Psyllid ID: psy8808


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MPDDDPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDASLVYGSDDELAAKLREFNGGRLAVEFRDGRPWPPAAANKSAVCDSKNDALPCYQFGK
cccccccccccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHEEEccccHHHccHHHHHHccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHcHHHHHHcccccccccccHHHHHHHHcHHHEHHccccccccccccccccccccccccEEEEccc
mpdddpvyskFRQVCMNFVRsttdidqgcnpgytpaeQMIQVKHNRIATVLghlnphwddetLYQEARKILIAEYSHINYYEWLPIVVVTHWMDaslvygsdDELAAKLREfnggrlavefrdgrpwppaaanksavcdskndalpcyqfgk
MPDDDPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDASLVYGSDDELAAKLREFNGGRLAVEFRDGRPWPPAaanksavcdskndalpcyqfgk
MPDDDPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDASLVYGSDDELAAKLREFNGGRLAVEFRDGRPWPPAAANKSAVCDSKNDALPCYQFGK
*******YSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDASLVYGSDDELAAKLREFNGGRLAVEFRDGR*W*************************
MP******SKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDASLVYGSDDELAAKLREFNGGRLAVEFRDGRPWPPAAAN*SA*CDSKNDALPCYQFG*
MPDDDPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDASLVYGSDDELAAKLREFNGGRLAVEFRDGRPWPPAAANKSAVCDSKNDALPCYQFGK
****DPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDASLVYGSDDELAAKLREFNGGRLAVEFRDGRPWPPAAANKSAVCDSKNDALPCYQFG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPDDDPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDASLVYGSDDELAAKLREFNGGRLAVEFRDGRPWPPAAANKSAVCDSKNDALPCYQFGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query152 2.2.26 [Sep-21-2011]
Q01603 690 Peroxidase OS=Drosophila yes N/A 0.131 0.028 0.522 2e-14
P82600 790 Chorion peroxidase OS=Aed N/A N/A 0.532 0.102 0.428 7e-13
Q9VZZ4 1527 Peroxidasin OS=Drosophila no N/A 0.342 0.034 0.5 1e-10
Q9VEG6 809 Chorion peroxidase OS=Dro no N/A 0.355 0.066 0.509 2e-10
A1KZ92 1463 Peroxidasin-like protein yes N/A 0.243 0.025 0.608 2e-10
Q92626 1479 Peroxidasin homolog OS=Ho no N/A 0.335 0.034 0.508 9e-10
A4IGL7 1457 Peroxidasin OS=Xenopus tr yes N/A 0.328 0.034 0.5 1e-09
Q3UQ28 1475 Peroxidasin homolog OS=Mu yes N/A 0.335 0.034 0.491 2e-09
P05164 745 Myeloperoxidase OS=Homo s no N/A 0.335 0.068 0.482 6e-09
Q7QH73 767 Chorion peroxidase OS=Ano no N/A 0.039 0.007 0.490 2e-08
>sp|Q01603|PERO_DROME Peroxidase OS=Drosophila melanogaster GN=Pxd PE=2 SV=2 Back     alignment and function desciption
 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (68%)

Query: 22  TTDIDQGCNPGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYY 81
           + D+    NPG    + ++  +HNRIA  L  LNPH+DD TL+QEARKI IA+Y  I+YY
Sbjct: 327 SGDVRVNQNPGLAILQTILLREHNRIADALSALNPHYDDRTLFQEARKINIAQYQQISYY 386

Query: 82  EWLPIVV 88
           EWLPI +
Sbjct: 387 EWLPIFL 393




Involved in the chorion hardening process, through protein cross-linking mediated by the formation of di- and tri-tyrosine bonds.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 7
>sp|P82600|PERC_AEDAE Chorion peroxidase OS=Aedes aegypti GN=pxt PE=1 SV=3 Back     alignment and function description
>sp|Q9VZZ4|PXDN_DROME Peroxidasin OS=Drosophila melanogaster GN=Pxn PE=1 SV=1 Back     alignment and function description
>sp|Q9VEG6|PERC_DROME Chorion peroxidase OS=Drosophila melanogaster GN=Pxt PE=2 SV=3 Back     alignment and function description
>sp|A1KZ92|PXDNL_HUMAN Peroxidasin-like protein OS=Homo sapiens GN=PXDNL PE=1 SV=3 Back     alignment and function description
>sp|Q92626|PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens GN=PXDN PE=1 SV=2 Back     alignment and function description
>sp|A4IGL7|PXDN_XENTR Peroxidasin OS=Xenopus tropicalis GN=pxdn PE=2 SV=1 Back     alignment and function description
>sp|Q3UQ28|PXDN_MOUSE Peroxidasin homolog OS=Mus musculus GN=Pxdn PE=2 SV=2 Back     alignment and function description
>sp|P05164|PERM_HUMAN Myeloperoxidase OS=Homo sapiens GN=MPO PE=1 SV=1 Back     alignment and function description
>sp|Q7QH73|PERC_ANOGA Chorion peroxidase OS=Anopheles gambiae GN=pxt PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
328707938 694 PREDICTED: peroxidase-like [Acyrthosipho 0.684 0.149 0.496 6e-32
307167191 1552 Peroxidase [Camponotus floridanus] 0.684 0.067 0.397 6e-22
340717182 702 PREDICTED: peroxidase-like isoform 1 [Bo 0.684 0.148 0.384 5e-20
156549449 696 PREDICTED: peroxidase-like [Nasonia vitr 0.684 0.149 0.384 1e-19
350407373 702 PREDICTED: peroxidase-like isoform 1 [Bo 0.684 0.148 0.377 4e-19
383856116 692 PREDICTED: peroxidase-like [Megachile ro 0.684 0.150 0.384 1e-18
307209899 745 Peroxidase [Harpegnathos saltator] 0.684 0.139 0.364 1e-18
328776817 703 PREDICTED: peroxidase [Apis mellifera] 0.684 0.147 0.364 1e-17
91078176 673 PREDICTED: similar to AGAP010734-PA [Tri 0.684 0.154 0.317 1e-15
380021230 709 PREDICTED: peroxidase-like [Apis florea] 0.684 0.146 0.364 5e-15
>gi|328707938|ref|XP_001949485.2| PREDICTED: peroxidase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 75/151 (49%), Positives = 85/151 (56%), Gaps = 47/151 (31%)

Query: 1   MPDDDPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQVKHNRIATVLGHLNPHWDD 60
           +P+DDPV+SKF + CMNFVRSTTD + GCN G  PAEQ+                     
Sbjct: 224 IPEDDPVFSKFHRECMNFVRSTTDQETGCNAGNKPAEQL--------------------- 262

Query: 61  ETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDASLVYGSDDELAAKLREFNGGRLAVE 120
                                     VVV+HWMDAS VYGS+  LA  LRE  GGRL VE
Sbjct: 263 --------------------------VVVSHWMDASFVYGSNQRLADTLREGIGGRLRVE 296

Query: 121 FRDGRPWPPAAANKSAVCDSKNDALPCYQFG 151
           FRDGRPWPPAAANKSAVCD + +  PCYQFG
Sbjct: 297 FRDGRPWPPAAANKSAVCDQQTEEEPCYQFG 327




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307167191|gb|EFN60907.1| Peroxidase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340717182|ref|XP_003397066.1| PREDICTED: peroxidase-like isoform 1 [Bombus terrestris] gi|340717184|ref|XP_003397067.1| PREDICTED: peroxidase-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|156549449|ref|XP_001603589.1| PREDICTED: peroxidase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350407373|ref|XP_003488069.1| PREDICTED: peroxidase-like isoform 1 [Bombus impatiens] gi|350407376|ref|XP_003488070.1| PREDICTED: peroxidase-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|383856116|ref|XP_003703556.1| PREDICTED: peroxidase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307209899|gb|EFN86678.1| Peroxidase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328776817|ref|XP_623940.3| PREDICTED: peroxidase [Apis mellifera] Back     alignment and taxonomy information
>gi|91078176|ref|XP_967241.1| PREDICTED: similar to AGAP010734-PA [Tribolium castaneum] gi|270002725|gb|EEZ99172.1| hypothetical protein TcasGA2_TC000175 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380021230|ref|XP_003694474.1| PREDICTED: peroxidase-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
FB|FBgn0038511 753 CG5873 [Drosophila melanogaste 0.394 0.079 0.491 7.8e-14
FB|FBgn0004577 690 Pxd "Peroxidase" [Drosophila m 0.414 0.091 0.555 1.5e-13
FB|FBgn0263986 830 cd "cardinal" [Drosophila mela 0.296 0.054 0.577 9e-13
FB|FBgn0261987 809 Pxt "Peroxinectin-like" [Droso 0.302 0.056 0.586 1.3e-12
UNIPROTKB|P82600 790 pxt "Chorion peroxidase" [Aede 0.532 0.102 0.428 5.7e-12
UNIPROTKB|F1M335 1317 F1M335 "Uncharacterized protei 0.519 0.059 0.445 9.5e-12
MGI|MGI:1916925 1475 Pxdn "peroxidasin homolog (Dro 0.519 0.053 0.445 1.1e-11
WB|WBGene00016700 1537 C46A5.4 [Caenorhabditis elegan 0.532 0.052 0.393 3.8e-09
FB|FBgn0032685 1394 CG10211 [Drosophila melanogast 0.440 0.048 0.4 3.4e-08
WB|WBGene00011530 1490 T06D8.10 [Caenorhabditis elega 0.381 0.038 0.448 2.2e-09
FB|FBgn0038511 CG5873 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 152 (58.6 bits), Expect = 7.8e-14, Sum P(2) = 7.8e-14
 Identities = 30/61 (49%), Positives = 41/61 (67%)

Query:    43 KHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDA-SLVYGS 101
             +HNR+AT L  +N HWDDETL+QEAR+I IA   H+ + E+LPI++    M+   LV   
Sbjct:   398 EHNRLATALAQINKHWDDETLFQEARRINIAIVQHVTFNEFLPILLGKEVMEKFGLVLQK 457

Query:   102 D 102
             D
Sbjct:   458 D 458


GO:0004601 "peroxidase activity" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0006979 "response to oxidative stress" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
FB|FBgn0004577 Pxd "Peroxidase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0263986 cd "cardinal" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0261987 Pxt "Peroxinectin-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P82600 pxt "Chorion peroxidase" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|F1M335 F1M335 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1916925 Pxdn "peroxidasin homolog (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00016700 C46A5.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0032685 CG10211 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00011530 T06D8.10 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
cd09823 378 cd09823, peroxinectin_like, peroxinectin_like anim 2e-25
pfam03098 521 pfam03098, An_peroxidase, Animal haem peroxidase 9e-22
cd09826 440 cd09826, peroxidasin_like, Animal heme peroxidase 2e-17
cd09823 378 cd09823, peroxinectin_like, peroxinectin_like anim 3e-17
pfam03098 521 pfam03098, An_peroxidase, Animal haem peroxidase 6e-16
cd05396 370 cd05396, An_peroxidase_like, Animal heme peroxidas 1e-15
cd09824 411 cd09824, myeloperoxidase_like, Myeloperoxidases, e 9e-14
cd09825 565 cd09825, thyroid_peroxidase, Thyroid peroxidase (T 3e-13
cd09822 420 cd09822, peroxinectin_like_bacterial, Uncharacteri 4e-11
cd09820 558 cd09820, dual_peroxidase_like, Dual oxidase and re 2e-10
cd09816 490 cd09816, prostaglandin_endoperoxide_synthase, Anim 4e-09
cd05396 370 cd05396, An_peroxidase_like, Animal heme peroxidas 2e-08
cd09824 411 cd09824, myeloperoxidase_like, Myeloperoxidases, e 1e-07
cd09826 440 cd09826, peroxidasin_like, Animal heme peroxidase 1e-06
cd09822 420 cd09822, peroxinectin_like_bacterial, Uncharacteri 2e-06
cd09818 484 cd09818, PIOX_like, Animal heme oxidases similar t 3e-05
cd09825 565 cd09825, thyroid_peroxidase, Thyroid peroxidase (T 2e-04
cd09820 558 cd09820, dual_peroxidase_like, Dual oxidase and re 7e-04
cd09818 484 cd09818, PIOX_like, Animal heme oxidases similar t 0.001
PLN02283 633 PLN02283, PLN02283, alpha-dioxygenase 0.003
>gnl|CDD|188655 cd09823, peroxinectin_like, peroxinectin_like animal heme peroxidases Back     alignment and domain information
 Score = 99.2 bits (248), Expect = 2e-25
 Identities = 30/45 (66%), Positives = 36/45 (80%)

Query: 44  HNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVV 88
           HNRIA  L  LNPHWDDE L+QEARKI+IA+  HI Y E+LPI++
Sbjct: 90  HNRIADELKKLNPHWDDERLFQEARKIVIAQMQHITYNEFLPILL 134


Peroxinectin is an arthropod protein that plays a role in invertebrate immunity mechanisms. Specifically, peroxinectins are secreted as cell-adhesive and opsonic peroxidases. The immunity mechanism appears to involve an interaction between peroxinectin and a transmembrane receptor of the integrin family. Human myeloperoxidase, which is included in this wider family, has also been reported to interact with integrins. Length = 378

>gnl|CDD|217366 pfam03098, An_peroxidase, Animal haem peroxidase Back     alignment and domain information
>gnl|CDD|188658 cd09826, peroxidasin_like, Animal heme peroxidase domain of peroxidasin and related proteins Back     alignment and domain information
>gnl|CDD|188655 cd09823, peroxinectin_like, peroxinectin_like animal heme peroxidases Back     alignment and domain information
>gnl|CDD|217366 pfam03098, An_peroxidase, Animal haem peroxidase Back     alignment and domain information
>gnl|CDD|188647 cd05396, An_peroxidase_like, Animal heme peroxidases and related proteins Back     alignment and domain information
>gnl|CDD|188656 cd09824, myeloperoxidase_like, Myeloperoxidases, eosinophil peroxidases, and lactoperoxidases Back     alignment and domain information
>gnl|CDD|188657 cd09825, thyroid_peroxidase, Thyroid peroxidase (TPO) Back     alignment and domain information
>gnl|CDD|188654 cd09822, peroxinectin_like_bacterial, Uncharacterized family of heme peroxidases, mostly bacterial Back     alignment and domain information
>gnl|CDD|188652 cd09820, dual_peroxidase_like, Dual oxidase and related animal heme peroxidases Back     alignment and domain information
>gnl|CDD|188648 cd09816, prostaglandin_endoperoxide_synthase, Animal prostaglandin endoperoxide synthase and related bacterial proteins Back     alignment and domain information
>gnl|CDD|188647 cd05396, An_peroxidase_like, Animal heme peroxidases and related proteins Back     alignment and domain information
>gnl|CDD|188656 cd09824, myeloperoxidase_like, Myeloperoxidases, eosinophil peroxidases, and lactoperoxidases Back     alignment and domain information
>gnl|CDD|188658 cd09826, peroxidasin_like, Animal heme peroxidase domain of peroxidasin and related proteins Back     alignment and domain information
>gnl|CDD|188654 cd09822, peroxinectin_like_bacterial, Uncharacterized family of heme peroxidases, mostly bacterial Back     alignment and domain information
>gnl|CDD|188650 cd09818, PIOX_like, Animal heme oxidases similar to plant pathogen-inducible oxygenases Back     alignment and domain information
>gnl|CDD|188657 cd09825, thyroid_peroxidase, Thyroid peroxidase (TPO) Back     alignment and domain information
>gnl|CDD|188652 cd09820, dual_peroxidase_like, Dual oxidase and related animal heme peroxidases Back     alignment and domain information
>gnl|CDD|188650 cd09818, PIOX_like, Animal heme oxidases similar to plant pathogen-inducible oxygenases Back     alignment and domain information
>gnl|CDD|177921 PLN02283, PLN02283, alpha-dioxygenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 152
KOG2408|consensus 719 99.94
PF03098 530 An_peroxidase: Animal haem peroxidase; InterPro: I 99.93
PLN02283 633 alpha-dioxygenase 99.86
KOG2408|consensus 719 99.08
PF03098 530 An_peroxidase: Animal haem peroxidase; InterPro: I 98.1
PLN02283 633 alpha-dioxygenase 97.64
>KOG2408|consensus Back     alignment and domain information
Probab=99.94  E-value=6.1e-28  Score=217.63  Aligned_cols=116  Identities=40%  Similarity=0.613  Sum_probs=95.1

Q ss_pred             CCCCCcccCCCCCeeeecccCccccCCCCCCCCCchhhchh---------------------------------------
Q psy8808           1 MPDDDPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQ---------------------------------------   41 (152)
Q Consensus         1 vp~~D~~~~~~~~~c~~~~Rs~~~~~~~c~~~~~~r~q~n~---------------------------------------   41 (152)
                      ||++||+|...+ .||+|+||.+++..++..+  +|||+|+                                       
T Consensus       267 ~p~~dp~~~~~~-~C~~f~Rs~~~~~~~~~~~--~reQlNq~T~~lD~S~IYGss~~~~~~lR~f~~~~g~l~~~~~~~~  343 (719)
T KOG2408|consen  267 IPPNDPYFPSNQ-RCLPFVRSLPACGSGYNLG--PREQLNQLTSFLDASVIYGSSDEDARKLRLFKDGKGLLRVDTGLFE  343 (719)
T ss_pred             cCCCCCccCCcc-cceeceecCCCccccccCC--hhhhhccccccccchhccCCCHHHHHHHhcccCcccceeecccccc
Confidence            689999998755 9999999999965444555  9999998                                       


Q ss_pred             -------------------------------------------------hHHHHHHHHhhhcCCCCCchHHHHHHHHHHH
Q psy8808          42 -------------------------------------------------VKHNRIATVLGHLNPHWDDETLYQEARKILI   72 (152)
Q Consensus        42 -------------------------------------------------r~HN~~a~~l~~~~p~w~de~lf~~aR~i~~   72 (152)
                                                                       |||||||.+|+..||||+||+||||||||++
T Consensus       344 ~~~~~lP~~~~~~~~c~~~~~~~~~~cf~aGD~R~~~~pgL~~~hti~lREHNRiA~~Lk~~np~W~dE~lfQeaRkI~~  423 (719)
T KOG2408|consen  344 NGRPLLPFSTDPPNSCRSKPPGAPKPCFTAGDERANEQPGLAALHTLFLREHNRIATELKALNPHWSDERLFQEARKIVG  423 (719)
T ss_pred             cCcccCCCCCCCCccccccCCCCCCcccccCccccccCcchHHHHHHHHHHHHHHHHHHHhhCCCCcHHHHHHHHHHHHH
Confidence                                                             9999999999999999999999999999999


Q ss_pred             Hhhcccccccchhhhhhhccc-ccccc--------CCCCHHHHHhhcccCCCeEEE
Q psy8808          73 AEYSHINYYEWLPIVVVTHWM-DASLV--------YGSDDELAAKLREFNGGRLAV  119 (152)
Q Consensus        73 a~~q~I~~~e~lP~lLgt~~i-D~sl~--------ygss~~~a~~lR~f~~G~L~~  119 (152)
                      |++|||||+||||.+||..+- ..|..        .+.+.+++.++.+|.++++.-
T Consensus       424 A~~q~Ity~e~LP~ilG~~~~~~~g~~~gY~~~~dp~IsneFataAfRfgHsli~~  479 (719)
T KOG2408|consen  424 AQVQHITYNEYLPKLLGAPLKVSLGGYRGYDPNVDPTISNEFATAAFRFGHSLIPP  479 (719)
T ss_pred             HHHhhhhHHhhhhhhcCcccccCCccccCcCCCCChhhhhhhhHHHHhhhcccCch
Confidence            999999999999999994433 22333        233345566666677776664



>PF03098 An_peroxidase: Animal haem peroxidase; InterPro: IPR002007 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions Back     alignment and domain information
>PLN02283 alpha-dioxygenase Back     alignment and domain information
>KOG2408|consensus Back     alignment and domain information
>PF03098 An_peroxidase: Animal haem peroxidase; InterPro: IPR002007 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions Back     alignment and domain information
>PLN02283 alpha-dioxygenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
3f9p_C 467 Crystal Structure Of Myeloperoxidase From Human Leu 7e-10
1myp_C 466 X-Ray Crystal Structure Of Canine Myeloperoxidase A 8e-10
1cxp_C 466 Cryogenic Crystal Structure Of Human Myeloperoxidas 8e-10
2ikc_A 595 Crystal Structure Of Sheep Lactoperoxidase At 3.25 2e-09
2ikc_A 595 Crystal Structure Of Sheep Lactoperoxidase At 3.25 8e-05
3r5q_A 595 Crystal Structure Of Sheep Lactoperoxidase In Compl 2e-09
3r5q_A 595 Crystal Structure Of Sheep Lactoperoxidase In Compl 1e-04
2e9e_A 595 Crystal Structure Of The Complex Of Goat Lactoperox 2e-09
2e9e_A 595 Crystal Structure Of The Complex Of Goat Lactoperox 7e-05
2r5l_A 595 Crystal Structure Of Lactoperoxidase At 2.4a Resolu 2e-09
2r5l_A 595 Crystal Structure Of Lactoperoxidase At 2.4a Resolu 9e-05
2gjm_A 583 Crystal Structure Of Buffalo Lactoperoxidase At 2.7 7e-09
2gj1_A 583 Crystal Structure Of Bovine Lactoperoxidase At 2.3a 7e-09
3erh_A 595 First Structural Evidence Of Substrate Specificity 7e-09
2ips_A 595 Crystal Structure Of A Ternary Complex Of Bovine La 8e-09
2pt3_A 595 Crystal Structure Of Bovine Lactoperoxidase At 2.34 8e-09
2z5z_A 595 Crystal Structure Of The Complex Of Buffalo Lactope 1e-08
2o86_A 595 Crystal Structure Of A Ternary Complex Of Buffalo L 1e-08
1ebv_A 551 Ovine Pghs-1 Complexed With Salicyl Hydroxamic Acid 9e-05
1ht5_A 551 The 2.75 Angstrom Resolution Model Of Ovine Cox-1 C 9e-05
3n8w_B 553 Crystal Structure Of R120qNATIVE CYCLOOXYGENASE-1 H 9e-05
3n8y_B 553 Structure Of Aspirin Acetylated Cyclooxygenase-1 In 9e-05
1diy_A 553 Crystal Structure Of Arachidonic Acid Bound In The 1e-04
1pge_A 576 Prostaglandin H2 Synthase-1 Complexed With P-(2'-Io 1e-04
2oye_P 600 Indomethacin-(r)-alpha-ethyl-ethanolamide Bound To 1e-04
1pth_A 576 The Structural Basis Of Aspirin Activity Inferred F 1e-04
1cqe_A 580 Prostaglandin H2 Synthase-1 Complex With Flurbiprof 1e-04
1ddx_A 552 Crystal Structure Of A Mixture Of Arachidonic Acid 2e-04
3rr3_A 560 Structure Of (R)-Flurbiprofen Bound To Mcox-2 Lengt 2e-04
3mdl_A 587 X-Ray Crystal Structure Of 1-Arachidonoyl Glycerol 2e-04
3tzi_A 593 X-Ray Crystal Structure Of Arachidonic Acid Bound I 2e-04
3olt_A 592 X-Ray Crystal Structure Of Arachidonic Acid Bound T 2e-04
3krk_A 591 X-Ray Crystal Structure Of Arachidonic Acid Bound I 2e-04
3hs5_A 591 X-Ray Crystal Structure Of Arachidonic Acid Bound T 2e-04
3nt1_A 587 High Resolution Structure Of Naproxen:cox-2 Complex 2e-04
1pxx_A 604 Crystal Structure Of Diclofenac Bound To The Cycloo 2e-04
3qh0_A 610 X-Ray Crystal Structure Of Palmitic Acid Bound To T 2e-04
1u67_A 600 Crystal Structure Of Arachidonic Acid Bound To A Mu 3e-04
>pdb|3F9P|C Chain C, Crystal Structure Of Myeloperoxidase From Human Leukocytes Length = 467 Back     alignment and structure

Iteration: 1

Score = 59.3 bits (142), Expect = 7e-10, Method: Compositional matrix adjust. Identities = 28/58 (48%), Positives = 37/58 (63%) Query: 31 PGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVV 88 P T ++ +HNR+AT L LNP WD E LYQEARKI+ A I Y ++LP+V+ Sbjct: 132 PELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVL 189
>pdb|1MYP|C Chain C, X-Ray Crystal Structure Of Canine Myeloperoxidase At 3 Angstroms Resolution Length = 466 Back     alignment and structure
>pdb|1CXP|C Chain C, Cryogenic Crystal Structure Of Human Myeloperoxidase Isoform C Length = 466 Back     alignment and structure
>pdb|2IKC|A Chain A, Crystal Structure Of Sheep Lactoperoxidase At 3.25 A Resolution Reveals The Binding Sites For Formate Length = 595 Back     alignment and structure
>pdb|2IKC|A Chain A, Crystal Structure Of Sheep Lactoperoxidase At 3.25 A Resolution Reveals The Binding Sites For Formate Length = 595 Back     alignment and structure
>pdb|3R5Q|A Chain A, Crystal Structure Of Sheep Lactoperoxidase In Complex With Tetrahydrofuran At 2.7 A Resolution Length = 595 Back     alignment and structure
>pdb|3R5Q|A Chain A, Crystal Structure Of Sheep Lactoperoxidase In Complex With Tetrahydrofuran At 2.7 A Resolution Length = 595 Back     alignment and structure
>pdb|2E9E|A Chain A, Crystal Structure Of The Complex Of Goat Lactoperoxidase With Nitrate At 3.25 A Resolution Length = 595 Back     alignment and structure
>pdb|2E9E|A Chain A, Crystal Structure Of The Complex Of Goat Lactoperoxidase With Nitrate At 3.25 A Resolution Length = 595 Back     alignment and structure
>pdb|2R5L|A Chain A, Crystal Structure Of Lactoperoxidase At 2.4a Resolution Length = 595 Back     alignment and structure
>pdb|2R5L|A Chain A, Crystal Structure Of Lactoperoxidase At 2.4a Resolution Length = 595 Back     alignment and structure
>pdb|2GJM|A Chain A, Crystal Structure Of Buffalo Lactoperoxidase At 2.75a Resolution Length = 583 Back     alignment and structure
>pdb|2GJ1|A Chain A, Crystal Structure Of Bovine Lactoperoxidase At 2.3a Resolution Length = 583 Back     alignment and structure
>pdb|3ERH|A Chain A, First Structural Evidence Of Substrate Specificity In Mammalian Peroxidases: Crystal Structures Of Substrate Complexes With Lactoperoxidases From Two Different Species Length = 595 Back     alignment and structure
>pdb|2IPS|A Chain A, Crystal Structure Of A Ternary Complex Of Bovine Lactoperoxidase With Thiocyanate And Iodide At 3.1 A Resolution Length = 595 Back     alignment and structure
>pdb|2PT3|A Chain A, Crystal Structure Of Bovine Lactoperoxidase At 2.34 A Resolution Reveals Multiple Anion Binding Sites Length = 595 Back     alignment and structure
>pdb|2Z5Z|A Chain A, Crystal Structure Of The Complex Of Buffalo Lactoperoxidase With Fluoride Ion At 3.5a Resolution Length = 595 Back     alignment and structure
>pdb|2O86|A Chain A, Crystal Structure Of A Ternary Complex Of Buffalo Lactoperoxidase With Nitrate And Iodide At 2.8 A Resolution Length = 595 Back     alignment and structure
>pdb|1EBV|A Chain A, Ovine Pghs-1 Complexed With Salicyl Hydroxamic Acid Length = 551 Back     alignment and structure
>pdb|1HT5|A Chain A, The 2.75 Angstrom Resolution Model Of Ovine Cox-1 Complexed With Methyl Ester Flurbiprofen Length = 551 Back     alignment and structure
>pdb|3N8W|B Chain B, Crystal Structure Of R120qNATIVE CYCLOOXYGENASE-1 Heterodimer Mutant In Complex With Flurbiprofen Length = 553 Back     alignment and structure
>pdb|3N8Y|B Chain B, Structure Of Aspirin Acetylated Cyclooxygenase-1 In Complex With Diclofenac Length = 553 Back     alignment and structure
>pdb|1DIY|A Chain A, Crystal Structure Of Arachidonic Acid Bound In The Cyclooxygenase Active Site Of Pghs-1 Length = 553 Back     alignment and structure
>pdb|1PGE|A Chain A, Prostaglandin H2 Synthase-1 Complexed With P-(2'-Iodo-5'-Thenoyl) Hydrotropic Acid (Iodosuprofen) Length = 576 Back     alignment and structure
>pdb|2OYE|P Chain P, Indomethacin-(r)-alpha-ethyl-ethanolamide Bound To Cyclooxygenase-1 Length = 600 Back     alignment and structure
>pdb|1PTH|A Chain A, The Structural Basis Of Aspirin Activity Inferred From The Crystal Structure Of Inactivated Prostaglandin H2 Synthase Length = 576 Back     alignment and structure
>pdb|1CQE|A Chain A, Prostaglandin H2 Synthase-1 Complex With Flurbiprofen Length = 580 Back     alignment and structure
>pdb|1DDX|A Chain A, Crystal Structure Of A Mixture Of Arachidonic Acid And Prostaglandin Bound To The Cyclooxygenase Active Site Of Cox-2: Prostaglandin Structure Length = 552 Back     alignment and structure
>pdb|3RR3|A Chain A, Structure Of (R)-Flurbiprofen Bound To Mcox-2 Length = 560 Back     alignment and structure
>pdb|3MDL|A Chain A, X-Ray Crystal Structure Of 1-Arachidonoyl Glycerol Bound To The Cyclooxygenase Channel Of Cyclooxygenase-2 Length = 587 Back     alignment and structure
>pdb|3TZI|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound In The Cyclooxygenase Channel Of G533v Murine Cox-2 Length = 593 Back     alignment and structure
>pdb|3OLT|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound To The Cyclooxygenase Channel Of R513h Murine Cox-2 Length = 592 Back     alignment and structure
>pdb|3KRK|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound In The Cyclooxygenase Channel Of L531f Murine Cox-2 Length = 591 Back     alignment and structure
>pdb|3HS5|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound To The Cyclooxygenase Channel Of Cyclooxygenase-2 Length = 591 Back     alignment and structure
>pdb|3NT1|A Chain A, High Resolution Structure Of Naproxen:cox-2 Complex. Length = 587 Back     alignment and structure
>pdb|1PXX|A Chain A, Crystal Structure Of Diclofenac Bound To The Cyclooxygenase Active Site Of Cox-2 Length = 604 Back     alignment and structure
>pdb|3QH0|A Chain A, X-Ray Crystal Structure Of Palmitic Acid Bound To The Cyclooxygenase Channel Of Cyclooxygenase-2 Length = 610 Back     alignment and structure
>pdb|1U67|A Chain A, Crystal Structure Of Arachidonic Acid Bound To A Mutant Of Prostagladin H Synthase-1 That Forms Predominantly 11-hpete Length = 600 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 1e-18
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 1e-11
1d2v_C 466 Myeloperoxidase; heme-protein, oxidoreductase, per 4e-18
1d2v_C 466 Myeloperoxidase; heme-protein, oxidoreductase, per 1e-12
3q9k_A 595 Lactoperoxidase, LPO; bovine lactoperoxidase, oxid 4e-18
3q9k_A 595 Lactoperoxidase, LPO; bovine lactoperoxidase, oxid 9e-07
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 1e-17
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 3e-12
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 Back     alignment and structure
 Score = 80.5 bits (198), Expect = 1e-18
 Identities = 19/65 (29%), Positives = 31/65 (47%)

Query: 30  NPGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVV 89
            PG      +   +HNR+  +L   +P W DE L+Q +R ILI E   I   +++  +  
Sbjct: 264 VPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSG 323

Query: 90  THWMD 94
            H+  
Sbjct: 324 YHFKL 328


>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 Back     alignment and structure
>1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* Length = 466 Back     alignment and structure
>1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* Length = 466 Back     alignment and structure
>3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... Length = 595 Back     alignment and structure
>3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... Length = 595 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
3q9k_A 595 Lactoperoxidase, LPO; bovine lactoperoxidase, oxid 99.96
1d2v_C 466 Myeloperoxidase; heme-protein, oxidoreductase, per 99.96
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 99.78
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 99.78
3q9k_A 595 Lactoperoxidase, LPO; bovine lactoperoxidase, oxid 98.96
1d2v_C 466 Myeloperoxidase; heme-protein, oxidoreductase, per 98.95
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 98.48
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 98.37
>3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... Back     alignment and structure
Probab=99.96  E-value=7.7e-30  Score=225.26  Aligned_cols=115  Identities=32%  Similarity=0.446  Sum_probs=96.2

Q ss_pred             CCCCCcccCCCCCeeeecccCccccCCCCCCCCCchhhchh---------------------------------------
Q psy8808           1 MPDDDPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQ---------------------------------------   41 (152)
Q Consensus         1 vp~~D~~~~~~~~~c~~~~Rs~~~~~~~c~~~~~~r~q~n~---------------------------------------   41 (152)
                      ||++||+|...+ .||+|+||.+++. +|.+++.+|||||+                                       
T Consensus       144 ip~~Dp~~~~~~-~Cm~f~RS~~~~~-~~~~~~~~reQiN~~Ts~lD~S~VYGss~~~~~~LR~~~~~~G~Lk~~~~~~~  221 (595)
T 3q9k_A          144 FPKNDPKLKTQG-KCMPFFRAGFVCP-TPPYQSLAREQINAVTSFLDASLVYGSEPSLASRLRNLSSPLGLMAVNQEAWD  221 (595)
T ss_dssp             CCTTCHHHHHSC-SEECCBCBCBSSC-SSCCCSSCCCBEECSCSSSSCHHHHCSSHHHHHHTBCCSSTTCCBCCCSSCCB
T ss_pred             CCCCCCcccCCC-ceeEeecCCCcCC-CCCCCcchHhhhccccceeeeeeccCCCHHHHHHHhCCCCCCceeecccccCC
Confidence            799999996555 4999999999865 46665569999998                                       


Q ss_pred             -------------------------------------------------hHHHHHHHHhhhcCCCCCchHHHHHHHHHHH
Q psy8808          42 -------------------------------------------------VKHNRIATVLGHLNPHWDDETLYQEARKILI   72 (152)
Q Consensus        42 -------------------------------------------------r~HN~~a~~l~~~~p~w~de~lf~~aR~i~~   72 (152)
                                                                       |||||||++|+++||+|+||+|||+||+|||
T Consensus       222 ~g~~~lP~~~~~~~~c~~~~~~~~~~cf~aGD~R~ne~p~L~~lhtlflREHNria~~L~~~nP~W~dE~LfQeAR~Iv~  301 (595)
T 3q9k_A          222 HGLAYLPFNNKKPSPCEFINTTARVPCFLAGDFRASEQILLATAHTLLLREHNRLARELKKLNPHWNGEKLYQEARKILG  301 (595)
T ss_dssp             TTBCCCCBCCCSSCHHHHTCTTTCCCCBCCSSTTTTSBHHHHHHHHHHHHHHHHHHHHHHHHCTTCCHHHHHHHHHHHHH
T ss_pred             CCccCCCCCCCCCCcccccCCCCCCcccccCCccccccHHHHHHHHHHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHHHH
Confidence                                                             9999999999999999999999999999999


Q ss_pred             Hhhcccccccchhhhhhhcc---c------cccccCCCCHHHHHhhcccCCCeEE
Q psy8808          73 AEYSHINYYEWLPIVVVTHW---M------DASLVYGSDDELAAKLREFNGGRLA  118 (152)
Q Consensus        73 a~~q~I~~~e~lP~lLgt~~---i------D~sl~ygss~~~a~~lR~f~~G~L~  118 (152)
                      |++|||||+||||.|||..+   +      +.++.++.+.++ +++.+|.+.++.
T Consensus       302 A~~Q~Ity~E~LP~ilG~~~~~~~~~~~gY~~~v~p~i~neF-~aafRfgHsli~  355 (595)
T 3q9k_A          302 AFIQIITFRDYLPIVLGSEMQKWIPPYQGYNNSVDPRISNVF-TFAFRFGHMEVP  355 (595)
T ss_dssp             HHHHHHHHHTHHHHHHGGGHHHHSCSCCCCCTTSCCCCBTTH-HHHGGGGGGGCC
T ss_pred             HHeeeeeHHHHHHHHhCchhhhhCCCccCCCCCCCCccHHHH-HHHHHhHHhhCc
Confidence            99999999999999999872   1      234456666788 777777655443



>1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... Back     alignment and structure
>1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 152
g1cxp.1 570 a.93.1.2 (A:,C:) Myeloperoxidase {Human (Homo sapi 2e-18
g1cxp.1 570 a.93.1.2 (A:,C:) Myeloperoxidase {Human (Homo sapi 8e-07
d1q4ga1 511 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {She 6e-18
d1q4ga1 511 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {She 2e-12
d1cvua1 511 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mou 6e-17
d1cvua1 511 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mou 2e-12
>d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Length = 511 Back     information, alignment and structure
>d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Length = 511 Back     information, alignment and structure
>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Length = 511 Back     information, alignment and structure
>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Length = 511 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
g1cxp.1 570 Myeloperoxidase {Human (Homo sapiens) [TaxId: 9606 99.95
d1q4ga1 511 Prostaglandin H2 synthase {Sheep (Ovis aries) [Tax 99.78
d1cvua1 511 Prostaglandin H2 synthase {Mouse (Mus musculus) [T 99.78
g1cxp.1 570 Myeloperoxidase {Human (Homo sapiens) [TaxId: 9606 98.53
d1cvua1 511 Prostaglandin H2 synthase {Mouse (Mus musculus) [T 98.44
d1q4ga1 511 Prostaglandin H2 synthase {Sheep (Ovis aries) [Tax 98.43
>d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure