Psyllid ID: psy8831
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 88 | ||||||
| 328721860 | 637 | PREDICTED: hypothetical protein LOC10016 | 0.545 | 0.075 | 0.75 | 1e-14 | |
| 345491204 | 737 | PREDICTED: hypothetical protein LOC10012 | 0.511 | 0.061 | 0.717 | 2e-12 | |
| 357609511 | 633 | GATA transcription factor GATAc [Danaus | 0.488 | 0.067 | 0.739 | 6e-12 | |
| 157125526 | 719 | transcription factor GATA-4 (GATA bindin | 0.511 | 0.062 | 0.688 | 8e-12 | |
| 56900908 | 719 | GATA transcription factor GATAc [Aedes a | 0.511 | 0.062 | 0.688 | 9e-12 | |
| 170043916 | 578 | GATA transcription factor GATAc [Culex q | 0.511 | 0.077 | 0.666 | 1e-11 | |
| 383863207 | 703 | PREDICTED: uncharacterized protein LOC10 | 0.522 | 0.065 | 0.695 | 1e-11 | |
| 54262117 | 567 | GATA transcription factor e [Strongyloce | 0.556 | 0.086 | 0.591 | 3e-11 | |
| 37781291 | 644 | GATA transcription factor alpha [Patiria | 0.556 | 0.076 | 0.612 | 3e-11 | |
| 347967441 | 747 | AGAP002236-PA [Anopheles gambiae str. PE | 0.511 | 0.060 | 0.688 | 4e-11 |
| >gi|328721860|ref|XP_001943307.2| PREDICTED: hypothetical protein LOC100166174 isoform 1 [Acyrthosiphon pisum] gi|328721862|ref|XP_003247419.1| PREDICTED: hypothetical protein LOC100166174 isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 83.6 bits (205), Expect = 1e-14, Method: Compositional matrix adjust.
Identities = 36/48 (75%), Positives = 40/48 (83%)
Query: 9 EQTGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAP 56
+QTGNKRSGV+CANCST TTLWRRNNNGEPVCNACGL ++N P
Sbjct: 464 QQTGNKRSGVACANCSTNTTTLWRRNNNGEPVCNACGLYFKLHNVNRP 511
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|345491204|ref|XP_001607832.2| PREDICTED: hypothetical protein LOC100124020 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|357609511|gb|EHJ66491.1| GATA transcription factor GATAc [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|157125526|ref|XP_001654370.1| transcription factor GATA-4 (GATA binding factor-4) [Aedes aegypti] gi|108873605|gb|EAT37830.1| AAEL010224-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|56900908|gb|AAW31747.1| GATA transcription factor GATAc [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170043916|ref|XP_001849613.1| GATA transcription factor GATAc [Culex quinquefasciatus] gi|167867188|gb|EDS30571.1| GATA transcription factor GATAc [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|383863207|ref|XP_003707073.1| PREDICTED: uncharacterized protein LOC100875315 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|54262117|ref|NP_001005725.1| GATA transcription factor e [Strongylocentrotus purpuratus] gi|52001519|gb|AAU21562.1| GATA transcription factor [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|37781291|gb|AAP35028.1| GATA transcription factor alpha [Patiria miniata] | Back alignment and taxonomy information |
|---|
| >gi|347967441|ref|XP_001230593.3| AGAP002236-PA [Anopheles gambiae str. PEST] gi|333466294|gb|EAU77738.3| AGAP002236-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 88 | ||||||
| UNIPROTKB|P43695 | 390 | gata5-a "GATA-binding factor 5 | 0.522 | 0.117 | 0.543 | 4.3e-13 | |
| UNIPROTKB|P23771 | 443 | GATA3 "Trans-acting T-cell-spe | 0.875 | 0.173 | 0.455 | 1.7e-12 | |
| UNIPROTKB|D4A2N9 | 438 | Gata4 "Transcription factor GA | 0.556 | 0.111 | 0.591 | 2.4e-12 | |
| RGD|2665 | 440 | Gata4 "GATA binding protein 4" | 0.556 | 0.111 | 0.591 | 2.5e-12 | |
| UNIPROTKB|P46152 | 440 | Gata4 "Transcription factor GA | 0.556 | 0.111 | 0.591 | 2.5e-12 | |
| UNIPROTKB|D2HDE5 | 412 | PANDA_008702 "Putative unchara | 0.852 | 0.182 | 0.454 | 3e-12 | |
| FB|FBgn0001138 | 486 | grn "grain" [Drosophila melano | 0.534 | 0.096 | 0.638 | 3.3e-12 | |
| ZFIN|ZDB-GENE-990415-82 | 438 | gata3 "GATA-binding protein 3" | 0.875 | 0.175 | 0.455 | 3.5e-12 | |
| UNIPROTKB|F1RUM8 | 442 | GATA3 "Uncharacterized protein | 0.852 | 0.169 | 0.454 | 3.5e-12 | |
| UNIPROTKB|Q08DV0 | 443 | GATA3 "Trans-acting T-cell-spe | 0.852 | 0.169 | 0.454 | 3.5e-12 |
| UNIPROTKB|P43695 gata5-a "GATA-binding factor 5-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Score = 152 (58.6 bits), Expect = 4.3e-13, Sum P(3) = 4.3e-13
Identities = 25/46 (54%), Positives = 33/46 (71%)
Query: 11 TGNKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAP 56
+ ++R+G+ C NC T+ TTLWRRN+ GEPVCNACGL M + P
Sbjct: 228 SSSRRAGLCCTNCHTSTTTLWRRNSEGEPVCNACGLYMKLHGVPRP 273
|
|
| UNIPROTKB|P23771 GATA3 "Trans-acting T-cell-specific transcription factor GATA-3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A2N9 Gata4 "Transcription factor GATA-4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|2665 Gata4 "GATA binding protein 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P46152 Gata4 "Transcription factor GATA-4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D2HDE5 PANDA_008702 "Putative uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0001138 grn "grain" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-990415-82 gata3 "GATA-binding protein 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RUM8 GATA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q08DV0 GATA3 "Trans-acting T-cell-specific transcription factor GATA-3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 88 | |||
| smart00401 | 52 | smart00401, ZnF_GATA, zinc finger binding to DNA c | 8e-10 | |
| pfam00320 | 36 | pfam00320, GATA, GATA zinc finger | 6e-09 | |
| cd00202 | 54 | cd00202, ZnF_GATA, Zinc finger DNA binding domain; | 1e-08 |
| >gnl|CDD|214648 smart00401, ZnF_GATA, zinc finger binding to DNA consensus sequence [AT]GATA[AG] | Back alignment and domain information |
|---|
Score = 49.3 bits (118), Expect = 8e-10
Identities = 20/33 (60%), Positives = 23/33 (69%), Gaps = 1/33 (3%)
Query: 15 RSGVSCANCSTTCTTLWRRNNNGE-PVCNACGL 46
SG SC+NC TT T LWRR +G +CNACGL
Sbjct: 1 GSGRSCSNCGTTETPLWRRGPSGNKTLCNACGL 33
|
Length = 52 |
| >gnl|CDD|109380 pfam00320, GATA, GATA zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|238123 cd00202, ZnF_GATA, Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| cd00202 | 54 | ZnF_GATA Zinc finger DNA binding domain; binds spe | 99.71 | |
| smart00401 | 52 | ZnF_GATA zinc finger binding to DNA consensus sequ | 99.67 | |
| PF00320 | 36 | GATA: GATA zinc finger; InterPro: IPR000679 Zinc f | 99.62 | |
| COG5641 | 498 | GAT1 GATA Zn-finger-containing transcription facto | 98.98 | |
| KOG1601|consensus | 340 | 98.95 | ||
| COG5641 | 498 | GAT1 GATA Zn-finger-containing transcription facto | 94.5 | |
| KOG3554|consensus | 693 | 93.87 | ||
| PF01412 | 116 | ArfGap: Putative GTPase activating protein for Arf | 88.68 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 88.19 | |
| COG5347 | 319 | GTPase-activating protein that regulates ARFs (ADP | 86.72 | |
| smart00105 | 112 | ArfGap Putative GTP-ase activating proteins for th | 85.77 | |
| PRK03988 | 138 | translation initiation factor IF-2 subunit beta; V | 82.23 | |
| TIGR00311 | 133 | aIF-2beta translation initiation factor aIF-2, bet | 81.62 | |
| smart00653 | 110 | eIF2B_5 domain present in translation initiation f | 81.62 | |
| KOG3740|consensus | 706 | 81.45 |
| >cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C | Back alignment and domain information |
|---|
Probab=99.71 E-value=6.3e-18 Score=101.84 Aligned_cols=43 Identities=42% Similarity=0.853 Sum_probs=39.2
Q ss_pred ccccCCCCCCCccccCCCCC-CccchhHHHHhhhCCCCCCccCC
Q psy8831 19 SCANCSTTCTTLWRRNNNGE-PVCNACGLIMNTVDINAPEKIMP 61 (88)
Q Consensus 19 ~C~nC~tt~Tp~WRrg~~G~-~lCNaCgl~~~~~~~~Rp~~~~~ 61 (88)
.|+||++++||+||++++|. .|||||||||++++..||.....
T Consensus 1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~~rp~~~~~ 44 (54)
T cd00202 1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKRK 44 (54)
T ss_pred CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCCCCCcccCc
Confidence 59999999999999999544 99999999999999999998864
|
|
| >smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] | Back alignment and domain information |
|---|
| >PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG1601|consensus | Back alignment and domain information |
|---|
| >COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG3554|consensus | Back alignment and domain information |
|---|
| >PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF | Back alignment and domain information |
|---|
| >PRK03988 translation initiation factor IF-2 subunit beta; Validated | Back alignment and domain information |
|---|
| >TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative | Back alignment and domain information |
|---|
| >smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5 | Back alignment and domain information |
|---|
| >KOG3740|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 88 | ||||
| 4hc7_A | 115 | Crystal Structure Of The Full Dna Binding Domain Of | 5e-12 | ||
| 3dfv_D | 63 | Adjacent Gata Dna Binding Length = 63 | 6e-12 | ||
| 3gat_A | 66 | Solution Nmr Structure Of The C-Terminal Domain Of | 3e-09 | ||
| 1gat_A | 60 | Solution Structure Of The Specific Dna Complex Of T | 4e-09 | ||
| 4gat_A | 66 | Solution Nmr Structure Of The Wild Type Dna Binding | 2e-06 | ||
| 7gat_A | 66 | Solution Nmr Structure Of The L22v Mutant Dna Bindi | 4e-06 | ||
| 2vus_I | 43 | Crystal Structure Of Unliganded Nmra-Area Zinc Fing | 5e-06 | ||
| 3vd6_C | 119 | Both Zn Fingers Of Gata1 Bound To Palindromic Dna R | 1e-05 | ||
| 1y0j_A | 46 | Zinc Fingers As Protein Recognition Motifs: Structu | 2e-04 | ||
| 1gnf_A | 46 | Solution Structure Of The N-Terminal Zinc Finger Of | 2e-04 | ||
| 2l6y_A | 39 | Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = | 7e-04 |
| >pdb|4HC7|A Chain A, Crystal Structure Of The Full Dna Binding Domain Of Gata3-Complex 2 Length = 115 | Back alignment and structure |
|
| >pdb|3DFV|D Chain D, Adjacent Gata Dna Binding Length = 63 | Back alignment and structure |
| >pdb|3GAT|A Chain A, Solution Nmr Structure Of The C-Terminal Domain Of Chicken Gata-1 Bound To Dna, 34 Structures Length = 66 | Back alignment and structure |
| >pdb|1GAT|A Chain A, Solution Structure Of The Specific Dna Complex Of The Zinc Containing Dna Binding Domain Of The Erythroid Transcription Factor Gata-1 By Multidimensional Nmr Length = 60 | Back alignment and structure |
| >pdb|4GAT|A Chain A, Solution Nmr Structure Of The Wild Type Dna Binding Domain Of Area Complexed To A 13bp Dna Containing A Cgata Site, Regularized Mean Structure Length = 66 | Back alignment and structure |
| >pdb|7GAT|A Chain A, Solution Nmr Structure Of The L22v Mutant Dna Binding Domain Of Area Complexed To A 13 Bp Dna Containing A Tgata Site, 34 Structures Length = 66 | Back alignment and structure |
| >pdb|2VUS|I Chain I, Crystal Structure Of Unliganded Nmra-Area Zinc Finger Complex Length = 43 | Back alignment and structure |
| >pdb|3VD6|C Chain C, Both Zn Fingers Of Gata1 Bound To Palindromic Dna Recognition Site, P21 Crystal Form Length = 119 | Back alignment and structure |
| >pdb|1Y0J|A Chain A, Zinc Fingers As Protein Recognition Motifs: Structural Basis For The Gata-1FRIEND OF GATA INTERACTION Length = 46 | Back alignment and structure |
| >pdb|1GNF|A Chain A, Solution Structure Of The N-Terminal Zinc Finger Of Murine Gata-1, Nmr, 25 Structures Length = 46 | Back alignment and structure |
| >pdb|2L6Y|A Chain A, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 39 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 88 | |||
| 1gnf_A | 46 | Transcription factor GATA-1; zinc finger, transcri | 9e-13 | |
| 4gat_A | 66 | Nitrogen regulatory protein AREA; DNA binding prot | 1e-12 | |
| 3dfx_A | 63 | Trans-acting T-cell-specific transcription factor | 2e-12 | |
| 2vut_I | 43 | AREA, nitrogen regulatory protein AREA; transcript | 1e-11 | |
| 2kae_A | 71 | GATA-type transcription factor; zinc finger, GATA- | 5e-10 | |
| 3k1f_M | 197 | Transcription initiation factor IIB; RNA polymeras | 4e-07 |
| >1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Length = 46 | Back alignment and structure |
|---|
Score = 55.9 bits (135), Expect = 9e-13
Identities = 16/31 (51%), Positives = 18/31 (58%)
Query: 16 SGVSCANCSTTCTTLWRRNNNGEPVCNACGL 46
C NC T T LWRR+ G +CNACGL
Sbjct: 3 EARECVNCGATATPLWRRDRTGHYLCNACGL 33
|
| >4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Length = 66 | Back alignment and structure |
|---|
| >3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Length = 63 | Back alignment and structure |
|---|
| >2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Length = 43 | Back alignment and structure |
|---|
| >2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Length = 71 | Back alignment and structure |
|---|
| >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| 3dfx_A | 63 | Trans-acting T-cell-specific transcription factor | 99.85 | |
| 4gat_A | 66 | Nitrogen regulatory protein AREA; DNA binding prot | 99.85 | |
| 2vut_I | 43 | AREA, nitrogen regulatory protein AREA; transcript | 99.84 | |
| 1gnf_A | 46 | Transcription factor GATA-1; zinc finger, transcri | 99.83 | |
| 4hc9_A | 115 | Trans-acting T-cell-specific transcription factor; | 99.78 | |
| 2kae_A | 71 | GATA-type transcription factor; zinc finger, GATA- | 99.77 | |
| 4hc9_A | 115 | Trans-acting T-cell-specific transcription factor; | 99.7 | |
| 1dl6_A | 58 | Transcription factor II B (TFIIB); zinc ribbon, ge | 89.66 | |
| 3k7a_M | 345 | Transcription initiation factor IIB; RNA polymeras | 87.09 | |
| 2owa_A | 138 | Arfgap-like finger domain containing protein; zinc | 86.6 | |
| 2iqj_A | 134 | Stromal membrane-associated protein 1-like; zinc, | 86.31 | |
| 2crr_A | 141 | Stromal membrane-associated protein SMAP1B; arfgap | 85.53 | |
| 1k81_A | 36 | EIF-2-beta, probable translation initiation factor | 84.61 | |
| 3cw2_K | 139 | Translation initiation factor 2 subunit beta; AIF2 | 84.44 | |
| 2crw_A | 149 | ARF GAP 3, ADP-ribosylation factor GTPase-activati | 84.04 | |
| 3dwd_A | 147 | ADP-ribosylation factor GTPase-activating protein; | 83.97 | |
| 2d74_B | 148 | Translation initiation factor 2 beta subunit; prot | 83.04 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 81.15 | |
| 2p57_A | 144 | GTPase-activating protein ZNF289; zinc finger, GAP | 81.15 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 80.09 | |
| 1nee_A | 138 | EIF-2-beta, probable translation initiation factor | 80.02 |
| >3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* | Back alignment and structure |
|---|
Probab=99.85 E-value=4.4e-22 Score=122.84 Aligned_cols=56 Identities=52% Similarity=0.908 Sum_probs=48.9
Q ss_pred CCCCCcccccCCCCCCCccccCCCCCCccchhHHHHhhhCCCCCCccCCCchhhcc
Q psy8831 13 NKRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAPEKIMPPIESMIS 68 (88)
Q Consensus 13 ~~~~~~~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~~Rp~~~~~~~~~~~~ 68 (88)
.......|++|++++||+||+|++|++|||||||||++++..||+.+.....+...
T Consensus 3 ~~~~~~~C~~C~tt~Tp~WR~gp~G~~LCNACGl~~~~~~~~RP~~~~~~~i~~R~ 58 (63)
T 3dfx_A 3 ARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRN 58 (63)
T ss_dssp CCCTTCCCTTTCCSCCSSCCCCTTSCCCCHHHHHHHHHHSSCCCGGGCCSSCCCCC
T ss_pred CCCCCCcCCCcCCCCCCccCCCCCCCchhhHHHHHHHHcCCCCCcCcCCCcccccc
Confidence 45678899999999999999999999999999999999999999998755444333
|
| >4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* | Back alignment and structure |
|---|
| >2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* | Back alignment and structure |
|---|
| >1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A | Back alignment and structure |
|---|
| >4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A | Back alignment and structure |
|---|
| >2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A | Back alignment and structure |
|---|
| >1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A | Back alignment and structure |
|---|
| >3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 | Back alignment and structure |
|---|
| >3cw2_K Translation initiation factor 2 subunit beta; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2nxu_A 2qmu_C* 3v11_C* | Back alignment and structure |
|---|
| >2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2d74_B Translation initiation factor 2 beta subunit; protein complex; 2.80A {Pyrococcus furiosus} PDB: 2dcu_B* | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1nee_A EIF-2-beta, probable translation initiation factor 2 beta subunit; two domain protein, mixed alpha-beta structure; NMR {Methanothermobacterthermautotrophicus} SCOP: d.241.1.1 g.59.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 88 | ||||
| d3gata_ | 66 | g.39.1.1 (A:) Erythroid transcription factor GATA- | 5e-13 | |
| d1y0ja1 | 39 | g.39.1.1 (A:200-238) Erythroid transcription facto | 3e-11 | |
| d2vuti1 | 42 | g.39.1.1 (I:671-712) Erythroid transcription facto | 5e-11 |
| >d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 66 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Erythroid transcription factor GATA-1 domain: Erythroid transcription factor GATA-1 species: Chicken (Gallus gallus) [TaxId: 9031]
Score = 56.1 bits (135), Expect = 5e-13
Identities = 24/43 (55%), Positives = 30/43 (69%)
Query: 14 KRSGVSCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAP 56
KR+G C+NC T+ TTLWRR+ G+PVCNACGL +N P
Sbjct: 1 KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRP 43
|
| >d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 | Back information, alignment and structure |
|---|
| >d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Length = 42 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| d2vuti1 | 42 | Erythroid transcription factor GATA-1 {Emericella | 99.88 | |
| d3gata_ | 66 | Erythroid transcription factor GATA-1 {Chicken (Ga | 99.86 | |
| d1y0ja1 | 39 | Erythroid transcription factor GATA-1 {Mouse (Mus | 99.82 | |
| d1neea2 | 37 | Zinc-binding domain of translation initiation fact | 92.73 | |
| d1dl6a_ | 58 | Transcription initiation factor TFIIB, N-terminal | 92.67 | |
| d1pfta_ | 50 | Transcription initiation factor TFIIB, N-terminal | 91.54 | |
| d1k81a_ | 36 | Zinc-binding domain of translation initiation fact | 89.47 | |
| d1dcqa2 | 122 | Pyk2-associated protein beta ARF-GAP domain {Mouse | 89.13 |
| >d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Erythroid transcription factor GATA-1 domain: Erythroid transcription factor GATA-1 species: Emericella nidulans [TaxId: 162425]
Probab=99.88 E-value=1e-23 Score=119.77 Aligned_cols=41 Identities=46% Similarity=1.048 Sum_probs=39.4
Q ss_pred ccccCCCCCCCccccCCCCCCccchhHHHHhhhCCCCCCcc
Q psy8831 19 SCANCSTTCTTLWRRNNNGEPVCNACGLIMNTVDINAPEKI 59 (88)
Q Consensus 19 ~C~nC~tt~Tp~WRrg~~G~~lCNaCgl~~~~~~~~Rp~~~ 59 (88)
.|+||++++||+||++++|.+|||||||||++|++.||+.+
T Consensus 2 ~C~nC~tt~Tp~WRr~~~G~~lCNACGl~~k~~g~~RP~sl 42 (42)
T d2vuti1 2 TCTNCFTQTTPLWRRNPEGQPLCNACGLFLKLHGVVRPLSL 42 (42)
T ss_dssp CCSSSCCCCCSCCEECTTSCEECHHHHHHHHHHSSCCCCCC
T ss_pred cCCCCCCCCCccceeCCCCCCchhhhhHHHHHcCCCCCCCC
Confidence 69999999999999999999999999999999999999864
|
| >d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|