Psyllid ID: psy8797


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MKGTIRIRLKLKFHSNMVKRRLNLDQDDEESPFKTPKSVKKMRVNPPTTPAKEKGTRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILEKKSKNNIQCKR
ccccHHHHccccccccccHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEHHHHHHHHccccEEEEEHHHHHcccccEEEcccccccccc
cccEEEEEEEccccccHcEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcc
MKGTIRIRLKLKFHSNMVKRRlnldqddeespfktpksvkkmrvnppttpakekgtrydtsLGLLTKKFVKLLqsspqgvvdlnvasesldvqkRRIYDITNVLEGIGILEkksknniqckr
mkgtirirlklkfhsnmvkrrlnldqddeespfktpksvkkmrvnppttpakekgtrydtSLGLLTKKFVKLLqsspqgvvdlnvasesldvqkrrIYDITNVlegigilekksknniqckr
MKGTIRIRLKLKFHSNMVKRRLNLDQDDEESPFKTPKSVKKMRVNPPTTPAKEKGTRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILEKKSKNNIQCKR
*******RLKLK***********************************************TSLGLLTKKFVKLLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILE***********
***************************************************************LLTKKFVKLLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILEKKSKN*IQCK*
MKGTIRIRLKLKFHSNMVKRRLNLDQDDEESPFKTPKSVKKMRVNPPTTPAKEKGTRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILEKKSKNNIQCKR
*KGTIRIRLKLKFHSNMVKRRLNLD******************************TRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILEKKSKN***C**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGTIRIRLKLKFHSNMVKRRLNLDQDDEESPFKTPKSVKKMRVNPPTTPAKEKGTRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILEKKSKNNIQCKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query122 2.2.26 [Sep-21-2011]
O00716 465 Transcription factor E2F3 yes N/A 0.836 0.219 0.559 5e-24
O35261 457 Transcription factor E2F3 yes N/A 0.827 0.221 0.564 6e-24
P56931 443 Transcription factor E2F2 no N/A 0.696 0.191 0.673 5e-23
Q14209 437 Transcription factor E2F2 no N/A 0.696 0.194 0.663 2e-22
Q90977 403 Transcription factor E2F1 no N/A 0.819 0.248 0.567 4e-22
Q27368 805 Transcription factor E2f yes N/A 0.516 0.078 0.841 4e-21
Q9FV71 469 Transcription factor E2FB yes N/A 0.581 0.151 0.619 2e-19
Q9FV70 396 Transcription factor E2FC no N/A 0.532 0.164 0.676 3e-19
Q61501 430 Transcription factor E2F1 no N/A 0.778 0.220 0.522 3e-19
Q01094 437 Transcription factor E2F1 no N/A 0.819 0.228 0.528 1e-18
>sp|O00716|E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens GN=E2F3 PE=1 SV=1 Back     alignment and function desciption
 Score =  109 bits (273), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/109 (55%), Positives = 74/109 (67%), Gaps = 7/109 (6%)

Query: 18  VKRRLNLDQDDEE---SPFKTPKSVKKMRVNPPTTPAKEKG----TRYDTSLGLLTKKFV 70
            KRRL L +   +      KTPK   +  +  P +P   K     TRYDTSLGLLTKKF+
Sbjct: 132 AKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFI 191

Query: 71  KLLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILEKKSKNNIQ 119
           +LL  SP GV+DLN A+E L VQKRRIYDITNVLEGI +++KKSKNN+Q
Sbjct: 192 QLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQ 240




Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F-3 binds specifically to RB1 protein, in a cell-cycle dependent manner.
Homo sapiens (taxid: 9606)
>sp|O35261|E2F3_MOUSE Transcription factor E2F3 OS=Mus musculus GN=E2f3 PE=1 SV=2 Back     alignment and function description
>sp|P56931|E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus GN=E2f2 PE=1 SV=2 Back     alignment and function description
>sp|Q14209|E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens GN=E2F2 PE=1 SV=1 Back     alignment and function description
>sp|Q90977|E2F1_CHICK Transcription factor E2F1 OS=Gallus gallus GN=E2F1 PE=2 SV=1 Back     alignment and function description
>sp|Q27368|E2F_DROME Transcription factor E2f OS=Drosophila melanogaster GN=E2f PE=1 SV=2 Back     alignment and function description
>sp|Q9FV71|E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana GN=E2FB PE=1 SV=1 Back     alignment and function description
>sp|Q9FV70|E2FC_ARATH Transcription factor E2FC OS=Arabidopsis thaliana GN=E2FC PE=1 SV=1 Back     alignment and function description
>sp|Q61501|E2F1_MOUSE Transcription factor E2F1 OS=Mus musculus GN=E2f1 PE=1 SV=1 Back     alignment and function description
>sp|Q01094|E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens GN=E2F1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
156546407 447 PREDICTED: transcription factor E2F3-lik 0.844 0.230 0.657 1e-26
193673908 422 PREDICTED: transcription factor E2F2-lik 0.877 0.253 0.595 4e-26
328708308 394 PREDICTED: transcription factor E2F2-lik 0.877 0.271 0.603 4e-26
332016563 446 Transcription factor E2F3 [Acromyrmex ec 0.852 0.233 0.619 4e-26
357608368 381 E2F1 [Danaus plexippus] 0.877 0.280 0.578 5e-26
340719191 416 PREDICTED: transcription factor E2F3-lik 0.844 0.247 0.640 8e-26
350399050 416 PREDICTED: transcription factor E2F3-lik 0.844 0.247 0.640 9e-26
189242505 485 PREDICTED: similar to E2F transcription 0.811 0.204 0.623 9e-26
340719189 450 PREDICTED: transcription factor E2F3-lik 0.844 0.228 0.640 9e-26
350538465 456 E2F transcription factor 1 [Bombyx mori] 0.877 0.234 0.570 1e-25
>gi|156546407|ref|XP_001607080.1| PREDICTED: transcription factor E2F3-like isoform 1 [Nasonia vitripennis] gi|345498319|ref|XP_003428202.1| PREDICTED: transcription factor E2F3-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 73/111 (65%), Positives = 81/111 (72%), Gaps = 8/111 (7%)

Query: 18  VKRRLNLDQDDEESPFKTPKSVKKMRVNPPT----TPAKEKG---TRYDTSLGLLTKKFV 70
           VKRRLNL+    +S FK PK  K+ R    +    TP K K    TRYDTSL LLTKKF+
Sbjct: 87  VKRRLNLEVGPSQSTFKAPKG-KRRRSGSSSLTGHTPTKSKTVERTRYDTSLSLLTKKFI 145

Query: 71  KLLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILEKKSKNNIQCK 121
            L++ S  GVVDLNVASE L+VQKRRIYDITNVLEGIGILEKKSKNNIQ K
Sbjct: 146 NLVEDSNDGVVDLNVASEKLEVQKRRIYDITNVLEGIGILEKKSKNNIQWK 196




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193673908|ref|XP_001945228.1| PREDICTED: transcription factor E2F2-like isoform 1 [Acyrthosiphon pisum] gi|328708305|ref|XP_003243650.1| PREDICTED: transcription factor E2F2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328708308|ref|XP_003243651.1| PREDICTED: transcription factor E2F2-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332016563|gb|EGI57444.1| Transcription factor E2F3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357608368|gb|EHJ65959.1| E2F1 [Danaus plexippus] Back     alignment and taxonomy information
>gi|340719191|ref|XP_003398040.1| PREDICTED: transcription factor E2F3-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350399050|ref|XP_003485399.1| PREDICTED: transcription factor E2F3-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|189242505|ref|XP_968025.2| PREDICTED: similar to E2F transcription factor 2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340719189|ref|XP_003398039.1| PREDICTED: transcription factor E2F3-like isoform 1 [Bombus terrestris] gi|350399047|ref|XP_003485398.1| PREDICTED: transcription factor E2F3-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350538465|ref|NP_001233214.1| E2F transcription factor 1 [Bombyx mori] gi|341865523|dbj|BAG85354.2| E2F1 [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
UNIPROTKB|J9P6U4 334 E2F3 "Uncharacterized protein" 0.827 0.302 0.564 1.6e-24
RGD|1561600245 E2f3 "E2F transcription factor 0.827 0.412 0.564 1.6e-24
UNIPROTKB|F1NR90 342 E2F3 "Uncharacterized protein" 0.827 0.295 0.574 2e-24
UNIPROTKB|F1P324 348 E2F3 "Uncharacterized protein" 0.827 0.290 0.574 2e-24
UNIPROTKB|F1MYH2 463 E2F3 "Uncharacterized protein" 0.827 0.218 0.564 2.3e-24
UNIPROTKB|F1RUH1 358 E2F3 "Uncharacterized protein" 0.778 0.265 0.615 3.3e-24
MGI|MGI:1096340 457 E2f3 "E2F transcription factor 0.827 0.221 0.564 3.6e-24
UNIPROTKB|O00716 465 E2F3 "Transcription factor E2F 0.827 0.217 0.564 4e-24
UNIPROTKB|E1BD75 365 E2F2 "Uncharacterized protein" 0.852 0.284 0.601 6.8e-24
MGI|MGI:1096341 443 E2f2 "E2F transcription factor 0.811 0.223 0.629 8.5e-24
UNIPROTKB|J9P6U4 E2F3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 280 (103.6 bits), Expect = 1.6e-24, P = 1.6e-24
 Identities = 61/108 (56%), Positives = 74/108 (68%)

Query:    19 KRRLNLDQDDEE---SPFKTPKSVKKMRVNPPTTPAKEKG----TRYDTSLGLLTKKFVK 71
             KRRL L +   +      KTPK   +  +  P +P   K     TRYDTSLGLLTKKF++
Sbjct:     2 KRRLELGESGHQYLSDGLKTPKGKGRATLRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQ 61

Query:    72 LLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILEKKSKNNIQ 119
             LL  SP GV+DLN A+E L VQKRRIYDITNVLEGI +++KKSKNN+Q
Sbjct:    62 LLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQ 109




GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005667 "transcription factor complex" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
RGD|1561600 E2f3 "E2F transcription factor 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NR90 E2F3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P324 E2F3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYH2 E2F3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUH1 E2F3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1096340 E2f3 "E2F transcription factor 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O00716 E2F3 "Transcription factor E2F3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BD75 E2F2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1096341 E2f2 "E2F transcription factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O35261E2F3_MOUSENo assigned EC number0.56480.82780.2210yesN/A
Q27368E2F_DROMENo assigned EC number0.84120.51630.0782yesN/A
O00716E2F3_HUMANNo assigned EC number0.55960.83600.2193yesN/A
Q9FV71E2FB_ARATHNo assigned EC number0.61970.58190.1513yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
pfam0231967 pfam02319, E2F_TDP, E2F/DP family winged-helix DNA 3e-28
>gnl|CDD|202203 pfam02319, E2F_TDP, E2F/DP family winged-helix DNA-binding domain Back     alignment and domain information
 Score = 97.6 bits (244), Expect = 3e-28
 Identities = 44/66 (66%), Positives = 54/66 (81%), Gaps = 1/66 (1%)

Query: 57  RYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDV-QKRRIYDITNVLEGIGILEKKSK 115
           R + SLGLLT+KF+KL + SP G+ DLN A++ LDV QKRRIYDITNVLEGIG++EKKSK
Sbjct: 1   RKEKSLGLLTQKFLKLCEKSPDGITDLNEAAKELDVKQKRRIYDITNVLEGIGLIEKKSK 60

Query: 116 NNIQCK 121
           N I+  
Sbjct: 61  NEIRWI 66


This family contains the transcription factor E2F and its dimerisation partners TDP1 and TDP2, which stimulate E2F-dependent transcription. E2F binds to DNA as a homodimer or as a heterodimer in association with TDP1/2, the heterodimer having increased binding efficiency. The crystal structure of an E2F4-DP2-DNA complex shows that the DNA-binding domains of the E2F and DP proteins both have a fold related to the winged-helix DNA-binding motif. Recognition of the central c/gGCGCg/c sequence of the consensus DNA-binding site is symmetric, and amino acids that contact these bases are conserved among all known E2F and DP proteins. Length = 67

