07 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 5e-07 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 2e-04 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 6e-07 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 3e-06 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 0.001 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 7e-07 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 0.002 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 8e-07 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 1e-06 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 1e-04 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 1e-06 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 1e-06 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 4e-04 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 2e-06 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 2e-06 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 3e-04 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 3e-06 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 2e-05 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 5e-06 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 6e-06 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 7e-06 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 9e-06 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 0.001 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 1e-05 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 2e-05 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 1e-05 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 0.003 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 2e-05 | |
| d2d9qb2 | 105 | b.1.2.1 (B:204-308) Granulocyte colony-stimulating | 3e-05 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 3e-05 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 3e-04 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 3e-05 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 0.001 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 5e-05 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 5e-05 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 5e-05 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 0.004 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 5e-05 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 5e-05 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 5e-05 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 0.002 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 8e-05 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 1e-04 | |
| d1v5ja_ | 108 | b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId | 2e-04 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 2e-04 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 2e-04 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 9e-04 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 3e-04 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 4e-04 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 4e-04 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 7e-04 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 7e-04 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 0.001 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 8e-04 | |
| d3d85d3 | 94 | b.1.2.1 (D:212-305) The p40 domain of interleukin- | 8e-04 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 0.001 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 0.002 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 0.002 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 0.004 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 0.004 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 0.004 |
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Fibronectin type III family: Fibronectin type III domain: Insulin receptor species: Human (Homo sapiens) [TaxId: 9606]
Score = 76.8 bits (187), Expect = 5e-17
Identities = 29/184 (15%), Positives = 49/184 (26%), Gaps = 13/184 (7%)
Query: 9 TIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAGQ 68
I L W P+ G I Y V + E+ + L + +
Sbjct: 18 QIILKWKPPSDPNGNITHYLVFW----ERQAEDSELFELDYCLKGLKLPSRTWSPPFESE 73
Query: 69 NHIGYGQ--ETVRYYTTPEGPPTGP-----PANISHHFQTPDVVCITWDPPLRTHRNGQI 121
+ + Q P T S D + P +
Sbjct: 74 DSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVP--RPSRKRR 131
Query: 122 VLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSLMT 181
L +V + + + + V S L Y E+QA + P + ++
Sbjct: 132 SLGDVGNAGNNEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVS 191
Query: 182 ARDM 185
AR M
Sbjct: 192 ARTM 195
|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 427 | |||
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.6 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.59 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 99.58 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 99.57 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 99.56 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.56 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 99.55 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 99.55 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 99.55 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 99.54 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.54 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 99.53 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 99.52 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 99.52 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 99.51 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.5 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.5 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 99.5 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.5 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.49 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 99.49 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 99.49 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.49 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.48 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 99.48 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 99.48 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 99.48 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.48 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 99.48 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.47 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 99.47 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 99.47 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.47 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 99.46 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 99.46 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.46 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 99.46 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.46 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.45 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.45 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.45 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 99.45 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.45 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 99.45 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.44 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.44 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.44 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 99.44 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.44 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.43 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.43 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 99.42 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.42 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.42 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 99.41 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 99.39 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.39 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 99.38 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.38 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.37 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.37 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 99.37 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.36 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.36 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.35 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.35 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 99.35 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.35 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.34 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.34 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.34 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.34 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.34 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 99.34 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 99.33 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.33 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.33 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.33 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.33 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.33 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.32 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.31 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.31 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.31 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 99.31 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.31 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.31 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.31 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 99.31 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 99.3 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.3 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 99.3 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.29 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 99.29 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.29 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 99.29 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.28 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 99.28 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.28 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.28 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.28 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.28 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.28 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.28 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 99.28 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 99.27 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 99.27 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 99.27 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 99.26 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.26 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 99.26 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 99.25 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 99.24 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 99.24 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.23 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.23 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.23 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 99.23 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 99.23 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.23 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 99.23 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.22 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.22 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.22 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.21 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.21 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 99.21 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 99.2 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.19 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 99.19 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.19 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 99.19 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.17 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 99.16 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.15 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 99.14 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 99.07 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 99.07 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 99.06 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 99.05 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.05 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.04 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.02 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 98.99 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.93 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 98.91 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 98.87 | |
| d3d85d3 | 94 | The p40 domain of interleukin-12 (IL-12 beta chain | 98.83 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 98.78 | |
| d3d85d3 | 94 | The p40 domain of interleukin-12 (IL-12 beta chain | 98.71 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 98.62 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 98.6 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 98.4 | |
| d2qfra1 | 112 | Purple acid phosphatase, N-terminal domain {Kidney | 97.41 | |
| d2qfra1 | 112 | Purple acid phosphatase, N-terminal domain {Kidney | 97.21 | |
| d1xzwa1 | 119 | Purple acid phosphatase, N-terminal domain {Sweet | 97.12 | |
| d1xzwa1 | 119 | Purple acid phosphatase, N-terminal domain {Sweet | 96.79 | |
| d1f6fb1 | 96 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 96.61 | |
| d2hfta1 | 106 | Extracellular region of human tissue factor {Human | 96.55 | |
| d1a21a1 | 103 | Extracellular region of human tissue factor {Rabbi | 96.45 | |
| d2c4fu1 | 116 | Extracellular region of human tissue factor {Human | 96.15 | |
| d2hyma1 | 109 | Interferon-alpha/beta receptor beta chain {Human ( | 96.07 | |
| d1f6fb1 | 96 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 96.02 | |
| d2hyma1 | 109 | Interferon-alpha/beta receptor beta chain {Human ( | 95.67 | |
| d2c4fu1 | 116 | Extracellular region of human tissue factor {Human | 95.36 | |
| d2hfta1 | 106 | Extracellular region of human tissue factor {Human | 94.15 | |
| d1a21a1 | 103 | Extracellular region of human tissue factor {Rabbi | 93.96 | |
| d2gysa3 | 99 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 83.96 | |
| d1edqa1 | 109 | Chitinase A, N-terminal domain N {Serratia marcesc | 82.6 | |
| d1axib1 | 99 | Growth hormone receptor {Human (Homo sapiens) [Tax | 82.21 |
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Fibronectin type III family: Fibronectin type III domain: Sidekick 2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68 E-value=8.7e-17 Score=122.88 Aligned_cols=112 Identities=24% Similarity=0.335 Sum_probs=91.7
Q ss_pred CCCCCC-CCCeEEEcccccCCCCCceEEEeeeCcEEEEEeeeCCCCCCceeEEEEEEEeccccccccccccccccccccc
Q psy8774 168 AGPGPW-SPKLSLMTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSIPLTESSN 246 (427)
Q Consensus 168 ~g~~~~-s~~~~~~t~~~~p~~p~~l~~~~~~~~si~v~W~~p~~~~g~i~~Y~I~~~~~~~~~~~~~~~~~~~~~~~~~ 246 (427)
.|.|.+ +..+.++|..++|.+|.++.+...+.+++.|+|++|...+|.+.+|.|+|+..........
T Consensus 2 ~G~G~pss~~v~~~T~~~~P~~P~~~~~~~~~~~sv~v~W~~P~~~~g~i~~Y~i~y~~~~~~~~~~~------------ 69 (117)
T d1wfoa1 2 IGDGSPSHPPILERTLDDVPGPPMGILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNTTTANTAT------------ 69 (117)
T ss_dssp CCCCCCCCCCSCCCCSCCCCCCCCCCEEEEECSSEEEEECCCCSCCCSCCCEEEEEEEESSCCCSCCC------------
T ss_pred ccCCCCCCCCEEEECCCCCCcCCCCcEEEEecCCEEEEEEECCCCCCCceEEEeeeeeeccCCCceEe------------
Confidence 467755 4567888888889999999999999999999999998788899999999987643221111
Q ss_pred ceeEEeeeccccccccccccccCCCCceeccCCCCCCeEEEEEEEEeccCCCCCccceEEee
Q psy8774 247 IARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKV 308 (427)
Q Consensus 247 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~p~t~Y~~~V~a~~~~G~g~~s~~~~~~t 308 (427)
........++++|.+|+|++.|.|+|+|+|..|.|++|..+.++|
T Consensus 70 -----------------~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~n~~G~g~~S~~~~~tT 114 (117)
T d1wfoa1 70 -----------------VEVLAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTT 114 (117)
T ss_dssp -----------------EEEECTTCCEEEEESCCSSSEEEEEEEEECSSCEEEEEEEEEECC
T ss_pred -----------------EEecCCceEEEEECCCCCCCEEEEEEEEECCCcCCCCcCCEEEEC
Confidence 223345677899999999999999999999999999998877776
|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} | Back information, alignment and structure |
|---|
| >d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} | Back information, alignment and structure |
|---|
| >d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2gysa3 b.1.2.1 (A:218-316) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edqa1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|