Psyllid ID: psy8831


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MILTFGIREQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAPEKIMPPIESMISRNGDALSVITSTPNIHHSDD
cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccc
cEEEcccccccHHHccccEEEcccccccccEcccccccccccccHHHEHcccccccccccccccccEEcccccHcccccccccccccc
miltfgireqtgnkrsgvscancsttcttlwrrnnngepvcnacglimntvdinapekimppiesmisrngdalsvitstpnihhsdd
miltfgireqtgnkrsgvscanCSTTCttlwrrnnnGEPVCNACGLIMNTVDINAPEKIMPPIESMISRNGDALSVItstpnihhsdd
MILTFGIREQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAPEKIMPPIESMISRNGDALSVITSTPNIHHSDD
****************GVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAPEKI*****************************
**********************CSTTCTTLWRRNNNGEPVCNACGLIMNTVDI***********************************
MILTFGIREQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAPEKIMPPIESMISRNGDALSVITSTPNIHHSDD
********EQT***R*GVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAPEKI*****************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILTFGIREQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAPEKIMPPIESMISRNGDALSVITSTPNIHHSDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
Q91428438 Transcription factor GATA yes N/A 0.556 0.111 0.612 4e-12
P23773435 GATA-binding factor 3 OS= N/A N/A 0.556 0.112 0.612 4e-12
P23825444 GATA-binding factor 3 OS= yes N/A 0.534 0.105 0.612 5e-12
P91623486 GATA-binding factor C OS= yes N/A 0.534 0.096 0.638 5e-12
Q08DV0443 Trans-acting T-cell-speci yes N/A 0.545 0.108 0.612 2e-11
P23772443 Trans-acting T-cell-speci yes N/A 0.556 0.110 0.612 2e-11
P23771443 Trans-acting T-cell-speci yes N/A 0.545 0.108 0.612 3e-11
P43691 380 Transcription factor GATA no N/A 0.556 0.128 0.591 3e-11
Q91677392 Transcription factor GATA N/A N/A 0.556 0.125 0.591 3e-11
O09100480 Endothelial transcription no N/A 0.556 0.102 0.571 5e-11
>sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 Back     alignment and function desciption
 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%)

Query: 8   REQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAP 56
           R  +  +R+G SCANC TT TTLWRRN NG+PVCNACGL     +IN P
Sbjct: 298 RRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRP 346





Danio rerio (taxid: 7955)
>sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 Back     alignment and function description
>sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 Back     alignment and function description
>sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 Back     alignment and function description
>sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 Back     alignment and function description
>sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 Back     alignment and function description
>sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 Back     alignment and function description
>sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 Back     alignment and function description
>sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 Back     alignment and function description
>sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
328721860 637 PREDICTED: hypothetical protein LOC10016 0.545 0.075 0.75 1e-14
345491204 737 PREDICTED: hypothetical protein LOC10012 0.511 0.061 0.717 2e-12
357609511 633 GATA transcription factor GATAc [Danaus 0.488 0.067 0.739 6e-12
157125526 719 transcription factor GATA-4 (GATA bindin 0.511 0.062 0.688 8e-12
56900908 719 GATA transcription factor GATAc [Aedes a 0.511 0.062 0.688 9e-12
170043916 578 GATA transcription factor GATAc [Culex q 0.511 0.077 0.666 1e-11
383863207 703 PREDICTED: uncharacterized protein LOC10 0.522 0.065 0.695 1e-11
54262117 567 GATA transcription factor e [Strongyloce 0.556 0.086 0.591 3e-11
37781291 644 GATA transcription factor alpha [Patiria 0.556 0.076 0.612 3e-11
347967441 747 AGAP002236-PA [Anopheles gambiae str. PE 0.511 0.060 0.688 4e-11
>gi|328721860|ref|XP_001943307.2| PREDICTED: hypothetical protein LOC100166174 isoform 1 [Acyrthosiphon pisum] gi|328721862|ref|XP_003247419.1| PREDICTED: hypothetical protein LOC100166174 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%)

Query: 9   EQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAP 56
           +QTGNKRSGV+CANCST  TTLWRRNNNGEPVCNACGL     ++N P
Sbjct: 464 QQTGNKRSGVACANCSTNTTTLWRRNNNGEPVCNACGLYFKLHNVNRP 511




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345491204|ref|XP_001607832.2| PREDICTED: hypothetical protein LOC100124020 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357609511|gb|EHJ66491.1| GATA transcription factor GATAc [Danaus plexippus] Back     alignment and taxonomy information
>gi|157125526|ref|XP_001654370.1| transcription factor GATA-4 (GATA binding factor-4) [Aedes aegypti] gi|108873605|gb|EAT37830.1| AAEL010224-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|56900908|gb|AAW31747.1| GATA transcription factor GATAc [Aedes aegypti] Back     alignment and taxonomy information
>gi|170043916|ref|XP_001849613.1| GATA transcription factor GATAc [Culex quinquefasciatus] gi|167867188|gb|EDS30571.1| GATA transcription factor GATAc [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|383863207|ref|XP_003707073.1| PREDICTED: uncharacterized protein LOC100875315 [Megachile rotundata] Back     alignment and taxonomy information
>gi|54262117|ref|NP_001005725.1| GATA transcription factor e [Strongylocentrotus purpuratus] gi|52001519|gb|AAU21562.1| GATA transcription factor [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|37781291|gb|AAP35028.1| GATA transcription factor alpha [Patiria miniata] Back     alignment and taxonomy information
>gi|347967441|ref|XP_001230593.3| AGAP002236-PA [Anopheles gambiae str. PEST] gi|333466294|gb|EAU77738.3| AGAP002236-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
UNIPROTKB|P43695390 gata5-a "GATA-binding factor 5 0.522 0.117 0.543 4.3e-13
UNIPROTKB|P23771443 GATA3 "Trans-acting T-cell-spe 0.875 0.173 0.455 1.7e-12
UNIPROTKB|D4A2N9438 Gata4 "Transcription factor GA 0.556 0.111 0.591 2.4e-12
RGD|2665 440 Gata4 "GATA binding protein 4" 0.556 0.111 0.591 2.5e-12
UNIPROTKB|P46152 440 Gata4 "Transcription factor GA 0.556 0.111 0.591 2.5e-12
UNIPROTKB|D2HDE5412 PANDA_008702 "Putative unchara 0.852 0.182 0.454 3e-12
FB|FBgn0001138486 grn "grain" [Drosophila melano 0.534 0.096 0.638 3.3e-12
ZFIN|ZDB-GENE-990415-82438 gata3 "GATA-binding protein 3" 0.875 0.175 0.455 3.5e-12
UNIPROTKB|F1RUM8442 GATA3 "Uncharacterized protein 0.852 0.169 0.454 3.5e-12
UNIPROTKB|Q08DV0443 GATA3 "Trans-acting T-cell-spe 0.852 0.169 0.454 3.5e-12
UNIPROTKB|P43695 gata5-a "GATA-binding factor 5-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 152 (58.6 bits), Expect = 4.3e-13, Sum P(3) = 4.3e-13
 Identities = 25/46 (54%), Positives = 33/46 (71%)

Query:    11 TGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAP 56
             + ++R+G+ C NC T+ TTLWRRN+ GEPVCNACGL M    +  P
Sbjct:   228 SSSRRAGLCCTNCHTSTTTLWRRNSEGEPVCNACGLYMKLHGVPRP 273


GO:0005634 "nucleus" evidence=IDA
GO:0044212 "transcription regulatory region DNA binding" evidence=IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
UNIPROTKB|P23771 GATA3 "Trans-acting T-cell-specific transcription factor GATA-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4A2N9 Gata4 "Transcription factor GATA-4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2665 Gata4 "GATA binding protein 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P46152 Gata4 "Transcription factor GATA-4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D2HDE5 PANDA_008702 "Putative uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] Back     alignment and assigned GO terms
FB|FBgn0001138 grn "grain" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-82 gata3 "GATA-binding protein 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUM8 GATA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DV0 GATA3 "Trans-acting T-cell-specific transcription factor GATA-3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P91623GATAC_DROMENo assigned EC number0.63820.53400.0967yesN/A
P23772GATA3_MOUSENo assigned EC number0.61220.55680.1106yesN/A
P23771GATA3_HUMANNo assigned EC number0.61220.54540.1083yesN/A
Q91428GATA3_DANRENo assigned EC number0.61220.55680.1118yesN/A
Q08DV0GATA3_BOVINNo assigned EC number0.61220.54540.1083yesN/A
P23825GATA3_CHICKNo assigned EC number0.61220.53400.1058yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
smart0040152 smart00401, ZnF_GATA, zinc finger binding to DNA c 8e-10
pfam0032036 pfam00320, GATA, GATA zinc finger 6e-09
cd0020254 cd00202, ZnF_GATA, Zinc finger DNA binding domain; 1e-08
>gnl|CDD|214648 smart00401, ZnF_GATA, zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
 Score = 49.3 bits (118), Expect = 8e-10
 Identities = 20/33 (60%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 15 RSGVSCANCSTTCTTLWRRNNNGE-PVCNACGL 46
           SG SC+NC TT T LWRR  +G   +CNACGL
Sbjct: 1  GSGRSCSNCGTTETPLWRRGPSGNKTLCNACGL 33


Length = 52

>gnl|CDD|109380 pfam00320, GATA, GATA zinc finger Back     alignment and domain information
>gnl|CDD|238123 cd00202, ZnF_GATA, Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
cd0020254 ZnF_GATA Zinc finger DNA binding domain; binds spe 99.71
smart0040152 ZnF_GATA zinc finger binding to DNA consensus sequ 99.67
PF0032036 GATA: GATA zinc finger; InterPro: IPR000679 Zinc f 99.62
COG5641 498 GAT1 GATA Zn-finger-containing transcription facto 98.98
KOG1601|consensus340 98.95
COG5641 498 GAT1 GATA Zn-finger-containing transcription facto 94.5
KOG3554|consensus 693 93.87
PF01412116 ArfGap: Putative GTPase activating protein for Arf 88.68
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 88.19
COG5347 319 GTPase-activating protein that regulates ARFs (ADP 86.72
smart00105112 ArfGap Putative GTP-ase activating proteins for th 85.77
PRK03988138 translation initiation factor IF-2 subunit beta; V 82.23
TIGR00311133 aIF-2beta translation initiation factor aIF-2, bet 81.62
smart00653110 eIF2B_5 domain present in translation initiation f 81.62
KOG3740|consensus 706 81.45
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
Probab=99.71  E-value=6.3e-18  Score=101.84  Aligned_cols=43  Identities=42%  Similarity=0.853  Sum_probs=39.2

Q ss_pred             ccccCCCCCCCccccCCCCC-CccchhHHHHhhhCCCCCCccCC
Q psy8831          19 SCANCSTTCTTLWRRNNNGE-PVCNACGLIMNTVDINAPEKIMP   61 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl~~~~~~~~Rp~~~~~   61 (88)
                      .|+||++++||+||++++|. .|||||||||++++..||.....
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~~rp~~~~~   44 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRK   44 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCCCCCcccCc
Confidence            59999999999999999544 99999999999999999998864



>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>KOG1601|consensus Back     alignment and domain information
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>KOG3554|consensus Back     alignment and domain information
>PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>PRK03988 translation initiation factor IF-2 subunit beta; Validated Back     alignment and domain information
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative Back     alignment and domain information
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5 Back     alignment and domain information
>KOG3740|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
4hc7_A115 Crystal Structure Of The Full Dna Binding Domain Of 5e-12
3dfv_D63 Adjacent Gata Dna Binding Length = 63 6e-12
3gat_A66 Solution Nmr Structure Of The C-Terminal Domain Of 3e-09
1gat_A60 Solution Structure Of The Specific Dna Complex Of T 4e-09
4gat_A66 Solution Nmr Structure Of The Wild Type Dna Binding 2e-06
7gat_A66 Solution Nmr Structure Of The L22v Mutant Dna Bindi 4e-06
2vus_I43 Crystal Structure Of Unliganded Nmra-Area Zinc Fing 5e-06
3vd6_C119 Both Zn Fingers Of Gata1 Bound To Palindromic Dna R 1e-05
1y0j_A46 Zinc Fingers As Protein Recognition Motifs: Structu 2e-04
1gnf_A46 Solution Structure Of The N-Terminal Zinc Finger Of 2e-04
2l6y_A39 Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 7e-04
>pdb|4HC7|A Chain A, Crystal Structure Of The Full Dna Binding Domain Of Gata3-Complex 2 Length = 115 Back     alignment and structure

Iteration: 1

Score = 66.2 bits (160), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 30/49 (61%), Positives = 35/49 (71%) Query: 8 REQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAP 56 R + +R+G SCANC TT TTLWRRN NG+PVCNACGL +IN P Sbjct: 50 RRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRP 98
>pdb|3DFV|D Chain D, Adjacent Gata Dna Binding Length = 63 Back     alignment and structure
>pdb|3GAT|A Chain A, Solution Nmr Structure Of The C-Terminal Domain Of Chicken Gata-1 Bound To Dna, 34 Structures Length = 66 Back     alignment and structure
>pdb|1GAT|A Chain A, Solution Structure Of The Specific Dna Complex Of The Zinc Containing Dna Binding Domain Of The Erythroid Transcription Factor Gata-1 By Multidimensional Nmr Length = 60 Back     alignment and structure
>pdb|4GAT|A Chain A, Solution Nmr Structure Of The Wild Type Dna Binding Domain Of Area Complexed To A 13bp Dna Containing A Cgata Site, Regularized Mean Structure Length = 66 Back     alignment and structure
>pdb|7GAT|A Chain A, Solution Nmr Structure Of The L22v Mutant Dna Binding Domain Of Area Complexed To A 13 Bp Dna Containing A Tgata Site, 34 Structures Length = 66 Back     alignment and structure
>pdb|2VUS|I Chain I, Crystal Structure Of Unliganded Nmra-Area Zinc Finger Complex Length = 43 Back     alignment and structure
>pdb|3VD6|C Chain C, Both Zn Fingers Of Gata1 Bound To Palindromic Dna Recognition Site, P21 Crystal Form Length = 119 Back     alignment and structure
>pdb|1Y0J|A Chain A, Zinc Fingers As Protein Recognition Motifs: Structural Basis For The Gata-1FRIEND OF GATA INTERACTION Length = 46 Back     alignment and structure
>pdb|1GNF|A Chain A, Solution Structure Of The N-Terminal Zinc Finger Of Murine Gata-1, Nmr, 25 Structures Length = 46 Back     alignment and structure
>pdb|2L6Y|A Chain A, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 39 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 9e-13
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 1e-12
3dfx_A63 Trans-acting T-cell-specific transcription factor 2e-12
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 1e-11
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 5e-10
3k1f_M 197 Transcription initiation factor IIB; RNA polymeras 4e-07
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Length = 46 Back     alignment and structure
 Score = 55.9 bits (135), Expect = 9e-13
 Identities = 16/31 (51%), Positives = 18/31 (58%)

Query: 16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGL 46
              C NC  T T LWRR+  G  +CNACGL
Sbjct: 3  EARECVNCGATATPLWRRDRTGHYLCNACGL 33


>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Length = 66 Back     alignment and structure
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Length = 63 Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Length = 43 Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Length = 71 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
3dfx_A63 Trans-acting T-cell-specific transcription factor 99.85
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 99.85
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 99.84
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 99.83
4hc9_A115 Trans-acting T-cell-specific transcription factor; 99.78
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 99.77
4hc9_A115 Trans-acting T-cell-specific transcription factor; 99.7
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 89.66
3k7a_M 345 Transcription initiation factor IIB; RNA polymeras 87.09
2owa_A138 Arfgap-like finger domain containing protein; zinc 86.6
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 86.31
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 85.53
1k81_A36 EIF-2-beta, probable translation initiation factor 84.61
3cw2_K139 Translation initiation factor 2 subunit beta; AIF2 84.44
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 84.04
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 83.97
2d74_B148 Translation initiation factor 2 beta subunit; prot 83.04
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 81.15
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 81.15
2b0o_E 301 UPLC1; arfgap, structural genomics, structural gen 80.09
1nee_A138 EIF-2-beta, probable translation initiation factor 80.02
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Back     alignment and structure
Probab=99.85  E-value=4.4e-22  Score=122.84  Aligned_cols=56  Identities=52%  Similarity=0.908  Sum_probs=48.9

Q ss_pred             CCCCCcccccCCCCCCCccccCCCCCCccchhHHHHhhhCCCCCCccCCCchhhcc
Q psy8831          13 NKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAPEKIMPPIESMIS   68 (88)
Q Consensus        13 ~~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~~Rp~~~~~~~~~~~~   68 (88)
                      .......|++|++++||+||+|++|++|||||||||++++..||+.+.....+...
T Consensus         3 ~~~~~~~C~~C~tt~Tp~WR~gp~G~~LCNACGl~~~~~~~~RP~~~~~~~i~~R~   58 (63)
T 3dfx_A            3 ARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRN   58 (63)
T ss_dssp             CCCTTCCCTTTCCSCCSSCCCCTTSCCCCHHHHHHHHHHSSCCCGGGCCSSCCCCC
T ss_pred             CCCCCCcCCCcCCCCCCccCCCCCCCchhhHHHHHHHHcCCCCCcCcCCCcccccc
Confidence            45678899999999999999999999999999999999999999998755444333



>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Back     alignment and structure
>4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 Back     alignment and structure
>3cw2_K Translation initiation factor 2 subunit beta; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2nxu_A 2qmu_C* 3v11_C* Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Back     alignment and structure
>2d74_B Translation initiation factor 2 beta subunit; protein complex; 2.80A {Pyrococcus furiosus} PDB: 2dcu_B* Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1nee_A EIF-2-beta, probable translation initiation factor 2 beta subunit; two domain protein, mixed alpha-beta structure; NMR {Methanothermobacterthermautotrophicus} SCOP: d.241.1.1 g.59.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 88
d3gata_66 g.39.1.1 (A:) Erythroid transcription factor GATA- 5e-13
d1y0ja139 g.39.1.1 (A:200-238) Erythroid transcription facto 3e-11
d2vuti142 g.39.1.1 (I:671-712) Erythroid transcription facto 5e-11
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 66 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Erythroid transcription factor GATA-1
domain: Erythroid transcription factor GATA-1
species: Chicken (Gallus gallus) [TaxId: 9031]
 Score = 56.1 bits (135), Expect = 5e-13
 Identities = 24/43 (55%), Positives = 30/43 (69%)

Query: 14 KRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAP 56
          KR+G  C+NC T+ TTLWRR+  G+PVCNACGL      +N P
Sbjct: 1  KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRP 43


>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Length = 42 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d2vuti142 Erythroid transcription factor GATA-1 {Emericella 99.88
d3gata_66 Erythroid transcription factor GATA-1 {Chicken (Ga 99.86
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 99.82
d1neea237 Zinc-binding domain of translation initiation fact 92.73
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 92.67
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 91.54
d1k81a_36 Zinc-binding domain of translation initiation fact 89.47
d1dcqa2122 Pyk2-associated protein beta ARF-GAP domain {Mouse 89.13
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Erythroid transcription factor GATA-1
domain: Erythroid transcription factor GATA-1
species: Emericella nidulans [TaxId: 162425]
Probab=99.88  E-value=1e-23  Score=119.77  Aligned_cols=41  Identities=46%  Similarity=1.048  Sum_probs=39.4

Q ss_pred             ccccCCCCCCCccccCCCCCCccchhHHHHhhhCCCCCCcc
Q psy8831          19 SCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAPEKI   59 (88)
Q Consensus        19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~~Rp~~~   59 (88)
                      .|+||++++||+||++++|.+|||||||||++|++.||+.+
T Consensus         2 ~C~nC~tt~Tp~WRr~~~G~~lCNACGl~~k~~g~~RP~sl   42 (42)
T d2vuti1           2 TCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLSL   42 (42)
T ss_dssp             CCSSSCCCCCSCCEECTTSCEECHHHHHHHHHHSSCCCCCC
T ss_pred             cCCCCCCCCCccceeCCCCCCchhhhhHHHHHcCCCCCCCC
Confidence            69999999999999999999999999999999999999864



>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure