Psyllid ID: psy8797
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 122 | ||||||
| 156546407 | 447 | PREDICTED: transcription factor E2F3-lik | 0.844 | 0.230 | 0.657 | 1e-26 | |
| 193673908 | 422 | PREDICTED: transcription factor E2F2-lik | 0.877 | 0.253 | 0.595 | 4e-26 | |
| 328708308 | 394 | PREDICTED: transcription factor E2F2-lik | 0.877 | 0.271 | 0.603 | 4e-26 | |
| 332016563 | 446 | Transcription factor E2F3 [Acromyrmex ec | 0.852 | 0.233 | 0.619 | 4e-26 | |
| 357608368 | 381 | E2F1 [Danaus plexippus] | 0.877 | 0.280 | 0.578 | 5e-26 | |
| 340719191 | 416 | PREDICTED: transcription factor E2F3-lik | 0.844 | 0.247 | 0.640 | 8e-26 | |
| 350399050 | 416 | PREDICTED: transcription factor E2F3-lik | 0.844 | 0.247 | 0.640 | 9e-26 | |
| 189242505 | 485 | PREDICTED: similar to E2F transcription | 0.811 | 0.204 | 0.623 | 9e-26 | |
| 340719189 | 450 | PREDICTED: transcription factor E2F3-lik | 0.844 | 0.228 | 0.640 | 9e-26 | |
| 350538465 | 456 | E2F transcription factor 1 [Bombyx mori] | 0.877 | 0.234 | 0.570 | 1e-25 |
| >gi|156546407|ref|XP_001607080.1| PREDICTED: transcription factor E2F3-like isoform 1 [Nasonia vitripennis] gi|345498319|ref|XP_003428202.1| PREDICTED: transcription factor E2F3-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 124 bits (310), Expect = 1e-26, Method: Compositional matrix adjust.
Identities = 73/111 (65%), Positives = 81/111 (72%), Gaps = 8/111 (7%)
Query: 18 VKRRLNLDQDDEESPFKTPKSVKKMRVNPPT----TPAKEKG---TRYDTSLGLLTKKFV 70
VKRRLNL+ +S FK PK K+ R + TP K K TRYDTSL LLTKKF+
Sbjct: 87 VKRRLNLEVGPSQSTFKAPKG-KRRRSGSSSLTGHTPTKSKTVERTRYDTSLSLLTKKFI 145
Query: 71 KLLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILEKKSKNNIQCK 121
L++ S GVVDLNVASE L+VQKRRIYDITNVLEGIGILEKKSKNNIQ K
Sbjct: 146 NLVEDSNDGVVDLNVASEKLEVQKRRIYDITNVLEGIGILEKKSKNNIQWK 196
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193673908|ref|XP_001945228.1| PREDICTED: transcription factor E2F2-like isoform 1 [Acyrthosiphon pisum] gi|328708305|ref|XP_003243650.1| PREDICTED: transcription factor E2F2-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328708308|ref|XP_003243651.1| PREDICTED: transcription factor E2F2-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|332016563|gb|EGI57444.1| Transcription factor E2F3 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|357608368|gb|EHJ65959.1| E2F1 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|340719191|ref|XP_003398040.1| PREDICTED: transcription factor E2F3-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350399050|ref|XP_003485399.1| PREDICTED: transcription factor E2F3-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|189242505|ref|XP_968025.2| PREDICTED: similar to E2F transcription factor 2 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|340719189|ref|XP_003398039.1| PREDICTED: transcription factor E2F3-like isoform 1 [Bombus terrestris] gi|350399047|ref|XP_003485398.1| PREDICTED: transcription factor E2F3-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|350538465|ref|NP_001233214.1| E2F transcription factor 1 [Bombyx mori] gi|341865523|dbj|BAG85354.2| E2F1 [Bombyx mori] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 122 | ||||||
| UNIPROTKB|J9P6U4 | 334 | E2F3 "Uncharacterized protein" | 0.827 | 0.302 | 0.564 | 1.6e-24 | |
| RGD|1561600 | 245 | E2f3 "E2F transcription factor | 0.827 | 0.412 | 0.564 | 1.6e-24 | |
| UNIPROTKB|F1NR90 | 342 | E2F3 "Uncharacterized protein" | 0.827 | 0.295 | 0.574 | 2e-24 | |
| UNIPROTKB|F1P324 | 348 | E2F3 "Uncharacterized protein" | 0.827 | 0.290 | 0.574 | 2e-24 | |
| UNIPROTKB|F1MYH2 | 463 | E2F3 "Uncharacterized protein" | 0.827 | 0.218 | 0.564 | 2.3e-24 | |
| UNIPROTKB|F1RUH1 | 358 | E2F3 "Uncharacterized protein" | 0.778 | 0.265 | 0.615 | 3.3e-24 | |
| MGI|MGI:1096340 | 457 | E2f3 "E2F transcription factor | 0.827 | 0.221 | 0.564 | 3.6e-24 | |
| UNIPROTKB|O00716 | 465 | E2F3 "Transcription factor E2F | 0.827 | 0.217 | 0.564 | 4e-24 | |
| UNIPROTKB|E1BD75 | 365 | E2F2 "Uncharacterized protein" | 0.852 | 0.284 | 0.601 | 6.8e-24 | |
| MGI|MGI:1096341 | 443 | E2f2 "E2F transcription factor | 0.811 | 0.223 | 0.629 | 8.5e-24 |
| UNIPROTKB|J9P6U4 E2F3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Score = 280 (103.6 bits), Expect = 1.6e-24, P = 1.6e-24
Identities = 61/108 (56%), Positives = 74/108 (68%)
Query: 19 KRRLNLDQDDEE---SPFKTPKSVKKMRVNPPTTPAKEKG----TRYDTSLGLLTKKFVK 71
KRRL L + + KTPK + + P +P K TRYDTSLGLLTKKF++
Sbjct: 2 KRRLELGESGHQYLSDGLKTPKGKGRATLRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQ 61
Query: 72 LLQSSPQGVVDLNVASESLDVQKRRIYDITNVLEGIGILEKKSKNNIQ 119
LL SP GV+DLN A+E L VQKRRIYDITNVLEGI +++KKSKNN+Q
Sbjct: 62 LLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQ 109
|
|
| RGD|1561600 E2f3 "E2F transcription factor 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NR90 E2F3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P324 E2F3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MYH2 E2F3 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RUH1 E2F3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1096340 E2f3 "E2F transcription factor 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O00716 E2F3 "Transcription factor E2F3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BD75 E2F2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1096341 E2f2 "E2F transcription factor 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 122 | |||
| pfam02319 | 67 | pfam02319, E2F_TDP, E2F/DP family winged-helix DNA | 3e-28 |
| >gnl|CDD|202203 pfam02319, E2F_TDP, E2F/DP family winged-helix DNA-binding domain | Back alignment and domain information |
|---|
Score = 97.6 bits (244), Expect = 3e-28
Identities = 44/66 (66%), Positives = 54/66 (81%), Gaps = 1/66 (1%)
Query: 57 RYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDV-QKRRIYDITNVLEGIGILEKKSK 115
R + SLGLLT+KF+KL + SP G+ DLN A++ LDV QKRRIYDITNVLEGIG++EKKSK
Sbjct: 1 RKEKSLGLLTQKFLKLCEKSPDGITDLNEAAKELDVKQKRRIYDITNVLEGIGLIEKKSK 60
Query: 116 NNIQCK 121
N I+
Sbjct: 61 NEIRWI 66
|
This family contains the transcription factor E2F and its dimerisation partners TDP1 and TDP2, which stimulate E2F-dependent transcription. E2F binds to DNA as a homodimer or as a heterodimer in association with TDP1/2, the heterodimer having increased binding efficiency. The crystal structure of an E2F4-DP2-DNA complex shows that the DNA-binding domains of the E2F and DP proteins both have a fold related to the winged-helix DNA-binding motif. Recognition of the central c/gGCGCg/c sequence of the consensus DNA-binding site is symmetric, and amino acids that contact these bases are conserved among all known E2F and DP proteins. Length = 67 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| KOG2577|consensus | 354 | 99.97 | ||
| PF02319 | 71 | E2F_TDP: E2F/DP family winged-helix DNA-binding do | 99.94 | |
| KOG2578|consensus | 388 | 99.86 | ||
| KOG2578|consensus | 388 | 99.63 | ||
| KOG2829|consensus | 326 | 98.24 | ||
| PF01978 | 68 | TrmB: Sugar-specific transcriptional regulator Trm | 96.83 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 96.14 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 95.94 | |
| smart00420 | 53 | HTH_DEOR helix_turn_helix, Deoxyribose operon repr | 95.77 | |
| smart00346 | 91 | HTH_ICLR helix_turn_helix isocitrate lyase regulat | 95.66 | |
| PF09339 | 52 | HTH_IclR: IclR helix-turn-helix domain; InterPro: | 95.24 | |
| smart00550 | 68 | Zalpha Z-DNA-binding domain in adenosine deaminase | 95.21 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 94.77 | |
| PF12802 | 62 | MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP | 94.67 | |
| PF02082 | 83 | Rrf2: Transcriptional regulator; InterPro: IPR0009 | 94.29 | |
| smart00418 | 66 | HTH_ARSR helix_turn_helix, Arsenical Resistance Op | 94.22 | |
| TIGR02944 | 130 | suf_reg_Xantho FeS assembly SUF system regulator, | 94.01 | |
| PF13730 | 55 | HTH_36: Helix-turn-helix domain | 93.11 | |
| PF01047 | 59 | MarR: MarR family; InterPro: IPR000835 The MarR-ty | 92.69 | |
| cd00090 | 78 | HTH_ARSR Arsenical Resistance Operon Repressor and | 92.52 | |
| smart00419 | 48 | HTH_CRP helix_turn_helix, cAMP Regulatory protein. | 92.3 | |
| PF09079 | 85 | Cdc6_C: CDC6, C terminal ; InterPro: IPR015163 The | 92.25 | |
| PF13463 | 68 | HTH_27: Winged helix DNA-binding domain; PDB: 3GFL | 92.04 | |
| smart00345 | 60 | HTH_GNTR helix_turn_helix gluconate operon transcr | 91.92 | |
| cd08768 | 87 | Cdc6_C Winged-helix domain of essential DNA replic | 91.84 | |
| PF00392 | 64 | GntR: Bacterial regulatory proteins, gntR family; | 91.14 | |
| TIGR00738 | 132 | rrf2_super rrf2 family protein (putative transcrip | 90.34 | |
| PF01726 | 65 | LexA_DNA_bind: LexA DNA binding domain; InterPro: | 89.53 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 88.97 | |
| COG3355 | 126 | Predicted transcriptional regulator [Transcription | 88.94 | |
| PF09012 | 69 | FeoC: FeoC like transcriptional regulator; InterPr | 88.68 | |
| PRK10163 | 271 | DNA-binding transcriptional repressor AllR; Provis | 88.45 | |
| PF04182 | 75 | B-block_TFIIIC: B-block binding subunit of TFIIIC; | 88.1 | |
| PRK09834 | 263 | DNA-binding transcriptional activator MhpR; Provis | 87.15 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 86.95 | |
| TIGR00122 | 69 | birA_repr_reg BirA biotin operon repressor domain. | 86.94 | |
| cd07377 | 66 | WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi | 86.77 | |
| smart00344 | 108 | HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto | 86.33 | |
| smart00347 | 101 | HTH_MARR helix_turn_helix multiple antibiotic resi | 86.23 | |
| COG1378 | 247 | Predicted transcriptional regulators [Transcriptio | 86.18 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 86.13 | |
| PF08784 | 102 | RPA_C: Replication protein A C terminal; InterPro: | 85.78 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 85.51 | |
| TIGR01610 | 95 | phage_O_Nterm phage replication protein O, N-termi | 84.69 | |
| TIGR02010 | 135 | IscR iron-sulfur cluster assembly transcription fa | 84.03 | |
| PF01325 | 60 | Fe_dep_repress: Iron dependent repressor, N-termin | 83.94 | |
| COG2739 | 105 | Uncharacterized protein conserved in bacteria [Fun | 83.89 | |
| TIGR01764 | 49 | excise DNA binding domain, excisionase family. An | 83.85 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 83.73 | |
| PF08280 | 59 | HTH_Mga: M protein trans-acting positive regulator | 83.25 | |
| PRK11511 | 127 | DNA-binding transcriptional activator MarA; Provis | 82.95 | |
| TIGR01889 | 109 | Staph_reg_Sar staphylococcal accessory regulator f | 82.78 | |
| PRK09954 | 362 | putative kinase; Provisional | 82.49 | |
| PRK10857 | 164 | DNA-binding transcriptional regulator IscR; Provis | 82.26 | |
| TIGR02431 | 248 | pcaR_pcaU beta-ketoadipate pathway transcriptional | 82.11 | |
| PF13545 | 76 | HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: | 82.01 | |
| PRK10219 | 107 | DNA-binding transcriptional regulator SoxS; Provis | 82.0 | |
| COG1414 | 246 | IclR Transcriptional regulator [Transcription] | 80.96 | |
| PRK00215 | 205 | LexA repressor; Validated | 80.87 | |
| PRK15090 | 257 | DNA-binding transcriptional regulator KdgR; Provis | 80.38 |
| >KOG2577|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=3.9e-32 Score=228.26 Aligned_cols=107 Identities=55% Similarity=0.723 Sum_probs=88.6
Q ss_pred hhhhhhcCCCCCCC-CC--CccCCCccccc--cCC-CCCCCCC-CCCCCCcCcHHHHHHHHHHHHhhCCCCcccHHHHHh
Q psy8797 16 NMVKRRLNLDQDDE-ES--PFKTPKSVKKM--RVN-PPTTPAK-EKGTRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASE 88 (122)
Q Consensus 16 ~~~~r~~~l~~~~~-~~--~~~tp~~~~~~--~~~-~~~~~k~-~~~~R~~kSLg~Lt~kFi~ll~~sp~~~idL~~aa~ 88 (122)
.++|++..+++... .. .+.+|.+.++. +.+ ++..+++ +.+.|+++|||+||+|||.|++++|+|++|||.||+
T Consensus 20 ~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~s~~~~~R~d~SLglLTkKFv~Llq~s~dGvldLn~aA~ 99 (354)
T KOG2577|consen 20 LPAKEDSRLEEMDPQSVESGLPSPISPGSRMDRKPDSSKSSSSPSESTRSDTSLGLLTKKFVDLLQESPDGVLDLNKAAE 99 (354)
T ss_pred cchhhhhhhhcccccccccCCCCCCCCCcccccCCCCcccccCCCCcccchhhHHHHHHHHHHHHHhCCCceeeHHHHHH
Confidence 67888888877433 11 14444444433 333 4455555 788999999999999999999999999999999999
Q ss_pred HhccchhhhhhHHHhhhhccceeeccCCceeecC
Q psy8797 89 SLDVQKRRIYDITNVLEGIGILEKKSKNNIQCKR 122 (122)
Q Consensus 89 ~L~v~kRRiYDI~NVLE~igLI~K~~Kn~~~W~G 122 (122)
.|+|+|||||||||||||||||+|++||+|+|+|
T Consensus 100 ~L~VqKRRIYDITNVLEGI~LIeKksKN~IqW~G 133 (354)
T KOG2577|consen 100 VLNVQKRRIYDITNVLEGIGLIEKKSKNNIQWIG 133 (354)
T ss_pred Hhccccceeeehhhhhhcccceeeccccceeeec
Confidence 9999999999999999999999999999999998
|
|
| >PF02319 E2F_TDP: E2F/DP family winged-helix DNA-binding domain; InterPro: IPR003316 The mammalian transcription factor E2F plays an important role in regulating the expression of genes that are required for passage through the cell cycle | Back alignment and domain information |
|---|
| >KOG2578|consensus | Back alignment and domain information |
|---|
| >KOG2578|consensus | Back alignment and domain information |
|---|
| >KOG2829|consensus | Back alignment and domain information |
|---|
| >PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor | Back alignment and domain information |
|---|
| >smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation | Back alignment and domain information |
|---|
| >PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B | Back alignment and domain information |
|---|
| >PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp | Back alignment and domain information |
|---|
| >smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor | Back alignment and domain information |
|---|
| >TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial | Back alignment and domain information |
|---|
| >PF13730 HTH_36: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance | Back alignment and domain information |
|---|
| >cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors | Back alignment and domain information |
|---|
| >smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein | Back alignment and domain information |
|---|
| >PF09079 Cdc6_C: CDC6, C terminal ; InterPro: IPR015163 The C-terminal domain of CDC6 assumes a winged helix fold, with a five alpha-helical bundle (alpha15-alpha19) structure, backed on one side by three beta strands (beta6-beta8) | Back alignment and domain information |
|---|
| >PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A | Back alignment and domain information |
|---|
| >smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor | Back alignment and domain information |
|---|
| >cd08768 Cdc6_C Winged-helix domain of essential DNA replication protein Cell division control protein (Cdc6), which mediates DNA binding | Back alignment and domain information |
|---|
| >PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) | Back alignment and domain information |
|---|
| >PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >COG3355 Predicted transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif | Back alignment and domain information |
|---|
| >PRK10163 DNA-binding transcriptional repressor AllR; Provisional | Back alignment and domain information |
|---|
| >PF04182 B-block_TFIIIC: B-block binding subunit of TFIIIC; InterPro: IPR007309 Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks | Back alignment and domain information |
|---|
| >PRK09834 DNA-binding transcriptional activator MhpR; Provisional | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >TIGR00122 birA_repr_reg BirA biotin operon repressor domain | Back alignment and domain information |
|---|
| >cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators | Back alignment and domain information |
|---|
| >smart00344 HTH_ASNC helix_turn_helix ASNC type | Back alignment and domain information |
|---|
| >smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein | Back alignment and domain information |
|---|
| >COG1378 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain | Back alignment and domain information |
|---|
| >TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR | Back alignment and domain information |
|---|
| >PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family | Back alignment and domain information |
|---|
| >COG2739 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01764 excise DNA binding domain, excisionase family | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF08280 HTH_Mga: M protein trans-acting positive regulator (MGA) HTH domain; InterPro: IPR013199 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] | Back alignment and domain information |
|---|
| >PRK11511 DNA-binding transcriptional activator MarA; Provisional | Back alignment and domain information |
|---|
| >TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family | Back alignment and domain information |
|---|
| >PRK09954 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10857 DNA-binding transcriptional regulator IscR; Provisional | Back alignment and domain information |
|---|
| >TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family | Back alignment and domain information |
|---|
| >PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A | Back alignment and domain information |
|---|
| >PRK10219 DNA-binding transcriptional regulator SoxS; Provisional | Back alignment and domain information |
|---|
| >COG1414 IclR Transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK00215 LexA repressor; Validated | Back alignment and domain information |
|---|
| >PRK15090 DNA-binding transcriptional regulator KdgR; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 122 | ||||
| 1cf7_A | 76 | Structural Basis Of Dna Recognition By The Heterodi | 3e-20 |
| >pdb|1CF7|A Chain A, Structural Basis Of Dna Recognition By The Heterodimeric Cell Cycle Transcription Factor E2f-Dp Length = 76 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 122 | |||
| 1cf7_A | 76 | Protein (transcription factor E2F-4); E2F, winged- | 2e-26 |
| >1cf7_A Protein (transcription factor E2F-4); E2F, winged-helix, DNA-binding domain, cell cycle, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: a.4.5.17 Length = 76 | Back alignment and structure |
|---|
Score = 92.7 bits (230), Expect = 2e-26
Identities = 49/77 (63%), Positives = 61/77 (79%), Gaps = 6/77 (7%)
Query: 46 PPTTPAKEKGTRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDV-QKRRIYDITNVL 104
PP TP +R++ SLGLLT KFV LLQ + GV+DL +A+++L V QKRRIYDITNVL
Sbjct: 1 PPGTP-----SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVL 55
Query: 105 EGIGILEKKSKNNIQCK 121
EGIG++EKKSKN+IQ K
Sbjct: 56 EGIGLIEKKSKNSIQWK 72
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| 1cf7_A | 76 | Protein (transcription factor E2F-4); E2F, winged- | 99.97 | |
| 1cf7_B | 95 | Protein (transcription factor DP-2); E2F, winged-h | 99.51 | |
| 2xvc_A | 59 | ESCRT-III, SSO0910; cell cycle, cell division, cyt | 96.08 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 95.94 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 95.7 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 95.58 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 95.52 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 94.48 | |
| 2y75_A | 129 | HTH-type transcriptional regulator CYMR; DNA bindi | 94.11 | |
| 3r0a_A | 123 | Putative transcriptional regulator; structural gen | 93.53 | |
| 3eco_A | 139 | MEPR; mutlidrug efflux pump regulator winged helix | 93.4 | |
| 3bro_A | 141 | Transcriptional regulator; helix_TURN_helix, multi | 93.32 | |
| 1y0u_A | 96 | Arsenical resistance operon repressor, putative; s | 92.97 | |
| 1sfx_A | 109 | Conserved hypothetical protein AF2008; structural | 92.97 | |
| 3cuo_A | 99 | Uncharacterized HTH-type transcriptional regulato; | 92.9 | |
| 2kko_A | 108 | Possible transcriptional regulatory protein (possi | 92.83 | |
| 2fu4_A | 83 | Ferric uptake regulation protein; DNA binding doma | 92.62 | |
| 2d1h_A | 109 | ST1889, 109AA long hypothetical transcriptional re | 92.13 | |
| 2oqg_A | 114 | Possible transcriptional regulator, ARSR family P; | 91.33 | |
| 1ku9_A | 152 | Hypothetical protein MJ223; putative transcription | 90.94 | |
| 3jth_A | 98 | Transcription activator HLYU; transcription factor | 90.81 | |
| 2frh_A | 127 | SARA, staphylococcal accessory regulator A; winged | 90.81 | |
| 1r1u_A | 106 | CZRA, repressor protein; zinc, DNA binding, transc | 90.62 | |
| 3pqk_A | 102 | Biofilm growth-associated repressor; helix-turn-he | 90.47 | |
| 3rkx_A | 323 | Biotin-[acetyl-COA-carboxylase] ligase; biotin pro | 90.24 | |
| 3jw4_A | 148 | Transcriptional regulator, MARR/EMRR family; DNA-b | 90.23 | |
| 1j5y_A | 187 | Transcriptional regulator, biotin repressor famil; | 90.2 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 90.02 | |
| 3deu_A | 166 | Transcriptional regulator SLYA; MARR, WING-helix, | 89.98 | |
| 3mq0_A | 275 | Transcriptional repressor of the blcabc operon; he | 89.88 | |
| 2hzt_A | 107 | Putative HTH-type transcriptional regulator YTCD; | 89.71 | |
| 4b8x_A | 147 | SCO5413, possible MARR-transcriptional regulator; | 89.67 | |
| 2pg4_A | 95 | Uncharacterized protein; structural genomics, join | 89.57 | |
| 1ylf_A | 149 | RRF2 family protein; structural genomics, transcri | 89.56 | |
| 1sfu_A | 75 | 34L protein; protein/Z-DNA complex, DNA binding pr | 89.41 | |
| 3mkl_A | 120 | HTH-type transcriptional regulator GADX; PSI2, MCS | 89.3 | |
| 1ub9_A | 100 | Hypothetical protein PH1061; helix-turn-helix moti | 89.25 | |
| 3nqo_A | 189 | MARR-family transcriptional regulator; structural | 89.17 | |
| 3oio_A | 113 | Transcriptional regulator (ARAC-type DNA-binding c | 89.11 | |
| 3oou_A | 108 | LIN2118 protein; protein structure initiative, PSI | 89.05 | |
| 2cfx_A | 144 | HTH-type transcriptional regulator LRPC; transcrip | 89.02 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 88.98 | |
| 3g3z_A | 145 | NMB1585, transcriptional regulator, MARR family; t | 88.84 | |
| 3u2r_A | 168 | Regulatory protein MARR; structural genomics, PSI- | 88.8 | |
| 2gxg_A | 146 | 146AA long hypothetical transcriptional regulator; | 88.76 | |
| 1u2w_A | 122 | CADC repressor, cadmium efflux system accessory pr | 88.72 | |
| 3tgn_A | 146 | ADC operon repressor ADCR; helix-turn-helix, trans | 88.59 | |
| 1on2_A | 142 | Transcriptional regulator MNTR; helix-turn-helix, | 88.56 | |
| 2x4h_A | 139 | Hypothetical protein SSO2273; transcription; 2.30A | 88.49 | |
| 2dbb_A | 151 | Putative HTH-type transcriptional regulator PH006; | 88.33 | |
| 1p6r_A | 82 | Penicillinase repressor; transcription regulation, | 88.29 | |
| 2nnn_A | 140 | Probable transcriptional regulator; structural gen | 88.28 | |
| 3nrv_A | 148 | Putative transcriptional regulator (MARR/EMRR FAM; | 88.16 | |
| 2fbi_A | 142 | Probable transcriptional regulator; MARR, APC5816, | 88.04 | |
| 3mn2_A | 108 | Probable ARAC family transcriptional regulator; st | 88.04 | |
| 3k69_A | 162 | Putative transcription regulator; putative transcr | 88.03 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 87.93 | |
| 1xn7_A | 78 | Hypothetical protein YHGG; alpha+beta, GFT structu | 87.91 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 87.88 | |
| 2xrn_A | 241 | HTH-type transcriptional regulator TTGV; DNA-bindi | 87.8 | |
| 3bja_A | 139 | Transcriptional regulator, MARR family, putative; | 87.75 | |
| 2cg4_A | 152 | Regulatory protein ASNC; DNA binding, FFRP, LRP fa | 87.74 | |
| 3fm5_A | 150 | Transcriptional regulator; MCSG, PF04017, PSI, MAR | 87.65 | |
| 2p5v_A | 162 | Transcriptional regulator, LRP/ASNC family; NMB057 | 87.64 | |
| 2hr3_A | 147 | Probable transcriptional regulator; MCSG, structur | 87.59 | |
| 1tbx_A | 99 | ORF F-93, hypothetical 11.0 kDa protein; sulfolobu | 87.59 | |
| 3f3x_A | 144 | Transcriptional regulator, MARR family, putative; | 87.57 | |
| 3bpv_A | 138 | Transcriptional regulator; MARR, DNA binding, tran | 87.52 | |
| 3oop_A | 143 | LIN2960 protein; protein structure initiative, PSI | 87.45 | |
| 2qww_A | 154 | Transcriptional regulator, MARR family; YP_013417. | 87.42 | |
| 2o0y_A | 260 | Transcriptional regulator; ICLR-family, structural | 87.42 | |
| 1mkm_A | 249 | ICLR transcriptional regulator; structural genomic | 87.4 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 87.23 | |
| 1i1g_A | 141 | Transcriptional regulator LRPA; helix-turn-helix, | 87.22 | |
| 2fsw_A | 107 | PG_0823 protein; alpha-beta structure, helix-turn- | 87.13 | |
| 2fa5_A | 162 | Transcriptional regulator MARR/EMRR family; multip | 87.03 | |
| 1z7u_A | 112 | Hypothetical protein EF0647; winged-helix-turn-hel | 87.02 | |
| 2a61_A | 145 | Transcriptional regulator TM0710; APC4350, MCSG, m | 86.88 | |
| 3f6o_A | 118 | Probable transcriptional regulator, ARSR family pr | 86.8 | |
| 2w25_A | 150 | Probable transcriptional regulatory protein; trans | 86.7 | |
| 2bv6_A | 142 | MGRA, HTH-type transcriptional regulator MGRA; mul | 86.67 | |
| 2eth_A | 154 | Transcriptional regulator, putative, MAR family; M | 86.59 | |
| 2k02_A | 87 | Ferrous iron transport protein C; FEOC, iron-sulfu | 86.45 | |
| 3ech_A | 142 | MEXR, multidrug resistance operon repressor; winge | 86.45 | |
| 1r1t_A | 122 | Transcriptional repressor SMTB; zinc, transcriptio | 86.43 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 86.32 | |
| 2dk5_A | 91 | DNA-directed RNA polymerase III 39 kDa polypeptide | 86.32 | |
| 3bdd_A | 142 | Regulatory protein MARR; putative multiple antibio | 86.25 | |
| 2fbh_A | 146 | Transcriptional regulator PA3341; MARR, transcript | 86.23 | |
| 3cdh_A | 155 | Transcriptional regulator, MARR family; helix-turn | 86.23 | |
| 3lsg_A | 103 | Two-component response regulator YESN; structural | 86.21 | |
| 2wte_A | 244 | CSA3; antiviral protein, viral resistance, winged | 86.19 | |
| 1bl0_A | 129 | Protein (multiple antibiotic resistance protein), | 86.18 | |
| 2vn2_A | 128 | DNAD, chromosome replication initiation protein; D | 86.16 | |
| 1lj9_A | 144 | Transcriptional regulator SLYA; HTH DNA binding pr | 86.13 | |
| 2jsc_A | 118 | Transcriptional regulator RV1994C/MT2050; cadmium, | 86.09 | |
| 3bj6_A | 152 | Transcriptional regulator, MARR family; helix-turn | 85.98 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 85.72 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 85.6 | |
| 2cyy_A | 151 | Putative HTH-type transcriptional regulator PH151; | 85.59 | |
| 3cjn_A | 162 | Transcriptional regulator, MARR family; silicibact | 85.19 | |
| 2k9s_A | 107 | Arabinose operon regulatory protein; activator, ar | 85.18 | |
| 3r4k_A | 260 | Transcriptional regulator, ICLR family; DNA/RNA-bi | 85.18 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 85.16 | |
| 2g7u_A | 257 | Transcriptional regulator; ICLR family, structural | 85.09 | |
| 2qko_A | 215 | Possible transcriptional regulator, TETR family P; | 85.07 | |
| 2pn6_A | 150 | ST1022, 150AA long hypothetical transcriptional re | 84.96 | |
| 4hbl_A | 149 | Transcriptional regulator, MARR family; HTH, trans | 84.82 | |
| 3hsr_A | 140 | HTH-type transcriptional regulator SARZ; helix-tur | 84.81 | |
| 1yyv_A | 131 | Putative transcriptional regulator; reductive meth | 84.6 | |
| 1v4r_A | 102 | Transcriptional repressor; helix-turn-helix, winge | 84.59 | |
| 3boq_A | 160 | Transcriptional regulator, MARR family; MARR famil | 84.33 | |
| 3k0l_A | 162 | Repressor protein; helix-turn-helix, structural ge | 84.3 | |
| 3s2w_A | 159 | Transcriptional regulator, MARR family; structural | 84.04 | |
| 1r7j_A | 95 | Conserved hypothetical protein SSO10A; winged heli | 84.01 | |
| 3t8r_A | 143 | Staphylococcus aureus CYMR; transcriptional regula | 84.0 | |
| 1s3j_A | 155 | YUSO protein; structural genomics, MARR transcript | 83.96 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 83.76 | |
| 3qph_A | 342 | TRMB, A global transcription regulator; transcript | 83.61 | |
| 2rdp_A | 150 | Putative transcriptional regulator MARR; PFAM PF01 | 83.57 | |
| 1jgs_A | 138 | Multiple antibiotic resistance protein MARR; trans | 83.57 | |
| 2pex_A | 153 | Transcriptional regulator OHRR; transcription regu | 83.43 | |
| 3tqn_A | 113 | Transcriptional regulator, GNTR family; regulatory | 83.42 | |
| 1z91_A | 147 | Organic hydroperoxide resistance transcriptional; | 82.88 | |
| 2nyx_A | 168 | Probable transcriptional regulatory protein, RV14; | 82.8 | |
| 2f2e_A | 146 | PA1607; transcription factor, helix-TRUN-helix, AP | 82.72 | |
| 2v79_A | 135 | DNA replication protein DNAD; primosome, DNA-bindi | 82.53 | |
| 3e6m_A | 161 | MARR family transcriptional regulator; APC88769, s | 82.47 | |
| 2ia2_A | 265 | Putative transcriptional regulator; SAD, PSI-2, st | 82.43 | |
| 2ia0_A | 171 | Putative HTH-type transcriptional regulator PF086; | 82.39 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 82.34 | |
| 2h09_A | 155 | Transcriptional regulator MNTR; transcription regu | 82.05 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 81.68 | |
| 2ek5_A | 129 | Predicted transcriptional regulators; helix-turn-h | 81.61 | |
| 4a5n_A | 131 | Uncharacterized HTH-type transcriptional regulato; | 81.55 | |
| 2fbk_A | 181 | Transcriptional regulator, MARR family; winged-hel | 81.48 | |
| 3f6v_A | 151 | Possible transcriptional regulator, ARSR family pr | 81.36 | |
| 3k2z_A | 196 | LEXA repressor; winged helix-turn-helix, SOS syste | 81.13 | |
| 1xmk_A | 79 | Double-stranded RNA-specific adenosine deaminase; | 80.89 | |
| 2e1c_A | 171 | Putative HTH-type transcriptional regulator PH151; | 80.66 |
| >1cf7_A Protein (transcription factor E2F-4); E2F, winged-helix, DNA-binding domain, cell cycle, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: a.4.5.17 | Back alignment and structure |
|---|
Probab=99.97 E-value=7.3e-32 Score=183.09 Aligned_cols=69 Identities=65% Similarity=0.949 Sum_probs=65.6
Q ss_pred CCCCCcCcHHHHHHHHHHHHhhCCCCcccHHHHHhHhcc-chhhhhhHHHhhhhccceeeccCCceeecC
Q psy8797 54 KGTRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDV-QKRRIYDITNVLEGIGILEKKSKNNIQCKR 122 (122)
Q Consensus 54 ~~~R~~kSLg~Lt~kFi~ll~~sp~~~idL~~aa~~L~v-~kRRiYDI~NVLE~igLI~K~~Kn~~~W~G 122 (122)
..+|+++||++||++||++|.+++++.++|++||+.|+| +|||||||+|||||||||+|.+||.|+|+|
T Consensus 4 ~~~R~~~SL~~lt~kFi~l~~~~~~~~i~l~~aa~~L~v~~kRRiYDI~NVLe~igli~K~~k~~~~W~G 73 (76)
T 1cf7_A 4 TPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWKG 73 (76)
T ss_dssp --CTTTTCHHHHHHHHHHHHHHSSTTEEEHHHHHHHTTTCCTHHHHHHHHHHHHHTSEEEEETTEEEEC-
T ss_pred CCCCccCcHHHHHHHHHHHHHhCCCCcCcHHHHHHHhCCccceehhhHHHHHhHhcceeecCCCcEEEeC
Confidence 478999999999999999999999999999999999999 999999999999999999999999999998
|
| >1cf7_B Protein (transcription factor DP-2); E2F, winged-helix, DNA-binding domain, cell cycle, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: a.4.5.17 | Back alignment and structure |
|---|
| >2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 | Back alignment and structure |
|---|
| >1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A | Back alignment and structure |
|---|
| >2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 | Back alignment and structure |
|---|
| >2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 | Back alignment and structure |
|---|
| >3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D | Back alignment and structure |
|---|
| >1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A | Back alignment and structure |
|---|
| >3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A | Back alignment and structure |
|---|
| >3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* | Back alignment and structure |
|---|
| >3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >1ylf_A RRF2 family protein; structural genomics, transcription regulator, P protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 | Back alignment and structure |
|---|
| >1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} | Back alignment and structure |
|---|
| >3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} | Back alignment and structure |
|---|
| >2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A | Back alignment and structure |
|---|
| >1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A | Back alignment and structure |
|---|
| >3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* | Back alignment and structure |
|---|
| >2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B | Back alignment and structure |
|---|
| >2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} | Back alignment and structure |
|---|
| >2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3k69_A Putative transcription regulator; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.95A {Lactobacillus plantarum} SCOP: a.4.5.0 | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A | Back alignment and structure |
|---|
| >3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} | Back alignment and structure |
|---|
| >2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A | Back alignment and structure |
|---|
| >2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 | Back alignment and structure |
|---|
| >3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* | Back alignment and structure |
|---|
| >3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} | Back alignment and structure |
|---|
| >2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} | Back alignment and structure |
|---|
| >1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A | Back alignment and structure |
|---|
| >2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A | Back alignment and structure |
|---|
| >1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 | Back alignment and structure |
|---|
| >3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} | Back alignment and structure |
|---|
| >2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} | Back alignment and structure |
|---|
| >2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A | Back alignment and structure |
|---|
| >2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2qko_A Possible transcriptional regulator, TETR family P; TETR family protein, structural genomics, P protein structure initiative; 2.35A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* | Back alignment and structure |
|---|
| >4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A | Back alignment and structure |
|---|
| >1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 | Back alignment and structure |
|---|
| >3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} | Back alignment and structure |
|---|
| >3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A | Back alignment and structure |
|---|
| >3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A | Back alignment and structure |
|---|
| >1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >3qph_A TRMB, A global transcription regulator; transcriptional regulator; HET: SUC; 2.99A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A | Back alignment and structure |
|---|
| >3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* | Back alignment and structure |
|---|
| >2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 | Back alignment and structure |
|---|
| >2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} | Back alignment and structure |
|---|
| >2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A | Back alignment and structure |
|---|
| >4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A | Back alignment and structure |
|---|
| >2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 | Back alignment and structure |
|---|
| >3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} | Back alignment and structure |
|---|
| >3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 122 | ||||
| d1cf7a_ | 67 | a.4.5.17 (A:) Cell cycle transcription factor E2F- | 6e-27 |
| >d1cf7a_ a.4.5.17 (A:) Cell cycle transcription factor E2F-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: Cell cycle transcription factor e2f-dp domain: Cell cycle transcription factor E2F-4 species: Human (Homo sapiens) [TaxId: 9606]
Score = 92.9 bits (231), Expect = 6e-27
Identities = 45/67 (67%), Positives = 57/67 (85%), Gaps = 1/67 (1%)
Query: 56 TRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDV-QKRRIYDITNVLEGIGILEKKS 114
+R++ SLGLLT KFV LLQ + GV+DL +A+++L V QKRRIYDITNVLEGIG++EKKS
Sbjct: 1 SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKS 60
Query: 115 KNNIQCK 121
KN+IQ K
Sbjct: 61 KNSIQWK 67
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 122 | |||
| d1cf7a_ | 67 | Cell cycle transcription factor E2F-4 {Human (Homo | 99.98 | |
| d1cf7b_ | 82 | Cell cycle transcription factor DP-2 {Human (Homo | 99.12 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 95.92 | |
| d1mkma1 | 75 | Transcriptional regulator IclR, N-terminal domain | 95.21 | |
| d1sfxa_ | 109 | Hypothetical protein AF2008 {Archaeoglobus fulgidu | 94.76 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 94.48 | |
| d1qzza1 | 92 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 93.51 | |
| d1tw3a1 | 85 | Carminomycin 4-O-methyltransferase {Streptomyces p | 93.51 | |
| d1lvaa3 | 64 | C-terminal fragment of elongation factor SelB {Moo | 93.37 | |
| d1ku9a_ | 151 | DNA-binding protein Mj223 {Archaeon Methanococcus | 93.29 | |
| d3broa1 | 135 | Transcriptional regulator OEOE1854 {Oenococcus oen | 93.11 | |
| d1p4xa1 | 125 | Staphylococcal accessory regulator A homolog, SarS | 92.82 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 92.54 | |
| d1bl0a1 | 54 | MarA {Escherichia coli [TaxId: 562]} | 92.36 | |
| d1fnna1 | 112 | CDC6, C-terminal domain {Archaeon Pyrobaculum aero | 92.32 | |
| d1d5ya1 | 54 | Rob transcription factor, N-terminal domain {Esche | 91.11 | |
| d2frha1 | 115 | Pleiotropic regulator of virulence genes, SarA {St | 90.31 | |
| d1p4xa2 | 125 | Staphylococcal accessory regulator A homolog, SarS | 90.12 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 89.41 | |
| d1hsja1 | 115 | Staphylococcal accessory regulator A homolog, SarR | 88.58 | |
| d2a61a1 | 139 | Transcriptional regulator TM0710 {Thermotoga marit | 86.85 | |
| d2hs5a1 | 69 | Putative transcriptional regulator RHA1_ro03477 {R | 86.19 | |
| d1ub9a_ | 100 | Hypothetical protein PH1061 {Archaeon Pyrococcus h | 85.95 | |
| d1ylfa1 | 138 | Hypothetical protein BC1842 {Bacillus cereus [TaxI | 85.9 | |
| d3ctaa1 | 85 | Ta1064 (RFK), N-terminal domain {Thermoplasma acid | 85.84 | |
| d3bwga1 | 78 | Transcriptional regulator YydK {Bacillus subtilis | 85.32 | |
| d2fbha1 | 137 | Transcriptional regulator PA3341 {Pseudomonas aeru | 84.71 | |
| d2hr3a1 | 145 | Probable transcriptional regulator PA3067 {Pseudom | 84.65 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 84.14 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 82.18 | |
| d2gxba1 | 59 | Z-alpha domain of dsRNA-specific adenosine deamina | 81.81 | |
| d2fbka1 | 172 | Transcriptional regulator DR1159 {Deinococcus radi | 81.13 | |
| d1w5sa1 | 110 | CDC6-like protein APE0152, C-terminal domain {Aero | 81.02 |
| >d1cf7a_ a.4.5.17 (A:) Cell cycle transcription factor E2F-4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: Cell cycle transcription factor e2f-dp domain: Cell cycle transcription factor E2F-4 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.98 E-value=2.5e-33 Score=185.68 Aligned_cols=66 Identities=68% Similarity=1.004 Sum_probs=64.7
Q ss_pred CCCcCcHHHHHHHHHHHHhhCCCCcccHHHHHhHhcc-chhhhhhHHHhhhhccceeeccCCceeec
Q psy8797 56 TRYDTSLGLLTKKFVKLLQSSPQGVVDLNVASESLDV-QKRRIYDITNVLEGIGILEKKSKNNIQCK 121 (122)
Q Consensus 56 ~R~~kSLg~Lt~kFi~ll~~sp~~~idL~~aa~~L~v-~kRRiYDI~NVLE~igLI~K~~Kn~~~W~ 121 (122)
+|+|+||++||++|+++|.++|++.+||++||+.|+| +|||||||+|||||||||+|.+||+|+|.
T Consensus 1 sR~ekSLglLt~kFl~l~~~~~~~~~~L~~aa~~L~v~~kRRiYDI~NVLe~igli~K~~Kn~~~W~ 67 (67)
T d1cf7a_ 1 SRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYDITNVLEGIGLIEKKSKNSIQWK 67 (67)
T ss_dssp CTTTTCHHHHHHHHHHHHHHSSTTEEEHHHHHHHTTTCCTHHHHHHHHHHHHHTSEEEEETTEEEEC
T ss_pred ChhhhhHHHHHHHHHHHHhhCCCCeeeHHHHHHHhcCcchhhHHHHHHHHhhhhhhhcccCCccccC
Confidence 6999999999999999999999999999999999999 89999999999999999999999999995
|
| >d1cf7b_ a.4.5.17 (B:) Cell cycle transcription factor DP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} | Back information, alignment and structure |
|---|
| >d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} | Back information, alignment and structure |
|---|
| >d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2gxba1 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1w5sa1 a.4.5.11 (A:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|