Psyllid ID: psy8774


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------
MLKEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAGQNHIGYGQETVRYYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSLMTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKVKPEDVPLSLRAHDVSTHSMTLSWSPPIKLNPVKYKEVSEKIQERRLQKYGQYRYFETRDESYIGKRVERMEVRGRKGRGRPKKRWMDCVNQDLGEKNLTGHEAHNRAAWKRLTRNADPI
ccccccccEEEEEEEccccccccccEEEEEEEEccccEEEEEEcccccEEEEcccccccEEEEEEEEEcccccccccccEEEccccccccccccEEEEEccccEEEEEEEccccccccccccEEEEEEEEccccccEEEEcccccEEEEcccccccEEEEEEEEEcccccccccccEEEEccccccccccccEEEEEEccEEEEEEEcccccccEEEEEEEEEEEccccccccccccccccccccccEEEEEEcccccccccccccccccccEEEEcccccccEEEEEEEEEcccccccccccEEEEEccccccccEEEEEccccEEEEEEccccccccEEEEEEEEEEEEEEEEEEcEEEEEEEcccccccEEEEEEEEEcccccccccccEEEEEEcccccccccccccccEEEEEEcccccccc
cccEccccEEEEEEcccccccccEEEEEEEEEccccccEEEEEcccccEEEEEccccccEEEEEEEEEEcccccccccEEEEEcccccccccccEEEEEccccEEEEEEcccccccccccEEEEEEEEEEccccccEEEEcccccEEEEEccccccEEEEEEEEEEccccccccccEEEEcccccccccccEEEEEEcccEEEEEEcccccccccEEEEEEEEEEccccccccEEEcccccccccccccEEEEcccccccccEEEEEccccEEEEEEccccccEEEEEEEEEEccccccccccEEEEcccccccccEEEEEccccEEEEEEccccccccEEEEEEEEEccccEEEEccccEEEEEEccccccEEEEEEEEEEccccccccccEEEEcccccccccccccEEccccEEEEEEEEcccc
mlkeepevTIELVwsqptqtygEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAGqnhigygqetvryyttpegpptgppanishhfqtpdvvcitwdpplrthrngqivLYNVkfhkkidannvihrntTQTKAVFSNLEEGIEYSAEVQAItkagpgpwspklslmTARDMVRAPLGVKALAtsdqsvevwwkpvpagrgkilGYQIFYTMTAVedldewsqksipltessniARIFYTMTAVEdldewsqksvpltesaeltslEKFTEYAVAVAARTVNglgrlsgkvtvkvkpedvplslrahdvsthsmtlswsppiklnpvkyKEVSEKIQERRLQKYGQYRYFETRDESYIGKRVERMEvrgrkgrgrpkkrwmdcvnqdlgeknltgheahNRAAWKRLTRNADPI
MLKEEPEVTIElvwsqptqtygeILGYRVKYGVREHTLkenlvnsknmsFLITNLERGVEYEFRIAGQNHIGYGQETVRYYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIdannvihrnttqTKAVFSNLEEGIEYSAEVQAItkagpgpwsPKLSLMTARDMVRAPLGVKAlatsdqsvevwwkpvpagrgkILGYQIFYTMTAVEDLDEWSQKSipltessniARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARtvnglgrlsgkvtvkvkpedvplslrahdvsthsmtlswsppiklnpvKYKEVSEKIQerrlqkygqyryfetrdesyigkrvermevrgrkgrgrpkkrwmdcVNQDLgeknltgheahnraawkrltrnadpi
MLKEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAGQNHIGYGQETVRYYttpegpptgppANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSLMTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKVKPEDVPLSLRAHDVSTHSMTLSWSPPIKLNPVKYKEVSEKIQERRLQKYGQYRYFETRDESYIGKRVERMEVrgrkgrgrpkkrWMDCVNQDLGEKNLTGHEAHNRAAWKRLTRNADPI
*******VTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAGQNHIGYGQETVRYYTT***********ISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSLMTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKVKPEDVPLSLRAHDVSTHSMTLSWSPPIKLNPVKYKEVSEKIQERRLQKYGQYRYFETRDESYIGK*******************WMDCV******************************
MLKEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAGQNHI********************PANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDAN***HRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSLMTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLD*W*******TESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKVKPEDVPLSLRAHDVSTHSMTLSWSPPIKLNPVKYKEVSEKIQERRLQKYGQYRYFETRDESYIGKRVERMEVRGRKGRGRPKKRWMDC********************WKR********
********TIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAGQNHIGYGQETVRYYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSLMTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKVKPEDVPLSLRAHDVSTHSMTLSWSPPIKLNPVKYKEVSEKIQERRLQKYGQYRYFETRDESYIGKRVERMEV**********KRWMDCVNQDLGEKNLTGHEAHNRAAWKRLTRNADPI
MLKEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAGQNHIGYGQETVRYYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSLMTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKVKPEDVPLSLRAHDVSTHSMTLSWSPPIKLNPVKYKEVSEKIQERRLQKYGQYRYFETRDESYIGKRVERMEVRGRKGRGRPKKRWMDCVNQDLGEKNLTGHEAHNRAAWKRLTRNADPI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAGQNHIGYGQETVRYYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSLMTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKVKPEDVPLSLRAHDVSTHSMTLSWSPPIKLNPVKYKEVSEKIQERRLQKYGQYRYFETRDESYIGKRVERMEVRGRKGRGRPKKRWMDCVNQDLGEKNLTGHEAHNRAAWKRLTRNADPI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query427 2.2.26 [Sep-21-2011]
P16621 2029 Tyrosine-protein phosphat yes N/A 0.733 0.154 0.581 1e-110
P10586 1907 Receptor-type tyrosine-pr yes N/A 0.510 0.114 0.309 7e-22
Q64487 1912 Receptor-type tyrosine-pr yes N/A 0.475 0.106 0.301 3e-20
A4IFW2 1909 Receptor-type tyrosine-pr no N/A 0.501 0.112 0.303 3e-20
P23468 1912 Receptor-type tyrosine-pr no N/A 0.496 0.110 0.305 3e-20
A2A8L5 1898 Receptor-type tyrosine-pr yes N/A 0.510 0.114 0.309 4e-20
Q64604 1898 Receptor-type tyrosine-pr no N/A 0.510 0.114 0.300 1e-19
A7MBJ4 1898 Receptor-type tyrosine-pr no N/A 0.512 0.115 0.301 2e-19
P0C5E4 2300 Phosphatidylinositol phos no N/A 0.681 0.126 0.245 1e-18
Q90610 1443 Neogenin (Fragment) OS=Ga no N/A 0.683 0.202 0.285 3e-17
>sp|P16621|LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster GN=Lar PE=1 SV=2 Back     alignment and function desciption
 Score =  399 bits (1024), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 247/344 (71%), Gaps = 31/344 (9%)

Query: 1    MLKEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSF-LITNLERGV 59
            +++ EP V+IEL W +P QTYGE+ GYR+++GV++  LKE +++   M+     NLERGV
Sbjct: 821  IMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRFDNLERGV 880

Query: 60   EYEFRIAGQNHIGYGQETVRYYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNG 119
            EYEFR+AG NHIG GQETV+ + TPEG P GPP+NI+  FQTPDV+C+TWDPP R HRNG
Sbjct: 881  EYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNG 940

Query: 120  QIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSL 179
             I  Y+V+FHKKID      RN T  KAVF+NLEE  EY   V+A TK G GP+S KL +
Sbjct: 941  IITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIV 1000

Query: 180  MTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSI 239
             T RDM RAP+ ++A ATS+Q+ E+WW+PV   RGK+LGY+IFYTMTAVEDLD+W  K+ 
Sbjct: 1001 ETERDMGRAPMSLQAEATSEQTAEIWWEPV-TSRGKLLGYKIFYTMTAVEDLDDWQTKT- 1058

Query: 240  PLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGR 299
                                        V LTESA+L +LEKF +YAVA+AAR  NGLGR
Sbjct: 1059 ----------------------------VGLTESADLVNLEKFAQYAVAIAARFKNGLGR 1090

Query: 300  LSGKVTVKVKPEDVPLSLRAHDVSTHSMTLSWSPPIKLNPVKYK 343
            LS KVTV++KPEDVPL+LRAHDVSTHSMTLSWSPPI+L PV YK
Sbjct: 1091 LSEKVTVRIKPEDVPLNLRAHDVSTHSMTLSWSPPIRLTPVNYK 1134




Possible cell adhesion receptor. It possesses an intrinsic protein tyrosine phosphatase activity (PTPase). It controls motor axon guidance.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|P10586|PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens GN=PTPRF PE=1 SV=2 Back     alignment and function description
>sp|Q64487|PTPRD_MOUSE Receptor-type tyrosine-protein phosphatase delta OS=Mus musculus GN=Ptprd PE=1 SV=3 Back     alignment and function description
>sp|A4IFW2|PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio GN=ptprf PE=2 SV=1 Back     alignment and function description
>sp|P23468|PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens GN=PTPRD PE=1 SV=2 Back     alignment and function description
>sp|A2A8L5|PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus GN=Ptprf PE=1 SV=1 Back     alignment and function description
>sp|Q64604|PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus GN=Ptprf PE=2 SV=1 Back     alignment and function description
>sp|A7MBJ4|PTPRF_BOVIN Receptor-type tyrosine-protein phosphatase F OS=Bos taurus GN=PTPRF PE=2 SV=1 Back     alignment and function description
>sp|P0C5E4|PTPRQ_MOUSE Phosphatidylinositol phosphatase PTPRQ OS=Mus musculus GN=Ptprq PE=1 SV=1 Back     alignment and function description
>sp|Q90610|NEO1_CHICK Neogenin (Fragment) OS=Gallus gallus PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query427
242003488 2014 Receptor-type tyrosine-protein phosphata 0.751 0.159 0.605 1e-119
350427923 2025 PREDICTED: tyrosine-protein phosphatase 0.749 0.158 0.594 1e-114
340724097 1926 PREDICTED: tyrosine-protein phosphatase 0.749 0.166 0.592 1e-114
270004034 2156 hypothetical protein TcasGA2_TC003342 [T 0.751 0.148 0.613 1e-113
189235110 2016 PREDICTED: similar to receptor tyrosine 0.751 0.159 0.613 1e-113
383854788 2040 PREDICTED: tyrosine-protein phosphatase 0.749 0.156 0.594 1e-112
380021984 1774 PREDICTED: tyrosine-protein phosphatase 0.749 0.180 0.592 1e-112
157109352 2007 receptor tyrosine phosphatase type r2a [ 0.751 0.159 0.585 1e-111
307201903 1374 Tyrosine-protein phosphatase Lar [Harpeg 0.749 0.232 0.577 1e-111
195385007 2025 GJ13567 [Drosophila virilis] gi|19414765 0.733 0.154 0.590 1e-111
>gi|242003488|ref|XP_002422752.1| Receptor-type tyrosine-protein phosphatase F precursor, putative [Pediculus humanus corporis] gi|212505585|gb|EEB10014.1| Receptor-type tyrosine-protein phosphatase F precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  436 bits (1120), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/352 (60%), Positives = 268/352 (76%), Gaps = 31/352 (8%)

Query: 1    MLKEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLV-NSKNMSFLITNLERGV 59
            ++++EP V+IEL W++PTQTYGE++GY++K+G+++  LKE ++  S   S    +LERG+
Sbjct: 808  VMEKEPTVSIELEWTKPTQTYGELIGYKLKHGIKDQPLKEEIIKGSGKTSRSFVDLERGL 867

Query: 60   EYEFRIAGQNHIGYGQETVRYYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNG 119
            EYEFRIAGQN +GYGQETV+Y+ TPEGPP+GPP NIS+ FQTPDVVCITW PP R  RNG
Sbjct: 868  EYEFRIAGQNAVGYGQETVKYFLTPEGPPSGPPLNISYRFQTPDVVCITWVPPSRDQRNG 927

Query: 120  QIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSL 179
            QI  Y+++F KK+D + V  RNTTQTKAVFSNLEE  EY  +++A T  GPGP+S K+S+
Sbjct: 928  QITHYDIQFFKKMDHSTVPERNTTQTKAVFSNLEENTEYVFQIRAFTSQGPGPFSEKISI 987

Query: 180  MTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSI 239
             T RDM+RAP+ V+A+ATS++SVEVWW+ VPA R K++GYQIFYTMTAVEDLDEW QKS 
Sbjct: 988  KTERDMMRAPMNVEAVATSEESVEVWWEAVPA-RSKVIGYQIFYTMTAVEDLDEWQQKS- 1045

Query: 240  PLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGR 299
                                        V LTESA+L +LEKF +YA+AVAART  GLGR
Sbjct: 1046 ----------------------------VSLTESADLLNLEKFAQYAIAVAARTKVGLGR 1077

Query: 300  LSGKVTVKVKPEDVPLSLRAHDVSTHSMTLSWSPPIKLNPVKYKEVSEKIQE 351
            LS KVTVK+KPEDVPL+LRAHDVSTHSMTLSWSPPI+LNP+ YK   + ++E
Sbjct: 1078 LSEKVTVKIKPEDVPLNLRAHDVSTHSMTLSWSPPIRLNPINYKISFDAVKE 1129




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350427923|ref|XP_003494927.1| PREDICTED: tyrosine-protein phosphatase Lar-like, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|340724097|ref|XP_003400421.1| PREDICTED: tyrosine-protein phosphatase Lar-like, partial [Bombus terrestris] Back     alignment and taxonomy information
>gi|270004034|gb|EFA00482.1| hypothetical protein TcasGA2_TC003342 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189235110|ref|XP_971078.2| PREDICTED: similar to receptor tyrosine phosphatase type r2a [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383854788|ref|XP_003702902.1| PREDICTED: tyrosine-protein phosphatase Lar-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380021984|ref|XP_003694835.1| PREDICTED: tyrosine-protein phosphatase Lar-like [Apis florea] Back     alignment and taxonomy information
>gi|157109352|ref|XP_001650632.1| receptor tyrosine phosphatase type r2a [Aedes aegypti] gi|108879038|gb|EAT43263.1| AAEL005284-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307201903|gb|EFN81532.1| Tyrosine-protein phosphatase Lar [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|195385007|ref|XP_002051200.1| GJ13567 [Drosophila virilis] gi|194147657|gb|EDW63355.1| GJ13567 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query427
FB|FBgn0000464 2029 Lar "Leukocyte-antigen-related 0.583 0.122 0.541 7.2e-70
UNIPROTKB|F2Z3B8 1266 PTPRF "Receptor-type tyrosine- 0.529 0.178 0.286 1.6e-17
UNIPROTKB|H0Y7Z9 1332 PTPRF "Receptor-type tyrosine- 0.529 0.169 0.286 1.7e-17
UNIPROTKB|H0Y6Z7 1553 PTPRF "Receptor-type tyrosine- 0.529 0.145 0.286 2.1e-17
ZFIN|ZDB-GENE-021031-1 1428 neo1 "neogenin 1" [Danio rerio 0.484 0.144 0.284 2.4e-17
UNIPROTKB|P10586 1907 PTPRF "Receptor-type tyrosine- 0.529 0.118 0.286 2.7e-17
UNIPROTKB|E2RE80 1897 PTPRF "Uncharacterized protein 0.529 0.119 0.290 3.5e-17
UNIPROTKB|E2RE81 1906 PTPRF "Uncharacterized protein 0.529 0.118 0.290 3.5e-17
UNIPROTKB|F1N897 1767 PTPRF "Uncharacterized protein 0.529 0.127 0.286 1.6e-16
UNIPROTKB|B7ZKN0 1450 NEO1 "NEO1 protein" [Homo sapi 0.601 0.177 0.270 5.4e-15
FB|FBgn0000464 Lar "Leukocyte-antigen-related-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 722 (259.2 bits), Expect = 7.2e-70, P = 7.2e-70
 Identities = 136/251 (54%), Positives = 181/251 (72%)

Query:     1 MLKEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSFL-ITNLERGV 59
             +++ EP V+IEL W +P QTYGE+ GYR+++GV++  LKE +++   M+     NLERGV
Sbjct:   821 IMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRFDNLERGV 880

Query:    60 EYEFRIAGQNHIGYGQETVRYYXXXXXXXXXXXANISHHFQTPDVVCITWDPPLRTHRNG 119
             EYEFR+AG NHIG GQETV+ +           +NI+  FQTPDV+C+TWDPP R HRNG
Sbjct:   881 EYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNG 940

Query:   120 QIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSL 179
              I  Y+V+FHKKID      RN T  KAVF+NLEE  EY   V+A TK G GP+S KL +
Sbjct:   941 IITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIV 1000

Query:   180 MTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSI 239
              T RDM RAP+ ++A ATS+Q+ E+WW+PV + RGK+LGY+IFYTMTAVEDLD+W  K++
Sbjct:  1001 ETERDMGRAPMSLQAEATSEQTAEIWWEPVTS-RGKLLGYKIFYTMTAVEDLDDWQTKTV 1059

Query:   240 PLTESSNIARI 250
              LTES+++  +
Sbjct:  1060 GLTESADLVNL 1070


GO:0006470 "protein dephosphorylation" evidence=NAS;IDA
GO:0005001 "transmembrane receptor protein tyrosine phosphatase activity" evidence=ISS
GO:0004725 "protein tyrosine phosphatase activity" evidence=NAS;IDA
GO:0005886 "plasma membrane" evidence=ISS;IDA
GO:0007411 "axon guidance" evidence=IMP;TAS
GO:0008045 "motor neuron axon guidance" evidence=IGI;NAS;IMP;TAS
GO:0016021 "integral to membrane" evidence=NAS
GO:0001700 "embryonic development via the syncytial blastoderm" evidence=NAS
GO:0048477 "oogenesis" evidence=IMP
GO:0007399 "nervous system development" evidence=IMP
GO:0007155 "cell adhesion" evidence=IMP
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0045467 "R7 cell development" evidence=IMP
GO:0008594 "photoreceptor cell morphogenesis" evidence=IMP
GO:0031290 "retinal ganglion cell axon guidance" evidence=IMP
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0030424 "axon" evidence=IDA
GO:0048841 "regulation of axon extension involved in axon guidance" evidence=IMP
GO:0048675 "axon extension" evidence=IMP
GO:0051124 "synaptic growth at neuromuscular junction" evidence=IMP
GO:0007412 "axon target recognition" evidence=IMP
GO:0032093 "SAM domain binding" evidence=IPI
GO:0005925 "focal adhesion" evidence=IDA
UNIPROTKB|F2Z3B8 PTPRF "Receptor-type tyrosine-protein phosphatase F" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y7Z9 PTPRF "Receptor-type tyrosine-protein phosphatase F" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y6Z7 PTPRF "Receptor-type tyrosine-protein phosphatase F" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021031-1 neo1 "neogenin 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P10586 PTPRF "Receptor-type tyrosine-protein phosphatase F" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE80 PTPRF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE81 PTPRF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N897 PTPRF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZKN0 NEO1 "NEO1 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P16621LAR_DROME3, ., 1, ., 3, ., 4, 80.58130.73300.1542yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query427
smart0006083 smart00060, FN3, Fibronectin type 3 domain 2e-11
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 2e-10
pfam0004184 pfam00041, fn3, Fibronectin type III domain 2e-09
smart0006083 smart00060, FN3, Fibronectin type 3 domain 4e-08
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 4e-08
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 3e-07
pfam0004184 pfam00041, fn3, Fibronectin type III domain 5e-07
pfam0004184 pfam00041, fn3, Fibronectin type III domain 8e-07
smart0006083 smart00060, FN3, Fibronectin type 3 domain 4e-04
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
 Score = 59.2 bits (143), Expect = 2e-11
 Identities = 23/82 (28%), Positives = 39/82 (47%)

Query: 90  GPPANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIHRNTTQTKAVF 149
            PP+N+     T   V ++W+PP      G IV Y V++ ++      ++   + T    
Sbjct: 2   SPPSNLRVTDVTSTSVTLSWEPPPDDGITGYIVGYRVEYREEGSEWKEVNVTPSSTSYTL 61

Query: 150 SNLEEGIEYSAEVQAITKAGPG 171
           + L+ G EY   V+A+  AG G
Sbjct: 62  TGLKPGTEYEFRVRAVNGAGEG 83


One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins. Length = 83

>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 427
KOG4221|consensus 1381 100.0
KOG4221|consensus 1381 100.0
KOG3513|consensus1051 100.0
KOG3513|consensus 1051 99.95
KOG0196|consensus 996 99.79
KOG0196|consensus 996 99.71
KOG4222|consensus 1281 99.68
KOG4222|consensus 1281 99.56
KOG4258|consensus1025 99.55
KOG4258|consensus1025 99.41
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.29
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.2
KOG4802|consensus516 98.85
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.71
KOG4802|consensus516 98.62
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.55
COG3401343 Fibronectin type 3 domain-containing protein [Gene 98.52
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 98.5
smart0006083 FN3 Fibronectin type 3 domain. One of three types 98.31
KOG3632|consensus 1335 98.23
KOG3632|consensus 1335 98.08
COG3401343 Fibronectin type 3 domain-containing protein [Gene 98.0
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.97
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 97.89
KOG4367|consensus699 97.56
KOG4152|consensus830 97.46
KOG4152|consensus830 97.38
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 97.35
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 97.21
KOG4367|consensus699 97.12
KOG4806|consensus454 96.85
KOG4228|consensus 1087 96.7
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 96.67
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 96.55
COG4733952 Phage-related protein, tail component [Function un 96.09
COG4733952 Phage-related protein, tail component [Function un 95.64
KOG0613|consensus 1205 95.36
KOG0613|consensus 1205 95.23
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 94.9
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 94.53
PLN02533 427 probable purple acid phosphatase 92.29
PLN02533427 probable purple acid phosphatase 90.83
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 90.3
KOG4806|consensus454 90.19
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 89.89
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 89.24
KOG1225|consensus525 88.5
KOG4228|consensus 1087 87.34
KOG1225|consensus525 86.9
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 85.36
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 84.46
>KOG4221|consensus Back     alignment and domain information
Probab=100.00  E-value=5.2e-36  Score=294.06  Aligned_cols=358  Identities=27%  Similarity=0.381  Sum_probs=282.7

Q ss_pred             CCccceEEEEEeeCCCCCCCcceEeEEEEEEecCccceeEe-ecCcceEEEcCCCCCceEEEEEEEEeccCcCcccce-E
Q psy8774           3 KEEPEVTIELVWSQPTQTYGEILGYRVKYGVREHTLKENLV-NSKNMSFLITNLERGVEYEFRIAGQNHIGYGQETVR-Y   80 (427)
Q Consensus         3 ~~~~~~sv~l~W~~p~~~~~~i~~Y~v~~~~~~~~~~~~~~-~~~~~~~~~~~L~p~t~Y~~~V~a~~~~g~~~~~~~-~   80 (427)
                      .-+..+.+.++|.+|...++++..|.+.|........+... .......++.+|.|.+.|.|+|+|.|..|.+.++.. .
T Consensus       437 ~~~~srfi~~tw~~p~~~~g~i~~~~v~~~~~~~~rer~~~tss~g~~~tv~nl~p~t~Y~~rv~A~n~~g~g~sS~pLk  516 (1381)
T KOG4221|consen  437 NLVSSRFIQLTWRPPAQISGNISTYTVFYKVEGDVRERLQNTSSPGIQVTVQNLSPLTMYFFRVRAKNEAGSGESSAPLK  516 (1381)
T ss_pred             ccccceeEEEeecCccccCCCcceEEEEEecCCchhhhheeccCCceEEEeeecccceeEEEEEeccCcccCCccCCceE
Confidence            34567889999998888889999999999876654433333 222288999999999999999999999999986643 4


Q ss_pred             EeCCCCCCCCCCeeeEEEeecCCEEEEEeeCCCCCCCCcceeEEEEEEEEccCCCceEEEeeeeeEEEEccCCCCcEEEE
Q psy8774          81 YTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSA  160 (427)
Q Consensus        81 ~~t~~~~p~~~p~~~~~~~~~~~~v~v~W~~p~~~~~~~~i~~Y~v~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~  160 (427)
                      +.+..+   +++. ++....+..++.+.|++|  .-.+++|.+|.+.|... +...+.....+..+++|++|.+.|.|.|
T Consensus       517 V~t~pE---gp~~-~~a~ats~~ti~v~WepP--~~~n~~I~~yk~~ys~~-~~~~~~~~~~n~~e~ti~gL~k~TeY~~  589 (1381)
T KOG4221|consen  517 VTTQPE---GPVQ-LQAYATSPTTILVTWEPP--PFGNGPITGYKLFYSED-DTGKELRVENNATEYTINGLEKYTEYSI  589 (1381)
T ss_pred             EecCCC---CCcc-ccccccCcceEEEEecCC--CCCCCCceEEEEEEEcC-CCCceEEEecCccEEEeecCCCccceEE
Confidence            444333   3344 888899999999999999  46788999999999987 4555666677899999999999999999


Q ss_pred             EEEEeeCCCCCCCCCCeEEEcccccCC-CCCceEEEeeeCcEEEEEeeeCCCC--CCceeEEEEEEEecccccccccccc
Q psy8774         161 EVQAITKAGPGPWSPKLSLMTARDMVR-APLGVKALATSDQSVEVWWKPVPAG--RGKILGYQIFYTMTAVEDLDEWSQK  237 (427)
Q Consensus       161 ~V~a~~~~g~~~~s~~~~~~t~~~~p~-~p~~l~~~~~~~~si~v~W~~p~~~--~g~i~~Y~I~~~~~~~~~~~~~~~~  237 (427)
                      +|.|+|.+|.|..|..+.+.|..+.|. ||.|+++...++++|.|+|.+|...  +|.+.+|+|+|+.........+   
T Consensus       590 ~vvA~N~~G~g~sS~~i~V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t~ng~itgYkIRy~~~~~~~~~~~---  666 (1381)
T KOG4221|consen  590 RVVAYNSAGSGVSSADITVRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSETQNGQITGYKIRYRKLSREDEVNE---  666 (1381)
T ss_pred             EEEEecCCCCCCCCCceEEEeccCCCCCCCcceEEEecCCCeEEEEccCCCcccccceEEEEEEEecccCcccccce---
Confidence            999999999999999999999877775 5556999999999999999999863  6899999999997633222211   


Q ss_pred             cccccccccceeEEeeeccccccccccccccCCCCceeccCCCCCCeEEEEEEEEeccCCCCCccceEEeecCC------
Q psy8774         238 SIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKVKPE------  311 (427)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~p~t~Y~~~V~a~~~~G~g~~s~~~~~~t~~~------  311 (427)
                                                 ....++...+.+.+|+|++.|.|+|.|.+..|.|++|++..+.|.-.      
T Consensus       667 ---------------------------t~v~~n~~~~l~~~Lep~T~Y~vrIsa~t~nGtGpaS~w~~aeT~~~d~~e~v  719 (1381)
T KOG4221|consen  667 ---------------------------TVVKGNTTQYLFNGLEPNTQYRVRISAMTVNGTGPASEWVSAETPESDLDERV  719 (1381)
T ss_pred             ---------------------------eecccchhhhHhhcCCCCceEEEEEEEeccCCCCCcccceeccCccccccccC
Confidence                                       22334778899999999999999999999999999999999998522      


Q ss_pred             -CCCcceEEeecCCCeEEEEecCCCcCCCc--eEEEEEehe---e-ecceeeeeeEEEEeecccccccceEEEEEeeccc
Q psy8774         312 -DVPLSLRAHDVSTHSMTLSWSPPIKLNPV--KYKEVSEKI---Q-ERRLQKYGQYRYFETRDESYIGKRVERMEVRGRK  384 (427)
Q Consensus       312 -~~P~~l~~~~~~~~~v~l~W~~P~~~~g~--~Y~i~~~~~---~-~~~l~~~t~y~~~~~~~~~~~~~~~~~v~a~~~~  384 (427)
                       .+|..|.+. ....++.++|.||..++..  +|+|.|+..   . ....+-..+-+++....|.+...|.++++|.|..
T Consensus       720 p~~ps~l~~~-~g~~si~vsW~Pp~~~~~~vrgY~ig~r~g~~~p~~~tIrl~~~~s~y~l~~Le~~~~YvVkL~AfNn~  798 (1381)
T KOG4221|consen  720 PGKPSELHVH-PGSNSIVVSWTPPPHPNIVVRGYKIGYRPGSGIPDTGTIRLDEKVSYYNLEQLEPNRDYVVKLRAFNNH  798 (1381)
T ss_pred             CCCCceeeec-cCceeEEEEeCCCCChhhhhcceEEeeecccCCCCCccEEecceeeEEEEEecccCceEEEEEEEeccC
Confidence             233333333 5788999999999988653  999999421   1 1112222344556777799999999999999999


Q ss_pred             CCCCcchhhhHHHH
Q psy8774         385 GRGRPKKRWMDCVN  398 (427)
Q Consensus       385 g~g~p~~~~~~~~~  398 (427)
                      |.|.|..+...+.+
T Consensus       799 gdG~p~y~~~~tR~  812 (1381)
T KOG4221|consen  799 GDGNPIYESVKTRS  812 (1381)
T ss_pred             CCCcceeeeeeecc
Confidence            99999755555543



>KOG4221|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query427
2edy_A103 Solution Structures Of The Fn3 Domain Of Human Rece 8e-07
3f7r_A249 First Pair Of Fibronectin Type Iii Domains And Part 1e-05
3f7p_C248 Crystal Structure Of A Complex Between Integrin Bet 1e-05
3f7q_A234 First Pair Of Fibronectin Type Iii Domains And Part 1e-05
2dn7_A107 Solution Structures Of The 6th Fn3 Domain Of Human 1e-05
1qg3_A195 Crystal Structure Of A Tandem Pair Of Fibronectin T 1e-05
1x5h_A132 The Solution Structure Of The Third Fibronectin Typ 1e-05
1x5h_A132 The Solution Structure Of The Third Fibronectin Typ 2e-05
1fnf_A368 Fragment Of Human Fibronectin Encompassing Type-Iii 5e-04
>pdb|2EDY|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 103 Back     alignment and structure

Iteration: 1

Score = 51.6 bits (122), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Query: 107 ITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAIT 166 + WDPP+ RNG+I+ Y V F + I++ + TT T+ + L+ Y +V+A T Sbjct: 27 LAWDPPVLAERNGRIISYTVVF-RDINSQQELQNITTDTRFTLTGLKPDTTYDIKVRAWT 85 Query: 167 KAGPGPWSPKL 177 G GP SP + Sbjct: 86 SKGSGPLSPSI 96
>pdb|3F7R|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 249 Back     alignment and structure
>pdb|3F7P|C Chain C, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 248 Back     alignment and structure
>pdb|3F7Q|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 234 Back     alignment and structure
>pdb|2DN7|A Chain A, Solution Structures Of The 6th Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 107 Back     alignment and structure
>pdb|1QG3|A Chain A, Crystal Structure Of A Tandem Pair Of Fibronectin Type Iii Domains From The Cytoplasmic Tail Of Integrin Alpha6 Beta4 Length = 195 Back     alignment and structure
>pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 Back     alignment and structure
>pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 Back     alignment and structure
>pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query427
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 7e-46
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 8e-36
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-12
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 5e-44
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 8e-35
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-26
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 7e-43
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-33
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 1e-26
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-10
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 4e-38
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 8e-31
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-30
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-30
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 8e-22
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 2e-37
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 1e-32
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 1e-27
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 3e-09
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 5e-36
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 9e-32
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 2e-18
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 8e-16
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 7e-35
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-27
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-20
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 8e-09
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-34
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 4e-19
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-09
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-34
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 4e-30
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 3e-16
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-07
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-33
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-32
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 3e-26
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-15
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 9e-31
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 5e-30
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 9e-22
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 8e-12
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 8e-11
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-30
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-29
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 6e-16
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 2e-29
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 6e-21
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-11
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 1e-27
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-12
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 4e-11
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 5e-27
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-16
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 5e-11
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-26
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 5e-19
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 1e-10
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 3e-09
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 2e-25
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 1e-13
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 2e-09
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 3e-25
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 6e-21
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 3e-10
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 1e-06
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 8e-24
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-20
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 5e-12
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 1e-23
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 1e-21
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 8e-14
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 3e-23
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 4e-18
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 7e-13
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-07
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 8e-23
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 6e-22
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 5e-13
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-07
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 1e-22
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 3e-19
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 1e-11
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 7e-22
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 4e-17
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 1e-09
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 1e-21
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 3e-15
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 3e-13
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 8e-05
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 5e-21
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 6e-18
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 3e-11
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 6e-21
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 2e-13
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 3e-07
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 1e-20
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 4e-14
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 1e-13
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-20
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 5e-17
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 5e-11
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 4e-20
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 2e-14
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 2e-12
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 7e-20
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 1e-14
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 2e-12
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 7e-20
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 2e-14
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 3e-13
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 1e-19
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 2e-16
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 7e-15
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 1e-06
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 4e-19
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-10
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 3e-09
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 5e-19
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 9e-18
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 2e-13
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 3e-05
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 9e-19
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 6e-16
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-10
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 3e-18
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-10
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 1e-07
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 7e-07
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 3e-18
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 7e-10
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 5e-07
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 1e-17
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 4e-12
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 2e-10
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 2e-17
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 4e-15
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 9e-09
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 3e-17
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 2e-14
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 5e-17
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 4e-16
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 2e-08
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 4e-05
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 2e-16
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 2e-16
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 2e-14
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 7e-04
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 3e-16
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 8e-16
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 5e-09
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 5e-16
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-13
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 2e-13
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 9e-16
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 1e-12
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 2e-10
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 1e-15
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 2e-08
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 2e-08
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 1e-15
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 3e-13
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 1e-15
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 6e-13
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 1e-12
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 2e-15
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 2e-10
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 5e-15
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 1e-12
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 1e-11
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 6e-15
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 1e-14
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 4e-13
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 8e-15
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 2e-14
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 3e-09
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-14
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 1e-13
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 1e-12
2gys_A419 Cytokine receptor common beta chain; dimer of inte 2e-14
2gys_A419 Cytokine receptor common beta chain; dimer of inte 6e-12
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 3e-14
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 2e-11
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 3e-14
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 7e-13
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 2e-11
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 2e-13
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 2e-05
1x4x_A106 Fibronectin type-III domain containing protein 3A; 2e-13
1x4x_A106 Fibronectin type-III domain containing protein 3A; 2e-12
1x4x_A106 Fibronectin type-III domain containing protein 3A; 6e-08
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 5e-13
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 4e-08
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 1e-05
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 6e-13
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 2e-08
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 1e-07
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 1e-12
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 3e-12
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 4e-04
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 1e-12
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 7e-11
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 2e-12
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 4e-12
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 6e-12
1x3d_A118 Fibronectin type-III domain containing protein 3A; 2e-12
1x3d_A118 Fibronectin type-III domain containing protein 3A; 1e-07
1x3d_A118 Fibronectin type-III domain containing protein 3A; 1e-05
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 8e-12
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 5e-11
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-07
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 1e-11
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 1e-06
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 1e-11
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 8e-06
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 3e-05
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 1e-11
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 7e-09
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 2e-05
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 2e-11
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 7e-08
1x5x_A109 Fibronectin type-III domain containing protein 3A; 3e-11
1x5x_A109 Fibronectin type-III domain containing protein 3A; 2e-09
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 3e-11
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 5e-06
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 3e-11
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 5e-04
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 5e-11
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 1e-06
2crz_A110 Fibronectin type-III domain containing protein 3A; 6e-11
2crz_A110 Fibronectin type-III domain containing protein 3A; 5e-10
3t04_D103 Monobody 7C12; engineered binding protein, antibod 2e-10
3t04_D103 Monobody 7C12; engineered binding protein, antibod 2e-10
3t04_D103 Monobody 7C12; engineered binding protein, antibod 2e-09
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 2e-10
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 1e-07
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 5e-07
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 3e-10
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 3e-07
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 2e-06
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 4e-10
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 4e-08
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 2e-06
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 4e-10
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 4e-07
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 5e-10
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 9e-10
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 6e-06
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 5e-10
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 3e-09
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 5e-06
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 6e-10
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 6e-05
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 7e-10
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 1e-08
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 7e-10
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 2e-09
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 3e-04
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 9e-10
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 4e-08
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 1e-09
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 8e-09
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 1e-09
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-07
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 4e-07
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 1e-09
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-09
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-09
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 5e-06
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 3e-09
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 1e-07
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 3e-04
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 4e-09
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 6e-06
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 8e-06
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 4e-09
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 2e-04
2erj_C247 Cytokine receptor common gamma chain; immune syste 9e-09
2erj_C247 Cytokine receptor common gamma chain; immune syste 4e-08
3k2m_C101 Monobody HA4; engineered binding protein, antibody 1e-08
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-08
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-07
1eer_B227 Epobp, erythropoietin receptor; signal transductio 1e-08
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 1e-08
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 4e-05
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 6e-04
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 2e-08
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 4e-06
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 2e-05
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 2e-08
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 2e-05
2crm_A120 Fibronectin type-III domain containing protein 3A; 2e-08
2crm_A120 Fibronectin type-III domain containing protein 3A; 9e-08
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 4e-08
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 2e-06
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 4e-08
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 4e-08
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 7e-08
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 1e-05
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 7e-04
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-07
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 9e-05
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-04
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 3e-07
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 2e-05
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 3e-07
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 4e-07
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 2e-06
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 5e-07
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 5e-06
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 1e-04
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 5e-07
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 7e-07
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 1e-06
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 1e-06
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 4e-06
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 1e-06
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 2e-06
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 1e-06
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 2e-06
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-06
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-06
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 8e-04
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 2e-06
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 4e-06
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 3e-06
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 3e-06
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 3e-05
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 3e-06
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 8e-06
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 6e-05
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 4e-06
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 4e-04
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 5e-06
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 6e-06
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 6e-06
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 1e-04
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 2e-04
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 2e-04
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
 Score =  168 bits (425), Expect = 7e-46
 Identities = 50/384 (13%), Positives = 105/384 (27%), Gaps = 47/384 (12%)

Query: 9   TIELVWSQPTQT-YGEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAG 67
            + +  +  +    G I+   V+Y         +     + S+ I +L+   EYE  +  
Sbjct: 277 YLWIQLNANSINGDGPIVAREVEYC-TASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLL 335

Query: 68  QNHIGYGQ----ETVRYYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNGQIVL 123
                 G       +R  T    P    P  +         + I W+P            
Sbjct: 336 TRPGEGGTGSPGPALRTRTKCADPM-RGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYN 394

Query: 124 YNVKFHKKIDANN------VIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKL 177
             V +  ++                +  +   +NL      S ++  +   G    S +L
Sbjct: 395 LTVHYCYQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKE-SQEL 453

Query: 178 SLMTARDM-VRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQ 236
            + T  D+    P      +T ++ + + W+      G I  Y+I Y   +  D +    
Sbjct: 454 IVQTDEDLPGAVPTESIQGSTFEEKIFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLS 513

Query: 237 KSIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNG 296
                                          +          L   T Y+  + A T  G
Sbjct: 514 NQ-----------------------SGRVSKLGNETHFLFFGLYPGTTYSFTIRASTAKG 550

Query: 297 LGRLSGK--VTVKVKPEDVPLSLRAH-DVSTHSMTLSWSPPIKLNP------VKYKEVSE 347
            G  +     T    P      L    + + +++T+   P            +  +E   
Sbjct: 551 FGPPATNQFTTKISAPSMPAYELETPLNQTDNTVTVMLKPAHSRGAPVSVYQIVVEEERP 610

Query: 348 KIQERRLQKYGQYRYFETRDESYI 371
           +  ++  +    Y        + +
Sbjct: 611 RRTKKTTEILKCYPVPIHFQNASL 634


>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query427
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 100.0
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 100.0
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 100.0
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 100.0
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 100.0
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 100.0
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 100.0
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 100.0
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 100.0
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 100.0
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 100.0
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.98
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.98
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.97
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.97
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.97
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.97
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.96
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.95
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.95
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 99.95
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.94
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.94
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.94
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.93
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.93
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.93
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.93
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.92
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.92
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.92
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.92
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.91
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.9
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.9
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.9
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.9
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.9
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.9
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.9
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.89
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.89
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.89
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.88
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.88
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.88
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.87
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.87
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.87
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.86
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.86
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.85
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.84
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.84
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.84
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.83
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.82
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.82
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.81
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.79
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.78
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.77
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.77
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.76
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.73
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.73
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.73
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.73
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.71
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.71
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.7
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.7
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.7
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.69
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.69
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.68
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.68
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.68
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.66
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.65
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.65
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.64
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.64
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.63
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.63
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.63
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.62
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.62
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.62
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.61
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.61
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.61
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.61
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.6
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.6
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.6
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.6
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.6
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.59
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.59
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.59
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.58
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.58
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.57
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.57
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.57
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.57
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.57
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.57
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.57
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.56
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.56
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.56
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.56
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.56
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.56
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.55
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.55
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.54
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.54
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.54
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.54
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.53
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.53
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.53
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.53
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.53
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.53
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.53
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.53
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.52
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.52
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.52
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.52
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.52
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.52
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.52
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.51
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.5
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.5
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.5
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.5
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.49
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.49
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.49
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.49
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.49
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.49
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.49
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.48
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.48
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.48
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.47
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.47
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.47
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.47
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.47
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.46
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.46
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.46
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.46
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.46
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.45
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.45
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.44
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.44
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.44
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.44
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.43
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.43
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.43
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.43
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.43
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.42
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.42
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.42
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.42
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.41
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.41
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.41
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.41
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.4
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.4
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.4
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.39
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.38
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 99.38
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.37
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.37
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 99.37
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.37
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.36
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.36
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 99.36
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 99.36
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.35
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.35
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.35
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 99.35
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.35
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 99.34
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.34
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.34
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.33
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.32
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.32
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 99.31
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.3
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.3
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.29
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.28
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 99.28
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.28
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.28
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.27
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 99.26
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 99.26
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.26
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 99.26
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.25
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.25
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.25
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.24
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.23
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 99.23
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.2
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 99.19
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 99.19
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 99.19
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 99.18
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 99.18
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 99.18
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 99.17
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.17
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.17
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.17
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 99.15
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 99.15
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 99.14
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.14
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 99.12
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.1
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 99.1
2erj_C247 Cytokine receptor common gamma chain; immune syste 99.09
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 99.09
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 99.09
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 99.07
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 99.06
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.01
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 99.0
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.0
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 99.0
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 99.0
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 98.99
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 98.98
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 98.98
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.95
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 98.95
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.92
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 98.9
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 98.89
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 98.88
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 98.81
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 98.79
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.77
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 98.76
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.73
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 98.68
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.68
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 98.57
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.56
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 98.55
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 98.54
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.52
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 98.51
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.47
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 98.44
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.38
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.38
1oww_A98 FN, fibronectin first type III module, CIG; fibron 98.21
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 98.18
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 98.13
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 97.59
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 97.22
3b4n_A 344 Endo-pectate lyase; pectin, galacturonic acid, rig 97.21
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 97.21
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 97.13
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 96.9
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 96.79
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 96.62
3b4n_A344 Endo-pectate lyase; pectin, galacturonic acid, rig 96.34
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 96.15
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 95.46
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 94.82
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 94.36
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 93.34
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 92.55
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 91.34
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 89.22
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 88.07
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 87.46
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 86.93
2w91_A653 Endo-beta-N-acetylglucosaminidase D; hydrolase, N- 86.79
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 86.77
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 86.67
2w91_A653 Endo-beta-N-acetylglucosaminidase D; hydrolase, N- 85.65
1edq_A540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 84.32
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 83.19
1edq_A 540 Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 82.11
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 81.02
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 80.11
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
Probab=100.00  E-value=1.6e-37  Score=294.08  Aligned_cols=340  Identities=17%  Similarity=0.220  Sum_probs=260.7

Q ss_pred             Cccce-EEEEEeeCCCCCCCcceEeEEEEEEecCc---cceeEeecCcceEEEcCCCCCceEEEEEEEEeccCcCcccce
Q psy8774           4 EEPEV-TIELVWSQPTQTYGEILGYRVKYGVREHT---LKENLVNSKNMSFLITNLERGVEYEFRIAGQNHIGYGQETVR   79 (427)
Q Consensus         4 ~~~~~-sv~l~W~~p~~~~~~i~~Y~v~~~~~~~~---~~~~~~~~~~~~~~~~~L~p~t~Y~~~V~a~~~~g~~~~~~~   79 (427)
                      ..+++ +|.|+|+++.  .+.+.+|+|+|+..++.   .+........+++.+.+|.|++.|.|+|+|.+..|.+.....
T Consensus        13 ~~~~~~sv~l~W~~~~--~~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~a~~~~g~s~~~~~   90 (375)
T 3t1w_A           13 ANPDTGVLTVSWERST--TPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISD   90 (375)
T ss_dssp             EETTTTEEEEEEECCS--CSSCCEEEEEEEETTCTTSCCEEEEEETTCCEEEECCCCTTCCEEEEEEEEETTEECCCEEE
T ss_pred             ecCCCeEEEEEEeCCC--CCCeeeEEEEEEECCCCCCcceeEEcCCCccEEEEcCCcCCCEEEEEEEEEcCCCCCCcEEe
Confidence            45667 9999999986  35789999999986543   233333677899999999999999999999998887765443


Q ss_pred             EEeCCCCCCCCCCeeeEEEeecCCEEEEEeeCCCCCCCCcceeEEEEEEEEccCCCceEE--EeeeeeEEEEccCCCCcE
Q psy8774          80 YYTTPEGPPTGPPANISHHFQTPDVVCITWDPPLRTHRNGQIVLYNVKFHKKIDANNVIH--RNTTQTKAVFSNLEEGIE  157 (427)
Q Consensus        80 ~~~t~~~~p~~~p~~~~~~~~~~~~v~v~W~~p~~~~~~~~i~~Y~v~~~~~~~~~~~~~--~~~~~~~~~i~~L~p~t~  157 (427)
                      .  +....|  +|.++.+...+.+++.|+|+++.    ++.+.+|.|+|+..+.......  .....+++.|.+|.|++.
T Consensus        91 ~--~~~~~p--~p~~l~~~~~~~~si~l~W~~~~----~~~i~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~  162 (375)
T 3t1w_A           91 T--IIPEVP--QLTDLSFVDITDSSIGLRWTPLN----SSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGID  162 (375)
T ss_dssp             E--ECCCCC--CCSCCEEECCCSSEEEEECCCCC----CTTEEEEEEEEEESSSCCSCEEEEECTTCCEEEEECCCTTCE
T ss_pred             e--EcCCCC--CCceEEEEecCCCeEEEEEECCC----CCCceEEEEEEEECCCCCceeEEEcCCCcceEEEeCCCCCCE
Confidence            3  333444  37899999999999999999873    3689999999998744333332  334588999999999999


Q ss_pred             EEEEEEEeeCCCCCCCCCCeEEEcccccCCCCCceEEEeeeCcEEEEEeeeCCCCCCceeEEEEEEEecccccccccccc
Q psy8774         158 YSAEVQAITKAGPGPWSPKLSLMTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQK  237 (427)
Q Consensus       158 Y~~~V~a~~~~g~~~~s~~~~~~t~~~~p~~p~~l~~~~~~~~si~v~W~~p~~~~g~i~~Y~I~~~~~~~~~~~~~~~~  237 (427)
                      |.|+|+|.|..|.|..+. ..+.+   .+.+|.++.+...+.+++.|+|++|.  ++.+.+|.|+|+..+...  .+.  
T Consensus       163 Y~~~V~a~~~~g~s~~s~-~~~~t---~~~~p~~l~~~~~~~~si~l~W~~p~--~~~i~~Y~v~~~~~~~~~--~~~--  232 (375)
T 3t1w_A          163 YDISVITLINGGESAPTT-LTQQT---AVPPPTDLRFTNIGPDTMRVTWAPPP--SIDLTNFLVRYSPVKNEE--DVA--  232 (375)
T ss_dssp             EEEEEEEEETTEECCCEE-EEEEC---CCCCCEEEEEESCCSSCEEEEEECCS--SCCCCEEEEEEEEGGGTT--CCE--
T ss_pred             EEEEEEEEeCCcccCCee-eeeec---CCCCCceeEEEecccCEEEEEEcCCC--CCCccEEEEEEEeCCCCC--CcE--
Confidence            999999999999886554 34444   34588999999999999999999975  467999999999863221  110  


Q ss_pred             cccccccccceeEEeeeccccccccccccccCCCCceeccCCCCCCeEEEEEEEEeccCCCCCccceEEeecCCCCCcce
Q psy8774         238 SIPLTESSNIARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKVKPEDVPLSL  317 (427)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~p~t~Y~~~V~a~~~~G~g~~s~~~~~~t~~~~~P~~l  317 (427)
                                                ........++++|.+|.|++.|.|+|+|++..|.|..+. ..+.| ++.+|.++
T Consensus       233 --------------------------~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~~~~g~s~~~~-~~~~t-~p~~P~~l  284 (375)
T 3t1w_A          233 --------------------------ELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLR-GRQKT-GLDSPTGI  284 (375)
T ss_dssp             --------------------------EEEECTTCCEEEECSCCTTCEEEEEEEEEETTEECCCEE-EEEEC-CCCCCEEE
T ss_pred             --------------------------EEEcCCCcCEEEeCCCCCCCEEEEEEEEEcCCCcCCcee-eEEec-CCCCCCcc
Confidence                                      122334568999999999999999999999998887664 44555 55688899


Q ss_pred             EEeecCCCeEEEEecCCCcCCCceEEEEEeheee-c---ceeeeeeEEEEeecccccccceEEEEEeecccCCCCcchh
Q psy8774         318 RAHDVSTHSMTLSWSPPIKLNPVKYKEVSEKIQE-R---RLQKYGQYRYFETRDESYIGKRVERMEVRGRKGRGRPKKR  392 (427)
Q Consensus       318 ~~~~~~~~~v~l~W~~P~~~~g~~Y~i~~~~~~~-~---~l~~~t~y~~~~~~~~~~~~~~~~~v~a~~~~g~g~p~~~  392 (427)
                      ++...+.+++.|+|++|. ....+|.|.+..... .   .......-..+....|.+...|.|+|+|.+..|.|+|...
T Consensus       285 ~~~~~~~~sv~l~W~~p~-~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~~~~G~s~p~s~  362 (375)
T 3t1w_A          285 DFSDITANSFTVHWIAPR-ATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIG  362 (375)
T ss_dssp             EEESCCSSCEEEEEECCS-SCCSEEEEEEEETTCCSSCEEEEEETTCCEEEECSCCTTCEEEEEEEEEETTEECCCEEE
T ss_pred             EeeeccCCEEEEEECCCC-cceeeEEEEEEECCCCCcceeEEcCCCccEEEECCCCCCCEEEEEEEEECCCCCCCceee
Confidence            998889999999999985 344599998864332 1   1111111223467889999999999999999999999763



>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 427
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 5e-17
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 1e-11
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 6e-05
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 0.002
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 6e-17
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 2e-06
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 3e-06
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 4e-16
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 2e-07
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 3e-04
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 2e-14
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 1e-07
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 4e-06
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 3e-14
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 3e-08
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-06
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 5e-14
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 8e-09
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 6e-07
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 3e-13
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 1e-06
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 5e-05
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 9e-13
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 5e-07
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 5e-05
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 1e-11
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 2e-11
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 3e-06
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 4e-06
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 3e-11
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 7e-07
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 3e-04
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 3e-11
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 3e-06
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 1e-10
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 1e-07
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 0.003
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 7e-10
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 9e-10
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 2e-06
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 1e-05
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 9e-10
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 1e-04
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 1e-09
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 3e-07
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 1e-09
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 0.001
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 2e-09
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 3e-09
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 1e-07
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 4e-09
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 1e-08
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 0.001
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 1e-08
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 6e-08
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 5e-07
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 1e-08
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 1e-08
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 2e-05
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 2e-08
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 3e-04
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 2e-08
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 4e-04
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 3e-08
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 4e-04
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 0.002
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 6e-08
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 7e-08
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 8e-08
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 1e-07
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 1e-04
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 2e-07
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 2e-07
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-07
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-06
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 2e-07
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 2e-04
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 5e-07
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 5e-07
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 2e-04
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 6e-07
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 3e-06
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 0.001
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 7e-07
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 0.002
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 8e-07
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 1e-06
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 1e-04
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 1e-06
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 1e-06
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 4e-04
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 2e-06
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 2e-06
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 3e-04
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 3e-06
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 2e-05
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 5e-06
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 6e-06
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 7e-06
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 9e-06
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 0.001
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 1e-05
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 2e-05
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 1e-05
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.003
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 2e-05
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 3e-05
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-05
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-04
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 3e-05
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 0.001
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 5e-05
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 5e-05
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 5e-05
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 0.004
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 5e-05
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 5e-05
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 5e-05
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 0.002
d1axib2106 b.1.2.1 (B:131-236) Growth hormone receptor {Human 8e-05
d1fyhb198 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha 1e-04
d1v5ja_108 b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId 2e-04
d1x5ia1113 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ 2e-04
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 2e-04
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 9e-04
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 3e-04
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 4e-04
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 4e-04
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 7e-04
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 7e-04
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 0.001
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 8e-04
d3d85d394 b.1.2.1 (D:212-305) The p40 domain of interleukin- 8e-04
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 0.001
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 0.002
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 0.002
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 0.004
d2fnba_95 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.004
d1y6kr199 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 0.004
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Insulin receptor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 76.8 bits (187), Expect = 5e-17
 Identities = 29/184 (15%), Positives = 49/184 (26%), Gaps = 13/184 (7%)

Query: 9   TIELVWSQPTQTYGEILGYRVKYGVREHTLKENLVNSKNMSFLITNLERGVEYEFRIAGQ 68
            I L W  P+   G I  Y V +        E+    +    L         +      +
Sbjct: 18  QIILKWKPPSDPNGNITHYLVFW----ERQAEDSELFELDYCLKGLKLPSRTWSPPFESE 73

Query: 69  NHIGYGQ--ETVRYYTTPEGPPTGP-----PANISHHFQTPDVVCITWDPPLRTHRNGQI 121
           +   + Q             P T           S      D +      P       + 
Sbjct: 74  DSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVP--RPSRKRR 131

Query: 122 VLYNVKFHKKIDANNVIHRNTTQTKAVFSNLEEGIEYSAEVQAITKAGPGPWSPKLSLMT 181
            L +V      + +    +   +   V S L     Y  E+QA  +  P       + ++
Sbjct: 132 SLGDVGNAGNNEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVS 191

Query: 182 ARDM 185
           AR M
Sbjct: 192 ARTM 195


>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query427
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.6
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.58
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.57
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.56
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.55
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.55
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.55
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.54
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.54
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.53
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.52
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.52
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.52
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.51
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.5
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.5
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.5
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.5
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.49
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.49
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.49
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.49
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.48
d2crza197 Fibronectin type-III domain containing protein 3a, 99.48
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.48
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.48
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.47
d2crza197 Fibronectin type-III domain containing protein 3a, 99.47
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.47
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.47
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.46
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.46
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.46
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.46
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.46
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.45
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.45
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.45
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.45
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.45
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.45
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.44
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.44
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.44
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.44
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.44
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.43
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.43
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.42
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.42
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.42
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.41
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.39
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.39
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.38
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.37
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.37
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.37
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.36
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.36
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.35
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.35
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.35
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.35
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.34
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.34
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.34
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.34
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.34
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.34
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.34
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.33
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.33
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.33
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.33
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.33
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.33
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.32
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.31
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.31
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.31
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.31
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.31
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.31
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.31
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.3
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.3
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.29
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.29
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.29
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.29
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.28
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.28
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.28
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.28
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.28
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.28
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.28
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.27
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.27
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.27
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.26
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.26
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.26
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.25
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.24
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.24
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.23
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.23
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.23
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.23
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.23
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.23
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.23
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.22
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.22
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.22
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.21
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.21
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.21
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.2
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.19
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.19
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.19
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.19
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.17
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.16
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.15
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.14
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.07
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.07
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 99.06
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 99.05
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.05
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 99.04
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.99
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.93
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.91
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.87
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.83
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.78
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.71
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.62
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.6
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.4
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.41
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.21
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 97.12
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 96.79
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 96.61
d2hfta1106 Extracellular region of human tissue factor {Human 96.55
d1a21a1103 Extracellular region of human tissue factor {Rabbi 96.45
d2c4fu1116 Extracellular region of human tissue factor {Human 96.15
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 96.07
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 96.02
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 95.67
d2c4fu1116 Extracellular region of human tissue factor {Human 95.36
d2hfta1106 Extracellular region of human tissue factor {Human 94.15
d1a21a1103 Extracellular region of human tissue factor {Rabbi 93.96
d2gysa399 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 83.96
d1edqa1109 Chitinase A, N-terminal domain N {Serratia marcesc 82.6
d1axib199 Growth hormone receptor {Human (Homo sapiens) [Tax 82.21
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Sidekick 2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68  E-value=8.7e-17  Score=122.88  Aligned_cols=112  Identities=24%  Similarity=0.335  Sum_probs=91.7

Q ss_pred             CCCCCC-CCCeEEEcccccCCCCCceEEEeeeCcEEEEEeeeCCCCCCceeEEEEEEEeccccccccccccccccccccc
Q psy8774         168 AGPGPW-SPKLSLMTARDMVRAPLGVKALATSDQSVEVWWKPVPAGRGKILGYQIFYTMTAVEDLDEWSQKSIPLTESSN  246 (427)
Q Consensus       168 ~g~~~~-s~~~~~~t~~~~p~~p~~l~~~~~~~~si~v~W~~p~~~~g~i~~Y~I~~~~~~~~~~~~~~~~~~~~~~~~~  246 (427)
                      .|.|.+ +..+.++|..++|.+|.++.+...+.+++.|+|++|...+|.+.+|.|+|+..........            
T Consensus         2 ~G~G~pss~~v~~~T~~~~P~~P~~~~~~~~~~~sv~v~W~~P~~~~g~i~~Y~i~y~~~~~~~~~~~------------   69 (117)
T d1wfoa1           2 IGDGSPSHPPILERTLDDVPGPPMGILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLNTTTANTAT------------   69 (117)
T ss_dssp             CCCCCCCCCCSCCCCSCCCCCCCCCCEEEEECSSEEEEECCCCSCCCSCCCEEEEEEEESSCCCSCCC------------
T ss_pred             ccCCCCCCCCEEEECCCCCCcCCCCcEEEEecCCEEEEEEECCCCCCCceEEEeeeeeeccCCCceEe------------
Confidence            467755 4567888888889999999999999999999999998788899999999987643221111            


Q ss_pred             ceeEEeeeccccccccccccccCCCCceeccCCCCCCeEEEEEEEEeccCCCCCccceEEee
Q psy8774         247 IARIFYTMTAVEDLDEWSQKSVPLTESAELTSLEKFTEYAVAVAARTVNGLGRLSGKVTVKV  308 (427)
Q Consensus       247 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~p~t~Y~~~V~a~~~~G~g~~s~~~~~~t  308 (427)
                                       ........++++|.+|+|++.|.|+|+|+|..|.|++|..+.++|
T Consensus        70 -----------------~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~n~~G~g~~S~~~~~tT  114 (117)
T d1wfoa1          70 -----------------VEVLAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTT  114 (117)
T ss_dssp             -----------------EEEECTTCCEEEEESCCSSSEEEEEEEEECSSCEEEEEEEEEECC
T ss_pred             -----------------EEecCCceEEEEECCCCCCCEEEEEEEEECCCcCCCCcCCEEEEC
Confidence                             223345677899999999999999999999999999998877776



>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2gysa3 b.1.2.1 (A:218-316) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edqa1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure