Psyllid ID: psy8808
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 152 | ||||||
| 328707938 | 694 | PREDICTED: peroxidase-like [Acyrthosipho | 0.684 | 0.149 | 0.496 | 6e-32 | |
| 307167191 | 1552 | Peroxidase [Camponotus floridanus] | 0.684 | 0.067 | 0.397 | 6e-22 | |
| 340717182 | 702 | PREDICTED: peroxidase-like isoform 1 [Bo | 0.684 | 0.148 | 0.384 | 5e-20 | |
| 156549449 | 696 | PREDICTED: peroxidase-like [Nasonia vitr | 0.684 | 0.149 | 0.384 | 1e-19 | |
| 350407373 | 702 | PREDICTED: peroxidase-like isoform 1 [Bo | 0.684 | 0.148 | 0.377 | 4e-19 | |
| 383856116 | 692 | PREDICTED: peroxidase-like [Megachile ro | 0.684 | 0.150 | 0.384 | 1e-18 | |
| 307209899 | 745 | Peroxidase [Harpegnathos saltator] | 0.684 | 0.139 | 0.364 | 1e-18 | |
| 328776817 | 703 | PREDICTED: peroxidase [Apis mellifera] | 0.684 | 0.147 | 0.364 | 1e-17 | |
| 91078176 | 673 | PREDICTED: similar to AGAP010734-PA [Tri | 0.684 | 0.154 | 0.317 | 1e-15 | |
| 380021230 | 709 | PREDICTED: peroxidase-like [Apis florea] | 0.684 | 0.146 | 0.364 | 5e-15 |
| >gi|328707938|ref|XP_001949485.2| PREDICTED: peroxidase-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 142 bits (357), Expect = 6e-32, Method: Compositional matrix adjust.
Identities = 75/151 (49%), Positives = 85/151 (56%), Gaps = 47/151 (31%)
Query: 1 MPDDDPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQVKHNRIATVLGHLNPHWDD 60
+P+DDPV+SKF + CMNFVRSTTD + GCN G PAEQ+
Sbjct: 224 IPEDDPVFSKFHRECMNFVRSTTDQETGCNAGNKPAEQL--------------------- 262
Query: 61 ETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDASLVYGSDDELAAKLREFNGGRLAVE 120
VVV+HWMDAS VYGS+ LA LRE GGRL VE
Sbjct: 263 --------------------------VVVSHWMDASFVYGSNQRLADTLREGIGGRLRVE 296
Query: 121 FRDGRPWPPAAANKSAVCDSKNDALPCYQFG 151
FRDGRPWPPAAANKSAVCD + + PCYQFG
Sbjct: 297 FRDGRPWPPAAANKSAVCDQQTEEEPCYQFG 327
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307167191|gb|EFN60907.1| Peroxidase [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|340717182|ref|XP_003397066.1| PREDICTED: peroxidase-like isoform 1 [Bombus terrestris] gi|340717184|ref|XP_003397067.1| PREDICTED: peroxidase-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|156549449|ref|XP_001603589.1| PREDICTED: peroxidase-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|350407373|ref|XP_003488069.1| PREDICTED: peroxidase-like isoform 1 [Bombus impatiens] gi|350407376|ref|XP_003488070.1| PREDICTED: peroxidase-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383856116|ref|XP_003703556.1| PREDICTED: peroxidase-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307209899|gb|EFN86678.1| Peroxidase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|328776817|ref|XP_623940.3| PREDICTED: peroxidase [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|91078176|ref|XP_967241.1| PREDICTED: similar to AGAP010734-PA [Tribolium castaneum] gi|270002725|gb|EEZ99172.1| hypothetical protein TcasGA2_TC000175 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|380021230|ref|XP_003694474.1| PREDICTED: peroxidase-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 152 | ||||||
| FB|FBgn0038511 | 753 | CG5873 [Drosophila melanogaste | 0.394 | 0.079 | 0.491 | 7.8e-14 | |
| FB|FBgn0004577 | 690 | Pxd "Peroxidase" [Drosophila m | 0.414 | 0.091 | 0.555 | 1.5e-13 | |
| FB|FBgn0263986 | 830 | cd "cardinal" [Drosophila mela | 0.296 | 0.054 | 0.577 | 9e-13 | |
| FB|FBgn0261987 | 809 | Pxt "Peroxinectin-like" [Droso | 0.302 | 0.056 | 0.586 | 1.3e-12 | |
| UNIPROTKB|P82600 | 790 | pxt "Chorion peroxidase" [Aede | 0.532 | 0.102 | 0.428 | 5.7e-12 | |
| UNIPROTKB|F1M335 | 1317 | F1M335 "Uncharacterized protei | 0.519 | 0.059 | 0.445 | 9.5e-12 | |
| MGI|MGI:1916925 | 1475 | Pxdn "peroxidasin homolog (Dro | 0.519 | 0.053 | 0.445 | 1.1e-11 | |
| WB|WBGene00016700 | 1537 | C46A5.4 [Caenorhabditis elegan | 0.532 | 0.052 | 0.393 | 3.8e-09 | |
| FB|FBgn0032685 | 1394 | CG10211 [Drosophila melanogast | 0.440 | 0.048 | 0.4 | 3.4e-08 | |
| WB|WBGene00011530 | 1490 | T06D8.10 [Caenorhabditis elega | 0.381 | 0.038 | 0.448 | 2.2e-09 |
| FB|FBgn0038511 CG5873 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 152 (58.6 bits), Expect = 7.8e-14, Sum P(2) = 7.8e-14
Identities = 30/61 (49%), Positives = 41/61 (67%)
Query: 43 KHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVVTHWMDA-SLVYGS 101
+HNR+AT L +N HWDDETL+QEAR+I IA H+ + E+LPI++ M+ LV
Sbjct: 398 EHNRLATALAQINKHWDDETLFQEARRINIAIVQHVTFNEFLPILLGKEVMEKFGLVLQK 457
Query: 102 D 102
D
Sbjct: 458 D 458
|
|
| FB|FBgn0004577 Pxd "Peroxidase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0263986 cd "cardinal" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0261987 Pxt "Peroxinectin-like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P82600 pxt "Chorion peroxidase" [Aedes aegypti (taxid:7159)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M335 F1M335 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1916925 Pxdn "peroxidasin homolog (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00016700 C46A5.4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032685 CG10211 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00011530 T06D8.10 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 152 | |||
| cd09823 | 378 | cd09823, peroxinectin_like, peroxinectin_like anim | 2e-25 | |
| pfam03098 | 521 | pfam03098, An_peroxidase, Animal haem peroxidase | 9e-22 | |
| cd09826 | 440 | cd09826, peroxidasin_like, Animal heme peroxidase | 2e-17 | |
| cd09823 | 378 | cd09823, peroxinectin_like, peroxinectin_like anim | 3e-17 | |
| pfam03098 | 521 | pfam03098, An_peroxidase, Animal haem peroxidase | 6e-16 | |
| cd05396 | 370 | cd05396, An_peroxidase_like, Animal heme peroxidas | 1e-15 | |
| cd09824 | 411 | cd09824, myeloperoxidase_like, Myeloperoxidases, e | 9e-14 | |
| cd09825 | 565 | cd09825, thyroid_peroxidase, Thyroid peroxidase (T | 3e-13 | |
| cd09822 | 420 | cd09822, peroxinectin_like_bacterial, Uncharacteri | 4e-11 | |
| cd09820 | 558 | cd09820, dual_peroxidase_like, Dual oxidase and re | 2e-10 | |
| cd09816 | 490 | cd09816, prostaglandin_endoperoxide_synthase, Anim | 4e-09 | |
| cd05396 | 370 | cd05396, An_peroxidase_like, Animal heme peroxidas | 2e-08 | |
| cd09824 | 411 | cd09824, myeloperoxidase_like, Myeloperoxidases, e | 1e-07 | |
| cd09826 | 440 | cd09826, peroxidasin_like, Animal heme peroxidase | 1e-06 | |
| cd09822 | 420 | cd09822, peroxinectin_like_bacterial, Uncharacteri | 2e-06 | |
| cd09818 | 484 | cd09818, PIOX_like, Animal heme oxidases similar t | 3e-05 | |
| cd09825 | 565 | cd09825, thyroid_peroxidase, Thyroid peroxidase (T | 2e-04 | |
| cd09820 | 558 | cd09820, dual_peroxidase_like, Dual oxidase and re | 7e-04 | |
| cd09818 | 484 | cd09818, PIOX_like, Animal heme oxidases similar t | 0.001 | |
| PLN02283 | 633 | PLN02283, PLN02283, alpha-dioxygenase | 0.003 |
| >gnl|CDD|188655 cd09823, peroxinectin_like, peroxinectin_like animal heme peroxidases | Back alignment and domain information |
|---|
Score = 99.2 bits (248), Expect = 2e-25
Identities = 30/45 (66%), Positives = 36/45 (80%)
Query: 44 HNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVV 88
HNRIA L LNPHWDDE L+QEARKI+IA+ HI Y E+LPI++
Sbjct: 90 HNRIADELKKLNPHWDDERLFQEARKIVIAQMQHITYNEFLPILL 134
|
Peroxinectin is an arthropod protein that plays a role in invertebrate immunity mechanisms. Specifically, peroxinectins are secreted as cell-adhesive and opsonic peroxidases. The immunity mechanism appears to involve an interaction between peroxinectin and a transmembrane receptor of the integrin family. Human myeloperoxidase, which is included in this wider family, has also been reported to interact with integrins. Length = 378 |
| >gnl|CDD|217366 pfam03098, An_peroxidase, Animal haem peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|188658 cd09826, peroxidasin_like, Animal heme peroxidase domain of peroxidasin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188655 cd09823, peroxinectin_like, peroxinectin_like animal heme peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|217366 pfam03098, An_peroxidase, Animal haem peroxidase | Back alignment and domain information |
|---|
| >gnl|CDD|188647 cd05396, An_peroxidase_like, Animal heme peroxidases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188656 cd09824, myeloperoxidase_like, Myeloperoxidases, eosinophil peroxidases, and lactoperoxidases | Back alignment and domain information |
|---|
| >gnl|CDD|188657 cd09825, thyroid_peroxidase, Thyroid peroxidase (TPO) | Back alignment and domain information |
|---|
| >gnl|CDD|188654 cd09822, peroxinectin_like_bacterial, Uncharacterized family of heme peroxidases, mostly bacterial | Back alignment and domain information |
|---|
| >gnl|CDD|188652 cd09820, dual_peroxidase_like, Dual oxidase and related animal heme peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|188648 cd09816, prostaglandin_endoperoxide_synthase, Animal prostaglandin endoperoxide synthase and related bacterial proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188647 cd05396, An_peroxidase_like, Animal heme peroxidases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188656 cd09824, myeloperoxidase_like, Myeloperoxidases, eosinophil peroxidases, and lactoperoxidases | Back alignment and domain information |
|---|
| >gnl|CDD|188658 cd09826, peroxidasin_like, Animal heme peroxidase domain of peroxidasin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188654 cd09822, peroxinectin_like_bacterial, Uncharacterized family of heme peroxidases, mostly bacterial | Back alignment and domain information |
|---|
| >gnl|CDD|188650 cd09818, PIOX_like, Animal heme oxidases similar to plant pathogen-inducible oxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|188657 cd09825, thyroid_peroxidase, Thyroid peroxidase (TPO) | Back alignment and domain information |
|---|
| >gnl|CDD|188652 cd09820, dual_peroxidase_like, Dual oxidase and related animal heme peroxidases | Back alignment and domain information |
|---|
| >gnl|CDD|188650 cd09818, PIOX_like, Animal heme oxidases similar to plant pathogen-inducible oxygenases | Back alignment and domain information |
|---|
| >gnl|CDD|177921 PLN02283, PLN02283, alpha-dioxygenase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 152 | |||
| KOG2408|consensus | 719 | 99.94 | ||
| PF03098 | 530 | An_peroxidase: Animal haem peroxidase; InterPro: I | 99.93 | |
| PLN02283 | 633 | alpha-dioxygenase | 99.86 | |
| KOG2408|consensus | 719 | 99.08 | ||
| PF03098 | 530 | An_peroxidase: Animal haem peroxidase; InterPro: I | 98.1 | |
| PLN02283 | 633 | alpha-dioxygenase | 97.64 |
| >KOG2408|consensus | Back alignment and domain information |
|---|
Probab=99.94 E-value=6.1e-28 Score=217.63 Aligned_cols=116 Identities=40% Similarity=0.613 Sum_probs=95.1
Q ss_pred CCCCCcccCCCCCeeeecccCccccCCCCCCCCCchhhchh---------------------------------------
Q psy8808 1 MPDDDPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQ--------------------------------------- 41 (152)
Q Consensus 1 vp~~D~~~~~~~~~c~~~~Rs~~~~~~~c~~~~~~r~q~n~--------------------------------------- 41 (152)
||++||+|...+ .||+|+||.+++..++..+ +|||+|+
T Consensus 267 ~p~~dp~~~~~~-~C~~f~Rs~~~~~~~~~~~--~reQlNq~T~~lD~S~IYGss~~~~~~lR~f~~~~g~l~~~~~~~~ 343 (719)
T KOG2408|consen 267 IPPNDPYFPSNQ-RCLPFVRSLPACGSGYNLG--PREQLNQLTSFLDASVIYGSSDEDARKLRLFKDGKGLLRVDTGLFE 343 (719)
T ss_pred cCCCCCccCCcc-cceeceecCCCccccccCC--hhhhhccccccccchhccCCCHHHHHHHhcccCcccceeecccccc
Confidence 689999998755 9999999999965444555 9999998
Q ss_pred -------------------------------------------------hHHHHHHHHhhhcCCCCCchHHHHHHHHHHH
Q psy8808 42 -------------------------------------------------VKHNRIATVLGHLNPHWDDETLYQEARKILI 72 (152)
Q Consensus 42 -------------------------------------------------r~HN~~a~~l~~~~p~w~de~lf~~aR~i~~ 72 (152)
|||||||.+|+..||||+||+||||||||++
T Consensus 344 ~~~~~lP~~~~~~~~c~~~~~~~~~~cf~aGD~R~~~~pgL~~~hti~lREHNRiA~~Lk~~np~W~dE~lfQeaRkI~~ 423 (719)
T KOG2408|consen 344 NGRPLLPFSTDPPNSCRSKPPGAPKPCFTAGDERANEQPGLAALHTLFLREHNRIATELKALNPHWSDERLFQEARKIVG 423 (719)
T ss_pred cCcccCCCCCCCCccccccCCCCCCcccccCccccccCcchHHHHHHHHHHHHHHHHHHHhhCCCCcHHHHHHHHHHHHH
Confidence 9999999999999999999999999999999
Q ss_pred Hhhcccccccchhhhhhhccc-ccccc--------CCCCHHHHHhhcccCCCeEEE
Q psy8808 73 AEYSHINYYEWLPIVVVTHWM-DASLV--------YGSDDELAAKLREFNGGRLAV 119 (152)
Q Consensus 73 a~~q~I~~~e~lP~lLgt~~i-D~sl~--------ygss~~~a~~lR~f~~G~L~~ 119 (152)
|++|||||+||||.+||..+- ..|.. .+.+.+++.++.+|.++++.-
T Consensus 424 A~~q~Ity~e~LP~ilG~~~~~~~g~~~gY~~~~dp~IsneFataAfRfgHsli~~ 479 (719)
T KOG2408|consen 424 AQVQHITYNEYLPKLLGAPLKVSLGGYRGYDPNVDPTISNEFATAAFRFGHSLIPP 479 (719)
T ss_pred HHHhhhhHHhhhhhhcCcccccCCccccCcCCCCChhhhhhhhHHHHhhhcccCch
Confidence 999999999999999994433 22333 233345566666677776664
|
|
| >PF03098 An_peroxidase: Animal haem peroxidase; InterPro: IPR002007 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions | Back alignment and domain information |
|---|
| >PLN02283 alpha-dioxygenase | Back alignment and domain information |
|---|
| >KOG2408|consensus | Back alignment and domain information |
|---|
| >PF03098 An_peroxidase: Animal haem peroxidase; InterPro: IPR002007 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions | Back alignment and domain information |
|---|
| >PLN02283 alpha-dioxygenase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 152 | ||||
| 3f9p_C | 467 | Crystal Structure Of Myeloperoxidase From Human Leu | 7e-10 | ||
| 1myp_C | 466 | X-Ray Crystal Structure Of Canine Myeloperoxidase A | 8e-10 | ||
| 1cxp_C | 466 | Cryogenic Crystal Structure Of Human Myeloperoxidas | 8e-10 | ||
| 2ikc_A | 595 | Crystal Structure Of Sheep Lactoperoxidase At 3.25 | 2e-09 | ||
| 2ikc_A | 595 | Crystal Structure Of Sheep Lactoperoxidase At 3.25 | 8e-05 | ||
| 3r5q_A | 595 | Crystal Structure Of Sheep Lactoperoxidase In Compl | 2e-09 | ||
| 3r5q_A | 595 | Crystal Structure Of Sheep Lactoperoxidase In Compl | 1e-04 | ||
| 2e9e_A | 595 | Crystal Structure Of The Complex Of Goat Lactoperox | 2e-09 | ||
| 2e9e_A | 595 | Crystal Structure Of The Complex Of Goat Lactoperox | 7e-05 | ||
| 2r5l_A | 595 | Crystal Structure Of Lactoperoxidase At 2.4a Resolu | 2e-09 | ||
| 2r5l_A | 595 | Crystal Structure Of Lactoperoxidase At 2.4a Resolu | 9e-05 | ||
| 2gjm_A | 583 | Crystal Structure Of Buffalo Lactoperoxidase At 2.7 | 7e-09 | ||
| 2gj1_A | 583 | Crystal Structure Of Bovine Lactoperoxidase At 2.3a | 7e-09 | ||
| 3erh_A | 595 | First Structural Evidence Of Substrate Specificity | 7e-09 | ||
| 2ips_A | 595 | Crystal Structure Of A Ternary Complex Of Bovine La | 8e-09 | ||
| 2pt3_A | 595 | Crystal Structure Of Bovine Lactoperoxidase At 2.34 | 8e-09 | ||
| 2z5z_A | 595 | Crystal Structure Of The Complex Of Buffalo Lactope | 1e-08 | ||
| 2o86_A | 595 | Crystal Structure Of A Ternary Complex Of Buffalo L | 1e-08 | ||
| 1ebv_A | 551 | Ovine Pghs-1 Complexed With Salicyl Hydroxamic Acid | 9e-05 | ||
| 1ht5_A | 551 | The 2.75 Angstrom Resolution Model Of Ovine Cox-1 C | 9e-05 | ||
| 3n8w_B | 553 | Crystal Structure Of R120qNATIVE CYCLOOXYGENASE-1 H | 9e-05 | ||
| 3n8y_B | 553 | Structure Of Aspirin Acetylated Cyclooxygenase-1 In | 9e-05 | ||
| 1diy_A | 553 | Crystal Structure Of Arachidonic Acid Bound In The | 1e-04 | ||
| 1pge_A | 576 | Prostaglandin H2 Synthase-1 Complexed With P-(2'-Io | 1e-04 | ||
| 2oye_P | 600 | Indomethacin-(r)-alpha-ethyl-ethanolamide Bound To | 1e-04 | ||
| 1pth_A | 576 | The Structural Basis Of Aspirin Activity Inferred F | 1e-04 | ||
| 1cqe_A | 580 | Prostaglandin H2 Synthase-1 Complex With Flurbiprof | 1e-04 | ||
| 1ddx_A | 552 | Crystal Structure Of A Mixture Of Arachidonic Acid | 2e-04 | ||
| 3rr3_A | 560 | Structure Of (R)-Flurbiprofen Bound To Mcox-2 Lengt | 2e-04 | ||
| 3mdl_A | 587 | X-Ray Crystal Structure Of 1-Arachidonoyl Glycerol | 2e-04 | ||
| 3tzi_A | 593 | X-Ray Crystal Structure Of Arachidonic Acid Bound I | 2e-04 | ||
| 3olt_A | 592 | X-Ray Crystal Structure Of Arachidonic Acid Bound T | 2e-04 | ||
| 3krk_A | 591 | X-Ray Crystal Structure Of Arachidonic Acid Bound I | 2e-04 | ||
| 3hs5_A | 591 | X-Ray Crystal Structure Of Arachidonic Acid Bound T | 2e-04 | ||
| 3nt1_A | 587 | High Resolution Structure Of Naproxen:cox-2 Complex | 2e-04 | ||
| 1pxx_A | 604 | Crystal Structure Of Diclofenac Bound To The Cycloo | 2e-04 | ||
| 3qh0_A | 610 | X-Ray Crystal Structure Of Palmitic Acid Bound To T | 2e-04 | ||
| 1u67_A | 600 | Crystal Structure Of Arachidonic Acid Bound To A Mu | 3e-04 |
| >pdb|3F9P|C Chain C, Crystal Structure Of Myeloperoxidase From Human Leukocytes Length = 467 | Back alignment and structure |
|
| >pdb|1MYP|C Chain C, X-Ray Crystal Structure Of Canine Myeloperoxidase At 3 Angstroms Resolution Length = 466 | Back alignment and structure |
| >pdb|1CXP|C Chain C, Cryogenic Crystal Structure Of Human Myeloperoxidase Isoform C Length = 466 | Back alignment and structure |
| >pdb|2IKC|A Chain A, Crystal Structure Of Sheep Lactoperoxidase At 3.25 A Resolution Reveals The Binding Sites For Formate Length = 595 | Back alignment and structure |
| >pdb|2IKC|A Chain A, Crystal Structure Of Sheep Lactoperoxidase At 3.25 A Resolution Reveals The Binding Sites For Formate Length = 595 | Back alignment and structure |
| >pdb|3R5Q|A Chain A, Crystal Structure Of Sheep Lactoperoxidase In Complex With Tetrahydrofuran At 2.7 A Resolution Length = 595 | Back alignment and structure |
| >pdb|3R5Q|A Chain A, Crystal Structure Of Sheep Lactoperoxidase In Complex With Tetrahydrofuran At 2.7 A Resolution Length = 595 | Back alignment and structure |
| >pdb|2E9E|A Chain A, Crystal Structure Of The Complex Of Goat Lactoperoxidase With Nitrate At 3.25 A Resolution Length = 595 | Back alignment and structure |
| >pdb|2E9E|A Chain A, Crystal Structure Of The Complex Of Goat Lactoperoxidase With Nitrate At 3.25 A Resolution Length = 595 | Back alignment and structure |
| >pdb|2R5L|A Chain A, Crystal Structure Of Lactoperoxidase At 2.4a Resolution Length = 595 | Back alignment and structure |
| >pdb|2R5L|A Chain A, Crystal Structure Of Lactoperoxidase At 2.4a Resolution Length = 595 | Back alignment and structure |
| >pdb|2GJM|A Chain A, Crystal Structure Of Buffalo Lactoperoxidase At 2.75a Resolution Length = 583 | Back alignment and structure |
| >pdb|2GJ1|A Chain A, Crystal Structure Of Bovine Lactoperoxidase At 2.3a Resolution Length = 583 | Back alignment and structure |
| >pdb|3ERH|A Chain A, First Structural Evidence Of Substrate Specificity In Mammalian Peroxidases: Crystal Structures Of Substrate Complexes With Lactoperoxidases From Two Different Species Length = 595 | Back alignment and structure |
| >pdb|2IPS|A Chain A, Crystal Structure Of A Ternary Complex Of Bovine Lactoperoxidase With Thiocyanate And Iodide At 3.1 A Resolution Length = 595 | Back alignment and structure |
| >pdb|2PT3|A Chain A, Crystal Structure Of Bovine Lactoperoxidase At 2.34 A Resolution Reveals Multiple Anion Binding Sites Length = 595 | Back alignment and structure |
| >pdb|2Z5Z|A Chain A, Crystal Structure Of The Complex Of Buffalo Lactoperoxidase With Fluoride Ion At 3.5a Resolution Length = 595 | Back alignment and structure |
| >pdb|2O86|A Chain A, Crystal Structure Of A Ternary Complex Of Buffalo Lactoperoxidase With Nitrate And Iodide At 2.8 A Resolution Length = 595 | Back alignment and structure |
| >pdb|1EBV|A Chain A, Ovine Pghs-1 Complexed With Salicyl Hydroxamic Acid Length = 551 | Back alignment and structure |
| >pdb|1HT5|A Chain A, The 2.75 Angstrom Resolution Model Of Ovine Cox-1 Complexed With Methyl Ester Flurbiprofen Length = 551 | Back alignment and structure |
| >pdb|3N8W|B Chain B, Crystal Structure Of R120qNATIVE CYCLOOXYGENASE-1 Heterodimer Mutant In Complex With Flurbiprofen Length = 553 | Back alignment and structure |
| >pdb|3N8Y|B Chain B, Structure Of Aspirin Acetylated Cyclooxygenase-1 In Complex With Diclofenac Length = 553 | Back alignment and structure |
| >pdb|1DIY|A Chain A, Crystal Structure Of Arachidonic Acid Bound In The Cyclooxygenase Active Site Of Pghs-1 Length = 553 | Back alignment and structure |
| >pdb|1PGE|A Chain A, Prostaglandin H2 Synthase-1 Complexed With P-(2'-Iodo-5'-Thenoyl) Hydrotropic Acid (Iodosuprofen) Length = 576 | Back alignment and structure |
| >pdb|2OYE|P Chain P, Indomethacin-(r)-alpha-ethyl-ethanolamide Bound To Cyclooxygenase-1 Length = 600 | Back alignment and structure |
| >pdb|1PTH|A Chain A, The Structural Basis Of Aspirin Activity Inferred From The Crystal Structure Of Inactivated Prostaglandin H2 Synthase Length = 576 | Back alignment and structure |
| >pdb|1CQE|A Chain A, Prostaglandin H2 Synthase-1 Complex With Flurbiprofen Length = 580 | Back alignment and structure |
| >pdb|1DDX|A Chain A, Crystal Structure Of A Mixture Of Arachidonic Acid And Prostaglandin Bound To The Cyclooxygenase Active Site Of Cox-2: Prostaglandin Structure Length = 552 | Back alignment and structure |
| >pdb|3RR3|A Chain A, Structure Of (R)-Flurbiprofen Bound To Mcox-2 Length = 560 | Back alignment and structure |
| >pdb|3MDL|A Chain A, X-Ray Crystal Structure Of 1-Arachidonoyl Glycerol Bound To The Cyclooxygenase Channel Of Cyclooxygenase-2 Length = 587 | Back alignment and structure |
| >pdb|3TZI|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound In The Cyclooxygenase Channel Of G533v Murine Cox-2 Length = 593 | Back alignment and structure |
| >pdb|3OLT|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound To The Cyclooxygenase Channel Of R513h Murine Cox-2 Length = 592 | Back alignment and structure |
| >pdb|3KRK|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound In The Cyclooxygenase Channel Of L531f Murine Cox-2 Length = 591 | Back alignment and structure |
| >pdb|3HS5|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound To The Cyclooxygenase Channel Of Cyclooxygenase-2 Length = 591 | Back alignment and structure |
| >pdb|3NT1|A Chain A, High Resolution Structure Of Naproxen:cox-2 Complex. Length = 587 | Back alignment and structure |
| >pdb|1PXX|A Chain A, Crystal Structure Of Diclofenac Bound To The Cyclooxygenase Active Site Of Cox-2 Length = 604 | Back alignment and structure |
| >pdb|3QH0|A Chain A, X-Ray Crystal Structure Of Palmitic Acid Bound To The Cyclooxygenase Channel Of Cyclooxygenase-2 Length = 610 | Back alignment and structure |
| >pdb|1U67|A Chain A, Crystal Structure Of Arachidonic Acid Bound To A Mutant Of Prostagladin H Synthase-1 That Forms Predominantly 11-hpete Length = 600 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 152 | |||
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 1e-18 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 1e-11 | |
| 1d2v_C | 466 | Myeloperoxidase; heme-protein, oxidoreductase, per | 4e-18 | |
| 1d2v_C | 466 | Myeloperoxidase; heme-protein, oxidoreductase, per | 1e-12 | |
| 3q9k_A | 595 | Lactoperoxidase, LPO; bovine lactoperoxidase, oxid | 4e-18 | |
| 3q9k_A | 595 | Lactoperoxidase, LPO; bovine lactoperoxidase, oxid | 9e-07 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 1e-17 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 3e-12 |
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 | Back alignment and structure |
|---|
Score = 80.5 bits (198), Expect = 1e-18
Identities = 19/65 (29%), Positives = 31/65 (47%)
Query: 30 NPGYTPAEQMIQVKHNRIATVLGHLNPHWDDETLYQEARKILIAEYSHINYYEWLPIVVV 89
PG + +HNR+ +L +P W DE L+Q +R ILI E I +++ +
Sbjct: 264 VPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSG 323
Query: 90 THWMD 94
H+
Sbjct: 324 YHFKL 328
|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 | Back alignment and structure |
|---|
| >1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* Length = 466 | Back alignment and structure |
|---|
| >1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* Length = 466 | Back alignment and structure |
|---|
| >3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... Length = 595 | Back alignment and structure |
|---|
| >3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... Length = 595 | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 152 | |||
| 3q9k_A | 595 | Lactoperoxidase, LPO; bovine lactoperoxidase, oxid | 99.96 | |
| 1d2v_C | 466 | Myeloperoxidase; heme-protein, oxidoreductase, per | 99.96 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 99.78 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 99.78 | |
| 3q9k_A | 595 | Lactoperoxidase, LPO; bovine lactoperoxidase, oxid | 98.96 | |
| 1d2v_C | 466 | Myeloperoxidase; heme-protein, oxidoreductase, per | 98.95 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 98.48 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 98.37 |
| >3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... | Back alignment and structure |
|---|
Probab=99.96 E-value=7.7e-30 Score=225.26 Aligned_cols=115 Identities=32% Similarity=0.446 Sum_probs=96.2
Q ss_pred CCCCCcccCCCCCeeeecccCccccCCCCCCCCCchhhchh---------------------------------------
Q psy8808 1 MPDDDPVYSKFRQVCMNFVRSTTDIDQGCNPGYTPAEQMIQ--------------------------------------- 41 (152)
Q Consensus 1 vp~~D~~~~~~~~~c~~~~Rs~~~~~~~c~~~~~~r~q~n~--------------------------------------- 41 (152)
||++||+|...+ .||+|+||.+++. +|.+++.+|||||+
T Consensus 144 ip~~Dp~~~~~~-~Cm~f~RS~~~~~-~~~~~~~~reQiN~~Ts~lD~S~VYGss~~~~~~LR~~~~~~G~Lk~~~~~~~ 221 (595)
T 3q9k_A 144 FPKNDPKLKTQG-KCMPFFRAGFVCP-TPPYQSLAREQINAVTSFLDASLVYGSEPSLASRLRNLSSPLGLMAVNQEAWD 221 (595)
T ss_dssp CCTTCHHHHHSC-SEECCBCBCBSSC-SSCCCSSCCCBEECSCSSSSCHHHHCSSHHHHHHTBCCSSTTCCBCCCSSCCB
T ss_pred CCCCCCcccCCC-ceeEeecCCCcCC-CCCCCcchHhhhccccceeeeeeccCCCHHHHHHHhCCCCCCceeecccccCC
Confidence 799999996555 4999999999865 46665569999998
Q ss_pred -------------------------------------------------hHHHHHHHHhhhcCCCCCchHHHHHHHHHHH
Q psy8808 42 -------------------------------------------------VKHNRIATVLGHLNPHWDDETLYQEARKILI 72 (152)
Q Consensus 42 -------------------------------------------------r~HN~~a~~l~~~~p~w~de~lf~~aR~i~~ 72 (152)
|||||||++|+++||+|+||+|||+||+|||
T Consensus 222 ~g~~~lP~~~~~~~~c~~~~~~~~~~cf~aGD~R~ne~p~L~~lhtlflREHNria~~L~~~nP~W~dE~LfQeAR~Iv~ 301 (595)
T 3q9k_A 222 HGLAYLPFNNKKPSPCEFINTTARVPCFLAGDFRASEQILLATAHTLLLREHNRLARELKKLNPHWNGEKLYQEARKILG 301 (595)
T ss_dssp TTBCCCCBCCCSSCHHHHTCTTTCCCCBCCSSTTTTSBHHHHHHHHHHHHHHHHHHHHHHHHCTTCCHHHHHHHHHHHHH
T ss_pred CCccCCCCCCCCCCcccccCCCCCCcccccCCccccccHHHHHHHHHHHHHHHHHHHHHHhhCCCCCHHHHHHHHHHHHH
Confidence 9999999999999999999999999999999
Q ss_pred Hhhcccccccchhhhhhhcc---c------cccccCCCCHHHHHhhcccCCCeEE
Q psy8808 73 AEYSHINYYEWLPIVVVTHW---M------DASLVYGSDDELAAKLREFNGGRLA 118 (152)
Q Consensus 73 a~~q~I~~~e~lP~lLgt~~---i------D~sl~ygss~~~a~~lR~f~~G~L~ 118 (152)
|++|||||+||||.|||..+ + +.++.++.+.++ +++.+|.+.++.
T Consensus 302 A~~Q~Ity~E~LP~ilG~~~~~~~~~~~gY~~~v~p~i~neF-~aafRfgHsli~ 355 (595)
T 3q9k_A 302 AFIQIITFRDYLPIVLGSEMQKWIPPYQGYNNSVDPRISNVF-TFAFRFGHMEVP 355 (595)
T ss_dssp HHHHHHHHHTHHHHHHGGGHHHHSCSCCCCCTTSCCCCBTTH-HHHGGGGGGGCC
T ss_pred HHeeeeeHHHHHHHHhCchhhhhCCCccCCCCCCCCccHHHH-HHHHHhHHhhCc
Confidence 99999999999999999872 1 234456666788 777777655443
|
| >1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... | Back alignment and structure |
|---|
| >1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 152 | ||||
| g1cxp.1 | 570 | a.93.1.2 (A:,C:) Myeloperoxidase {Human (Homo sapi | 2e-18 | |
| g1cxp.1 | 570 | a.93.1.2 (A:,C:) Myeloperoxidase {Human (Homo sapi | 8e-07 | |
| d1q4ga1 | 511 | a.93.1.2 (A:74-584) Prostaglandin H2 synthase {She | 6e-18 | |
| d1q4ga1 | 511 | a.93.1.2 (A:74-584) Prostaglandin H2 synthase {She | 2e-12 | |
| d1cvua1 | 511 | a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mou | 6e-17 | |
| d1cvua1 | 511 | a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mou | 2e-12 |
| >d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Length = 511 | Back information, alignment and structure |
|---|
| >d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Length = 511 | Back information, alignment and structure |
|---|
| >d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Length = 511 | Back information, alignment and structure |
|---|
| >d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Length = 511 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 152 | |||
| g1cxp.1 | 570 | Myeloperoxidase {Human (Homo sapiens) [TaxId: 9606 | 99.95 | |
| d1q4ga1 | 511 | Prostaglandin H2 synthase {Sheep (Ovis aries) [Tax | 99.78 | |
| d1cvua1 | 511 | Prostaglandin H2 synthase {Mouse (Mus musculus) [T | 99.78 | |
| g1cxp.1 | 570 | Myeloperoxidase {Human (Homo sapiens) [TaxId: 9606 | 98.53 | |
| d1cvua1 | 511 | Prostaglandin H2 synthase {Mouse (Mus musculus) [T | 98.44 | |
| d1q4ga1 | 511 | Prostaglandin H2 synthase {Sheep (Ovis aries) [Tax | 98.43 |
| >d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|