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
KOG2577|consensus 354 99.97
PF0231971 E2F_TDP: E2F/DP family winged-helix DNA-binding do 99.94
KOG2578|consensus 388 99.86
KOG2578|consensus 388 99.63
KOG2829|consensus 326 98.24
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 96.83
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 96.14
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 95.94
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 95.77
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 95.66
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 95.24
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 95.21
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 94.77
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 94.67
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 94.29
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 94.22
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator, 94.01
PF1373055 HTH_36: Helix-turn-helix domain 93.11
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 92.69
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 92.52
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 92.3
PF0907985 Cdc6_C: CDC6, C terminal ; InterPro: IPR015163 The 92.25
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 92.04
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 91.92
cd0876887 Cdc6_C Winged-helix domain of essential DNA replic 91.84
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 91.14
TIGR00738132 rrf2_super rrf2 family protein (putative transcrip 90.34
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 89.53
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 88.97
COG3355126 Predicted transcriptional regulator [Transcription 88.94
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 88.68
PRK10163 271 DNA-binding transcriptional repressor AllR; Provis 88.45
PF0418275 B-block_TFIIIC: B-block binding subunit of TFIIIC; 88.1
PRK09834 263 DNA-binding transcriptional activator MhpR; Provis 87.15
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 86.95
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 86.94
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 86.77
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 86.33
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 86.23
COG1378 247 Predicted transcriptional regulators [Transcriptio 86.18
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 86.13
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 85.78
TIGR02716 306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 85.51
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 84.69
TIGR02010135 IscR iron-sulfur cluster assembly transcription fa 84.03
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 83.94
COG2739105 Uncharacterized protein conserved in bacteria [Fun 83.89
TIGR0176449 excise DNA binding domain, excisionase family. An 83.85
PF1351852 HTH_28: Helix-turn-helix domain 83.73
PF0828059 HTH_Mga: M protein trans-acting positive regulator 83.25
PRK11511127 DNA-binding transcriptional activator MarA; Provis 82.95
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 82.78
PRK09954 362 putative kinase; Provisional 82.49
PRK10857164 DNA-binding transcriptional regulator IscR; Provis 82.26
TIGR02431 248 pcaR_pcaU beta-ketoadipate pathway transcriptional 82.11
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 82.01
PRK10219107 DNA-binding transcriptional regulator SoxS; Provis 82.0
COG1414 246 IclR Transcriptional regulator [Transcription] 80.96
PRK00215 205 LexA repressor; Validated 80.87
PRK15090 257 DNA-binding transcriptional regulator KdgR; Provis 80.38
>KOG2577|consensus Back     alignment and domain information
Probab=99.97  E-value=3.9e-32  Score=228.26  Aligned_cols=107  Identities=55%  Similarity=0.723  Sum_probs=88.6

Q ss_pred             hhhhhhcCCCCCCC-CC--CccCCCccccc--cCC-CCCCCCC-CCCCCCcCcHHHHHHHHHHHHhhCCCCcccHHHHHh
Q psy8797          16 NMVKRRLNLDQDDE-ES--PFKTPKSVKKM--RVN-PPTTPAK-EKGTRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASE   88 (122)
Q Consensus        16 ~~~~r~~~l~~~~~-~~--~~~tp~~~~~~--~~~-~~~~~k~-~~~~R~~kSLg~Lt~kFi~ll~~sp~~~idL~~aa~   88 (122)
                      .++|++..+++... ..  .+.+|.+.++.  +.+ ++..+++ +.+.|+++|||+||+|||.|++++|+|++|||.||+
T Consensus        20 ~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~s~~~~~R~d~SLglLTkKFv~Llq~s~dGvldLn~aA~   99 (354)
T KOG2577|consen   20 LPAKEDSRLEEMDPQSVESGLPSPISPGSRMDRKPDSSKSSSSPSESTRSDTSLGLLTKKFVDLLQESPDGVLDLNKAAE   99 (354)
T ss_pred             cchhhhhhhhcccccccccCCCCCCCCCcccccCCCCcccccCCCCcccchhhHHHHHHHHHHHHHhCCCceeeHHHHHH
Confidence            67888888877433 11  14444444433  333 4455555 788999999999999999999999999999999999


Q ss_pred             HhccchhhhhhHHHhhhhccceeeccCCceeecC
Q psy8797          89 SLDVQKRRIYDITNVLEGIGILEKKSKNNIQCKR  122 (122)
Q Consensus        89 ~L~v~kRRiYDI~NVLE~igLI~K~~Kn~~~W~G  122 (122)
                      .|+|+|||||||||||||||||+|++||+|+|+|
T Consensus       100 ~L~VqKRRIYDITNVLEGI~LIeKksKN~IqW~G  133 (354)
T KOG2577|consen  100 VLNVQKRRIYDITNVLEGIGLIEKKSKNNIQWIG  133 (354)
T ss_pred             Hhccccceeeehhhhhhcccceeeccccceeeec
Confidence            9999999999999999999999999999999998



>PF02319 E2F_TDP: E2F/DP family winged-helix DNA-binding domain; InterPro: IPR003316 The mammalian transcription factor E2F plays an important role in regulating the expression of genes that are required for passage through the cell cycle Back     alignment and domain information
>KOG2578|consensus Back     alignment and domain information
>KOG2578|consensus Back     alignment and domain information
>KOG2829|consensus Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PF09079 Cdc6_C: CDC6, C terminal ; InterPro: IPR015163 The C-terminal domain of CDC6 assumes a winged helix fold, with a five alpha-helical bundle (alpha15-alpha19) structure, backed on one side by three beta strands (beta6-beta8) Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>cd08768 Cdc6_C Winged-helix domain of essential DNA replication protein Cell division control protein (Cdc6), which mediates DNA binding Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>PF04182 B-block_TFIIIC: B-block binding subunit of TFIIIC; InterPro: IPR007309 Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>COG1378 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>COG2739 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01764 excise DNA binding domain, excisionase family Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PF08280 HTH_Mga: M protein trans-acting positive regulator (MGA) HTH domain; InterPro: IPR013199 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] Back     alignment and domain information
>PRK11511 DNA-binding transcriptional activator MarA; Provisional Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PRK10857 DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>PRK10219 DNA-binding transcriptional regulator SoxS; Provisional Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>PRK15090 DNA-binding transcriptional regulator KdgR; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
1cf7_A76 Structural Basis Of Dna Recognition By The Heterodi 3e-20
>pdb|1CF7|A Chain A, Structural Basis Of Dna Recognition By The Heterodimeric Cell Cycle Transcription Factor E2f-Dp Length = 76 Back     alignment and structure

Iteration: 1

Score = 93.6 bits (231), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 49/77 (63%), Positives = 61/77 (79%), Gaps = 6/77 (7%) Query: 46 PPTTPAKEKGTRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDV-QKRRIYDITNVL 104 PP TP +R++ SLGLLT KFV LLQ + GV+DL +A+++L V QKRRIYDITNVL Sbjct: 1 PPGTP-----SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVL 55 Query: 105 EGIGILEKKSKNNIQCK 121 EGIG++EKKSKN+IQ K Sbjct: 56 EGIGLIEKKSKNSIQWK 72

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
1cf7_A76 Protein (transcription factor E2F-4); E2F, winged- 2e-26
>1cf7_A Protein (transcription factor E2F-4); E2F, winged-helix, DNA-binding domain, cell cycle, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: a.4.5.17 Length = 76 Back     alignment and structure
 Score = 92.7 bits (230), Expect = 2e-26
 Identities = 49/77 (63%), Positives = 61/77 (79%), Gaps = 6/77 (7%)

Query: 46  PPTTPAKEKGTRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDV-QKRRIYDITNVL 104
           PP TP     +R++ SLGLLT KFV LLQ +  GV+DL +A+++L V QKRRIYDITNVL
Sbjct: 1   PPGTP-----SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVL 55

Query: 105 EGIGILEKKSKNNIQCK 121
           EGIG++EKKSKN+IQ K
Sbjct: 56  EGIGLIEKKSKNSIQWK 72


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
1cf7_A76 Protein (transcription factor E2F-4); E2F, winged- 99.97
1cf7_B95 Protein (transcription factor DP-2); E2F, winged-h 99.51
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 96.08
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 95.94
1qbj_A81 Protein (double-stranded RNA specific adenosine D 95.7
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 95.58
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 95.52
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 94.48
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 94.11
3r0a_A123 Putative transcriptional regulator; structural gen 93.53
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 93.4
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 93.32
1y0u_A96 Arsenical resistance operon repressor, putative; s 92.97
1sfx_A109 Conserved hypothetical protein AF2008; structural 92.97
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 92.9
2kko_A108 Possible transcriptional regulatory protein (possi 92.83
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 92.62
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 92.13
2oqg_A114 Possible transcriptional regulator, ARSR family P; 91.33
1ku9_A152 Hypothetical protein MJ223; putative transcription 90.94
3jth_A98 Transcription activator HLYU; transcription factor 90.81
2frh_A127 SARA, staphylococcal accessory regulator A; winged 90.81
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 90.62
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 90.47
3rkx_A 323 Biotin-[acetyl-COA-carboxylase] ligase; biotin pro 90.24
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 90.23
1j5y_A 187 Transcriptional regulator, biotin repressor famil; 90.2
2jt1_A77 PEFI protein; solution structure, winged helix-tur 90.02
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 89.98
3mq0_A 275 Transcriptional repressor of the blcabc operon; he 89.88
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 89.71
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 89.67
2pg4_A95 Uncharacterized protein; structural genomics, join 89.57
1ylf_A149 RRF2 family protein; structural genomics, transcri 89.56
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 89.41
3mkl_A120 HTH-type transcriptional regulator GADX; PSI2, MCS 89.3
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 89.25
3nqo_A189 MARR-family transcriptional regulator; structural 89.17
3oio_A113 Transcriptional regulator (ARAC-type DNA-binding c 89.11
3oou_A108 LIN2118 protein; protein structure initiative, PSI 89.05
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 89.02
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 88.98
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 88.84
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 88.8
2gxg_A146 146AA long hypothetical transcriptional regulator; 88.76
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 88.72
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 88.59
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 88.56
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 88.49
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 88.33
1p6r_A82 Penicillinase repressor; transcription regulation, 88.29
2nnn_A140 Probable transcriptional regulator; structural gen 88.28
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 88.16
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 88.04
3mn2_A108 Probable ARAC family transcriptional regulator; st 88.04
3k69_A162 Putative transcription regulator; putative transcr 88.03
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 87.93
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 87.91
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 87.88
2xrn_A 241 HTH-type transcriptional regulator TTGV; DNA-bindi 87.8
3bja_A139 Transcriptional regulator, MARR family, putative; 87.75
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 87.74
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 87.65
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 87.64
2hr3_A147 Probable transcriptional regulator; MCSG, structur 87.59
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 87.59
3f3x_A144 Transcriptional regulator, MARR family, putative; 87.57
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 87.52
3oop_A143 LIN2960 protein; protein structure initiative, PSI 87.45
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 87.42
2o0y_A 260 Transcriptional regulator; ICLR-family, structural 87.42
1mkm_A 249 ICLR transcriptional regulator; structural genomic 87.4
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 87.23
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 87.22
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 87.13
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 87.03
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 87.02
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 86.88
3f6o_A118 Probable transcriptional regulator, ARSR family pr 86.8
2w25_A150 Probable transcriptional regulatory protein; trans 86.7
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 86.67
2eth_A154 Transcriptional regulator, putative, MAR family; M 86.59
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 86.45
3ech_A142 MEXR, multidrug resistance operon repressor; winge 86.45
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 86.43
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 86.32
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 86.32
3bdd_A142 Regulatory protein MARR; putative multiple antibio 86.25
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 86.23
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 86.23
3lsg_A103 Two-component response regulator YESN; structural 86.21
2wte_A244 CSA3; antiviral protein, viral resistance, winged 86.19
1bl0_A129 Protein (multiple antibiotic resistance protein), 86.18
2vn2_A128 DNAD, chromosome replication initiation protein; D 86.16
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 86.13
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 86.09
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 85.98
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 85.72
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 85.6
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 85.59
3cjn_A162 Transcriptional regulator, MARR family; silicibact 85.19
2k9s_A107 Arabinose operon regulatory protein; activator, ar 85.18
3r4k_A 260 Transcriptional regulator, ICLR family; DNA/RNA-bi 85.18
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 85.16
2g7u_A 257 Transcriptional regulator; ICLR family, structural 85.09
2qko_A 215 Possible transcriptional regulator, TETR family P; 85.07
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 84.96
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 84.82
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 84.81
1yyv_A131 Putative transcriptional regulator; reductive meth 84.6
1v4r_A102 Transcriptional repressor; helix-turn-helix, winge 84.59
3boq_A160 Transcriptional regulator, MARR family; MARR famil 84.33
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 84.3
3s2w_A159 Transcriptional regulator, MARR family; structural 84.04
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 84.01
3t8r_A143 Staphylococcus aureus CYMR; transcriptional regula 84.0
1s3j_A155 YUSO protein; structural genomics, MARR transcript 83.96
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 83.76
3qph_A 342 TRMB, A global transcription regulator; transcript 83.61
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 83.57
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 83.57
2pex_A153 Transcriptional regulator OHRR; transcription regu 83.43
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 83.42
1z91_A147 Organic hydroperoxide resistance transcriptional; 82.88
2nyx_A168 Probable transcriptional regulatory protein, RV14; 82.8
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 82.72
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 82.53
3e6m_A161 MARR family transcriptional regulator; APC88769, s 82.47
2ia2_A 265 Putative transcriptional regulator; SAD, PSI-2, st 82.43
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 82.39
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 82.34
2h09_A155 Transcriptional regulator MNTR; transcription regu 82.05
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 81.68
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 81.61
4a5n_A131 Uncharacterized HTH-type transcriptional regulato; 81.55
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 81.48
3f6v_A151 Possible transcriptional regulator, ARSR family pr 81.36
3k2z_A 196 LEXA repressor; winged helix-turn-helix, SOS syste 81.13
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 80.89
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 80.66
>1cf7_A Protein (transcription factor E2F-4); E2F, winged-helix, DNA-binding domain, cell cycle, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: a.4.5.17 Back     alignment and structure
Probab=99.97  E-value=7.3e-32  Score=183.09  Aligned_cols=69  Identities=65%  Similarity=0.949  Sum_probs=65.6

Q ss_pred             CCCCCcCcHHHHHHHHHHHHhhCCCCcccHHHHHhHhcc-chhhhhhHHHhhhhccceeeccCCceeecC
Q psy8797          54 KGTRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDV-QKRRIYDITNVLEGIGILEKKSKNNIQCKR  122 (122)
Q Consensus        54 ~~~R~~kSLg~Lt~kFi~ll~~sp~~~idL~~aa~~L~v-~kRRiYDI~NVLE~igLI~K~~Kn~~~W~G  122 (122)
                      ..+|+++||++||++||++|.+++++.++|++||+.|+| +|||||||+|||||||||+|.+||.|+|+|
T Consensus         4 ~~~R~~~SL~~lt~kFi~l~~~~~~~~i~l~~aa~~L~v~~kRRiYDI~NVLe~igli~K~~k~~~~W~G   73 (76)
T 1cf7_A            4 TPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKG   73 (76)
T ss_dssp             --CTTTTCHHHHHHHHHHHHHHSSTTEEEHHHHHHHTTTCCTHHHHHHHHHHHHHTSEEEEETTEEEEC-
T ss_pred             CCCCccCcHHHHHHHHHHHHHhCCCCcCcHHHHHHHhCCccceehhhHHHHHhHhcceeecCCCcEEEeC
Confidence            478999999999999999999999999999999999999 999999999999999999999999999998



>1cf7_B Protein (transcription factor DP-2); E2F, winged-helix, DNA-binding domain, cell cycle, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: a.4.5.17 Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>1ylf_A RRF2 family protein; structural genomics, transcription regulator, P protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} Back     alignment and structure
>3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3k69_A Putative transcription regulator; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.95A {Lactobacillus plantarum} SCOP: a.4.5.0 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} Back     alignment and structure
>3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>2qko_A Possible transcriptional regulator, TETR family P; TETR family protein, structural genomics, P protein structure initiative; 2.35A {Rhodococcus SP} Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>3qph_A TRMB, A global transcription regulator; transcriptional regulator; HET: SUC; 2.99A {Pyrococcus furiosus} Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 122
d1cf7a_67 a.4.5.17 (A:) Cell cycle transcription factor E2F- 6e-27
>d1cf7a_ a.4.5.17 (A:) Cell cycle transcription factor E2F-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Cell cycle transcription factor e2f-dp
domain: Cell cycle transcription factor E2F-4
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 92.9 bits (231), Expect = 6e-27
 Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 1/67 (1%)

Query: 56  TRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDV-QKRRIYDITNVLEGIGILEKKS 114
           +R++ SLGLLT KFV LLQ +  GV+DL +A+++L V QKRRIYDITNVLEGIG++EKKS
Sbjct: 1   SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKS 60

Query: 115 KNNIQCK 121
           KN+IQ K
Sbjct: 61  KNSIQWK 67


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1cf7a_67 Cell cycle transcription factor E2F-4 {Human (Homo 99.98
d1cf7b_82 Cell cycle transcription factor DP-2 {Human (Homo 99.12
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 95.92
d1mkma175 Transcriptional regulator IclR, N-terminal domain 95.21
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 94.76
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 94.48
d1qzza192 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 93.51
d1tw3a185 Carminomycin 4-O-methyltransferase {Streptomyces p 93.51
d1lvaa364 C-terminal fragment of elongation factor SelB {Moo 93.37
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 93.29
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 93.11
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 92.82
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 92.54
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 92.36
d1fnna1112 CDC6, C-terminal domain {Archaeon Pyrobaculum aero 92.32
d1d5ya154 Rob transcription factor, N-terminal domain {Esche 91.11
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 90.31
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 90.12
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 89.41
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 88.58
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 86.85
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 86.19
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 85.95
d1ylfa1138 Hypothetical protein BC1842 {Bacillus cereus [TaxI 85.9
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 85.84
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 85.32
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 84.71
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 84.65
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 84.14
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 82.18
d2gxba159 Z-alpha domain of dsRNA-specific adenosine deamina 81.81
d2fbka1172 Transcriptional regulator DR1159 {Deinococcus radi 81.13
d1w5sa1110 CDC6-like protein APE0152, C-terminal domain {Aero 81.02
>d1cf7a_ a.4.5.17 (A:) Cell cycle transcription factor E2F-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Cell cycle transcription factor e2f-dp
domain: Cell cycle transcription factor E2F-4
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.98  E-value=2.5e-33  Score=185.68  Aligned_cols=66  Identities=68%  Similarity=1.004  Sum_probs=64.7

Q ss_pred             CCCcCcHHHHHHHHHHHHhhCCCCcccHHHHHhHhcc-chhhhhhHHHhhhhccceeeccCCceeec
Q psy8797          56 TRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDV-QKRRIYDITNVLEGIGILEKKSKNNIQCK  121 (122)
Q Consensus        56 ~R~~kSLg~Lt~kFi~ll~~sp~~~idL~~aa~~L~v-~kRRiYDI~NVLE~igLI~K~~Kn~~~W~  121 (122)
                      +|+|+||++||++|+++|.++|++.+||++||+.|+| +|||||||+|||||||||+|.+||+|+|.
T Consensus         1 sR~ekSLglLt~kFl~l~~~~~~~~~~L~~aa~~L~v~~kRRiYDI~NVLe~igli~K~~Kn~~~W~   67 (67)
T d1cf7a_           1 SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK   67 (67)
T ss_dssp             CTTTTCHHHHHHHHHHHHHHSSTTEEEHHHHHHHTTTCCTHHHHHHHHHHHHHTSEEEEETTEEEEC
T ss_pred             ChhhhhHHHHHHHHHHHHhhCCCCeeeHHHHHHHhcCcchhhHHHHHHHHhhhhhhhcccCCccccC
Confidence            6999999999999999999999999999999999999 89999999999999999999999999995



>d1cf7b_ a.4.5.17 (B:) Cell cycle transcription factor DP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2gxba1 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1w5sa1 a.4.5.11 (A:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure