Psyllid ID: psy885
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 270 | ||||||
| 328718401 | 1005 | PREDICTED: calcium-transporting ATPase s | 0.892 | 0.239 | 0.745 | 1e-98 | |
| 157113753 | 999 | calcium-transporting atpase sarcoplasmic | 0.892 | 0.241 | 0.745 | 1e-98 | |
| 157113755 | 1019 | calcium-transporting atpase sarcoplasmic | 0.892 | 0.236 | 0.745 | 1e-98 | |
| 157113751 | 998 | calcium-transporting atpase sarcoplasmic | 0.892 | 0.241 | 0.745 | 1e-98 | |
| 4191598 | 1000 | sarco(endo)plasmic reticulum-type calciu | 0.892 | 0.241 | 0.737 | 5e-98 | |
| 328785449 | 1018 | PREDICTED: calcium-transporting ATPase s | 0.851 | 0.225 | 0.770 | 5e-98 | |
| 350403500 | 1002 | PREDICTED: calcium-transporting ATPase s | 0.885 | 0.238 | 0.754 | 5e-98 | |
| 380022760 | 1018 | PREDICTED: LOW QUALITY PROTEIN: calcium- | 0.851 | 0.225 | 0.770 | 6e-98 | |
| 357615523 | 1025 | sarco/endoplasmic reticulum calcium ATPa | 0.892 | 0.235 | 0.741 | 6e-98 | |
| 332020025 | 981 | Calcium-transporting ATPase sarcoplasmic | 0.851 | 0.234 | 0.766 | 1e-97 |
| >gi|328718401|ref|XP_001943129.2| PREDICTED: calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type-like isoform 1 [Acyrthosiphon pisum] gi|328718403|ref|XP_003246477.1| PREDICTED: calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 365 bits (937), Expect = 1e-98, Method: Compositional matrix adjust.
Identities = 187/251 (74%), Positives = 204/251 (81%), Gaps = 10/251 (3%)
Query: 14 NPPNHCVSFSGRREQAIAVRQDVETKWKKEFTLEFSRDRKSMSSYCTPLKSSKLGSSGPK 73
NP N S RR AI V+QD+ETKWKKEFTLEFSRDRKSMSSYCTP+K +KLG+ GPK
Sbjct: 456 NPNNVSKSGLDRRTTAIVVKQDIETKWKKEFTLEFSRDRKSMSSYCTPIKPTKLGN-GPK 514
Query: 74 LFVKGAPEGVLERCTHARIGSQKVSLKDFSANTRFENLR-------SLEPKSKVSAIVPW 126
LFVKGAPEGVLERCTHAR+GSQKV L N E R +L + ++ P
Sbjct: 515 LFVKGAPEGVLERCTHARVGSQKVPLTSALKNRILELTRKYGTGRDTLRCLALATSDSP- 573
Query: 127 GMKPEDMNLADSTKFASYEVNLTFVGVVGMLDPPRKEVFDSIARCRAAGIRVIVITGDNK 186
KPE M+L DS KF +YEVNLTFVGVVGMLDPPRKEVFDSI RCRAAGIRVIVITGDNK
Sbjct: 574 -TKPEQMDLNDSNKFHTYEVNLTFVGVVGMLDPPRKEVFDSIQRCRAAGIRVIVITGDNK 632
Query: 187 ATAEAICRRIGVFTEEEDTTGKSYSGREFDDLPLSEQKAAVARARLFSRVEPAHKSKIVE 246
ATAEAICRRIGVFTEEEDTTGKSYSGREFDDL LSEQK+AVA+ARLFSRVEP+HKSKI+E
Sbjct: 633 ATAEAICRRIGVFTEEEDTTGKSYSGREFDDLSLSEQKSAVAKARLFSRVEPSHKSKIIE 692
Query: 247 FLQGMNEISAM 257
+LQ MNEISAM
Sbjct: 693 YLQSMNEISAM 703
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157113753|ref|XP_001652085.1| calcium-transporting atpase sarcoplasmic/endoplasmic reticulum type (calcium pump) [Aedes aegypti] gi|108877603|gb|EAT41828.1| AAEL006582-PB [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157113755|ref|XP_001652086.1| calcium-transporting atpase sarcoplasmic/endoplasmic reticulum type (calcium pump) [Aedes aegypti] gi|108877604|gb|EAT41829.1| AAEL006582-PC [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157113751|ref|XP_001652084.1| calcium-transporting atpase sarcoplasmic/endoplasmic reticulum type (calcium pump) [Aedes aegypti] gi|108877602|gb|EAT41827.1| AAEL006582-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|4191598|gb|AAD09820.1| sarco(endo)plasmic reticulum-type calcium ATPase [Heliothis virescens] | Back alignment and taxonomy information |
|---|
| >gi|328785449|ref|XP_393851.3| PREDICTED: calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350403500|ref|XP_003486819.1| PREDICTED: calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380022760|ref|XP_003695205.1| PREDICTED: LOW QUALITY PROTEIN: calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|357615523|gb|EHJ69709.1| sarco/endoplasmic reticulum calcium ATPase [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|332020025|gb|EGI60476.1| Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 270 | ||||||
| UNIPROTKB|Q292Q0 | 1002 | Ca-P60A "Calcium-transporting | 0.874 | 0.235 | 0.699 | 2.5e-81 | |
| FB|FBgn0263006 | 1020 | Ca-P60A "Calcium ATPase at 60A | 0.874 | 0.231 | 0.699 | 6e-80 | |
| ZFIN|ZDB-GENE-041229-2 | 991 | atp2a1l "ATPase, Ca++ transpor | 0.822 | 0.224 | 0.605 | 1.5e-62 | |
| ZFIN|ZDB-GENE-020905-1 | 1005 | atp2a1 "ATPase, Ca++ transport | 0.781 | 0.209 | 0.581 | 9.3e-60 | |
| UNIPROTKB|P13585 | 994 | ATP2A1 "Sarcoplasmic/endoplasm | 0.851 | 0.231 | 0.546 | 3.8e-58 | |
| WB|WBGene00004736 | 1059 | sca-1 [Caenorhabditis elegans | 0.807 | 0.205 | 0.563 | 6.7e-58 | |
| UNIPROTKB|Q9DDB8 | 994 | atp2A1 "Ca2+-ATPase" [Rana syl | 0.848 | 0.230 | 0.544 | 1e-57 | |
| UNIPROTKB|Q9DDB9 | 994 | atp2A1 "Ca2+-ATPase 1" [Rana c | 0.844 | 0.229 | 0.554 | 1.7e-57 | |
| UNIPROTKB|P70083 | 996 | atp2a1 "Sarcoplasmic/endoplasm | 0.870 | 0.235 | 0.536 | 2.9e-57 | |
| UNIPROTKB|E1C8G4 | 993 | ATP2A2 "Sarcoplasmic/endoplasm | 0.855 | 0.232 | 0.533 | 1e-56 |
| UNIPROTKB|Q292Q0 Ca-P60A "Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] | Back alignment and assigned GO terms |
|---|
Score = 816 (292.3 bits), Expect = 2.5e-81, P = 2.5e-81
Identities = 172/246 (69%), Positives = 191/246 (77%)
Query: 20 VSFSG--RREQAIAVRQDVETKWKKEFTLEFSRDRKSMSSYCTXXXXXXXXXXXXXXFVK 77
V+ SG RR AIA R ++ETKWKKEFTLEFSRDRKSMSSYCT FVK
Sbjct: 457 VNKSGLDRRSNAIAARGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTGPKL-FVK 515
Query: 78 GAPEGVLERCTHARIGSQKVSL------KDFSANTRFENLRSLEPKSKVSAIVPWGMKPE 131
GAPEGVL+RCTHAR+G+ KV L K + ++ R + A+ ++PE
Sbjct: 516 GAPEGVLDRCTHARVGTSKVPLTSALKAKILALTGQYGTGRDTL-RCLALAVADSPIRPE 574
Query: 132 DMNLADSTKFASYEVNLTFVGVVGMLDPPRKEVFDSIARCRAAGIRVIVITGDNKATAEA 191
DM+L DSTKF YEVNLTFVGVVGMLDPPRKEVFD+I RCRAAGIRVIVITGDNKATAEA
Sbjct: 575 DMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDAIVRCRAAGIRVIVITGDNKATAEA 634
Query: 192 ICRRIGVFTEEEDTTGKSYSGREFDDLPLSEQKAAVARARLFSRVEPAHKSKIVEFLQGM 251
ICRRIGVFTEEEDTTGKSYSGREFDDL ++EQKAAVAR+RLFSRVEP HKSKIVE+LQGM
Sbjct: 635 ICRRIGVFTEEEDTTGKSYSGREFDDLSIAEQKAAVARSRLFSRVEPQHKSKIVEYLQGM 694
Query: 252 NEISAM 257
NEISAM
Sbjct: 695 NEISAM 700
|
|
| FB|FBgn0263006 Ca-P60A "Calcium ATPase at 60A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041229-2 atp2a1l "ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 like" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-020905-1 atp2a1 "ATPase, Ca++ transporting, cardiac muscle, fast twitch 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P13585 ATP2A1 "Sarcoplasmic/endoplasmic reticulum calcium ATPase 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00004736 sca-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9DDB8 atp2A1 "Ca2+-ATPase" [Rana sylvatica (taxid:45438)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9DDB9 atp2A1 "Ca2+-ATPase 1" [Rana clamitans (taxid:145282)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P70083 atp2a1 "Sarcoplasmic/endoplasmic reticulum calcium ATPase 1" [Makaira nigricans (taxid:13604)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8G4 ATP2A2 "Sarcoplasmic/endoplasmic reticulum calcium ATPase 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 270 | |||
| TIGR01116 | 917 | TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic retic | 6e-87 | |
| COG0474 | 917 | COG0474, MgtA, Cation transport ATPase [Inorganic | 2e-41 | |
| TIGR01494 | 543 | TIGR01494, ATPase_P-type, ATPase, P-type (transpor | 3e-27 | |
| TIGR01522 | 884 | TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium- | 8e-26 | |
| TIGR01517 | 944 | TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium- | 6e-21 | |
| TIGR01106 | 997 | TIGR01106, ATPase-IIC_X-K, sodium or proton efflux | 3e-19 | |
| PRK10517 | 902 | PRK10517, PRK10517, magnesium-transporting ATPase | 7e-19 | |
| TIGR01524 | 867 | TIGR01524, ATPase-IIIB_Mg, magnesium-translocating | 4e-17 | |
| TIGR01523 | 1053 | TIGR01523, ATPase-IID_K-Na, potassium and/or sodiu | 3e-16 | |
| TIGR01647 | 754 | TIGR01647, ATPase-IIIA_H, plasma-membrane proton-e | 5e-13 | |
| PRK15122 | 903 | PRK15122, PRK15122, magnesium-transporting ATPase; | 8e-13 | |
| pfam13246 | 91 | pfam13246, Hydrolase_like2, Putative hydrolase of | 1e-12 | |
| COG2217 | 713 | COG2217, ZntA, Cation transport ATPase [Inorganic | 2e-10 | |
| TIGR01657 | 1054 | TIGR01657, P-ATPase-V, P-type ATPase of unknown pu | 6e-09 | |
| TIGR01525 | 556 | TIGR01525, ATPase-IB_hvy, heavy metal translocatin | 2e-07 | |
| TIGR01512 | 536 | TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb | 2e-06 | |
| pfam00702 | 187 | pfam00702, Hydrolase, haloacid dehalogenase-like h | 2e-06 | |
| TIGR01511 | 572 | TIGR01511, ATPase-IB1_Cu, copper-(or silver)-trans | 2e-06 | |
| PLN03190 | 1178 | PLN03190, PLN03190, aminophospholipid translocase; | 5e-05 | |
| PRK10671 | 834 | PRK10671, copA, copper exporting ATPase; Provision | 2e-04 | |
| COG2216 | 681 | COG2216, KdpB, High-affinity K+ transport system, | 7e-04 | |
| PRK11033 | 741 | PRK11033, zntA, zinc/cadmium/mercury/lead-transpor | 7e-04 | |
| PRK01122 | 679 | PRK01122, PRK01122, potassium-transporting ATPase | 8e-04 | |
| TIGR01652 | 1057 | TIGR01652, ATPase-Plipid, phospholipid-translocati | 0.001 | |
| TIGR01497 | 675 | TIGR01497, kdpB, K+-transporting ATPase, B subunit | 0.001 |
| >gnl|CDD|233277 TIGR01116, ATPase-IIA1_Ca, sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
Score = 277 bits (709), Expect = 6e-87
Identities = 126/249 (50%), Positives = 156/249 (62%), Gaps = 12/249 (4%)
Query: 14 NPPNHCVSFSGRREQAIAVRQDVETKWKKEFTLEFSRDRKSMSSYCTPLKSSKLGSSGPK 73
P S +R A+ K+KK TLEFSRDRKSMS C P S+G K
Sbjct: 394 GLPATKNGVSSKRRPALGCNSVWNDKFKKLATLEFSRDRKSMSVLCKP-------STGNK 446
Query: 74 LFVKGAPEGVLERCTHARIG-SQKVSLKDFSANTRFENLRSLEPKSKVS----AIVPWGM 128
LFVKGAPEGVLERCTH G + V L D NT ++ + + A
Sbjct: 447 LFVKGAPEGVLERCTHILNGDGRAVPLTDKMKNTILSVIKEMGTTKALRCLALAFKDIPD 506
Query: 129 KPEDMNLADSTKFASYEVNLTFVGVVGMLDPPRKEVFDSIARCRAAGIRVIVITGDNKAT 188
E+ L+D F + E +LTF+GVVGMLDPPR EV D+I +CR AGIRVI+ITGDNK T
Sbjct: 507 PREEDLLSDPANFEAIESDLTFIGVVGMLDPPRPEVADAIEKCRTAGIRVIMITGDNKET 566
Query: 189 AEAICRRIGVFTEEEDTTGKSYSGREFDDLPLSEQKAAVARARLFSRVEPAHKSKIVEFL 248
AEAICRRIG+F+ +ED T KS++GREFD++ ++Q+AA A LFSRVEP+HKS++VE L
Sbjct: 567 AEAICRRIGIFSPDEDVTFKSFTGREFDEMGPAKQRAACRSAVLFSRVEPSHKSELVELL 626
Query: 249 QGMNEISAM 257
Q EI AM
Sbjct: 627 QEQGEIVAM 635
|
This model describes the P-type ATPase responsible for translocating calcium ions across the endoplasmic reticulum membrane of eukaryotes , and is of particular importance in the sarcoplasmic reticulum of skeletal and cardiac muscle in vertebrates. These pumps transfer Ca2+ from the cytoplasm to the lumen of the endoplasmic reticulum. In humans and mice, at least, there are multiple isoforms of the SERCA pump with overlapping but not redundant functions. Defects in SERCA isoforms are associated with diseases in humans. The calcium P-type ATPases have been characterized as Type IIA based on a phylogenetic analysis which distinguishes this group from the Type IIB PMCA calcium pump modelled by TIGR01517. A separate analysis divides Type IIA into sub-types, SERCA and PMR1 the latter of which is modelled by TIGR01522 [Transport and binding proteins, Cations and iron carrying compounds]. Length = 917 |
| >gnl|CDD|223550 COG0474, MgtA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233438 TIGR01494, ATPase_P-type, ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >gnl|CDD|130585 TIGR01522, ATPase-IIA2_Ca, golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|188151 TIGR01517, ATPase-IIB_Ca, plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|130176 TIGR01106, ATPase-IIC_X-K, sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236705 PRK10517, PRK10517, magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130587 TIGR01524, ATPase-IIIB_Mg, magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|130586 TIGR01523, ATPase-IID_K-Na, potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >gnl|CDD|233506 TIGR01647, ATPase-IIIA_H, plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|237914 PRK15122, PRK15122, magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222006 pfam13246, Hydrolase_like2, Putative hydrolase of sodium-potassium ATPase alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|225127 COG2217, ZntA, Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233513 TIGR01657, P-ATPase-V, P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >gnl|CDD|233447 TIGR01525, ATPase-IB_hvy, heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|211664 TIGR01512, ATPase-IB2_Cd, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|233445 TIGR01511, ATPase-IB1_Cu, copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|215623 PLN03190, PLN03190, aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182635 PRK10671, copA, copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225126 COG2216, KdpB, High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236827 PRK11033, zntA, zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234905 PRK01122, PRK01122, potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233509 TIGR01652, ATPase-Plipid, phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >gnl|CDD|130561 TIGR01497, kdpB, K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 270 | |||
| KOG0202|consensus | 972 | 100.0 | ||
| COG0474 | 917 | MgtA Cation transport ATPase [Inorganic ion transp | 100.0 | |
| KOG0204|consensus | 1034 | 100.0 | ||
| TIGR01657 | 1054 | P-ATPase-V P-type ATPase of unknown pump specifici | 100.0 | |
| TIGR01523 | 1053 | ATPase-IID_K-Na potassium and/or sodium efflux P-t | 100.0 | |
| KOG0208|consensus | 1140 | 100.0 | ||
| TIGR01116 | 917 | ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium | 100.0 | |
| PRK10517 | 902 | magnesium-transporting ATPase MgtA; Provisional | 100.0 | |
| TIGR01517 | 941 | ATPase-IIB_Ca plasma-membrane calcium-translocatin | 100.0 | |
| PRK15122 | 903 | magnesium-transporting ATPase; Provisional | 100.0 | |
| TIGR01106 | 997 | ATPase-IIC_X-K sodium or proton efflux -- potassiu | 100.0 | |
| PLN03190 | 1178 | aminophospholipid translocase; Provisional | 100.0 | |
| TIGR01524 | 867 | ATPase-IIIB_Mg magnesium-translocating P-type ATPa | 100.0 | |
| TIGR01652 | 1057 | ATPase-Plipid phospholipid-translocating P-type AT | 100.0 | |
| TIGR01522 | 884 | ATPase-IIA2_Ca golgi membrane calcium-translocatin | 100.0 | |
| TIGR01647 | 755 | ATPase-IIIA_H plasma-membrane proton-efflux P-type | 100.0 | |
| KOG0206|consensus | 1151 | 100.0 | ||
| KOG0203|consensus | 1019 | 100.0 | ||
| KOG0209|consensus | 1160 | 100.0 | ||
| KOG0210|consensus | 1051 | 100.0 | ||
| PRK14010 | 673 | potassium-transporting ATPase subunit B; Provision | 100.0 | |
| PRK01122 | 679 | potassium-transporting ATPase subunit B; Provision | 100.0 | |
| TIGR01497 | 675 | kdpB K+-transporting ATPase, B subunit. One sequen | 99.96 | |
| KOG0205|consensus | 942 | 99.95 | ||
| TIGR01494 | 499 | ATPase_P-type ATPase, P-type (transporting), HAD s | 99.93 | |
| COG2216 | 681 | KdpB High-affinity K+ transport system, ATPase cha | 99.91 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 99.89 | |
| KOG0207|consensus | 951 | 99.86 | ||
| PF00702 | 215 | Hydrolase: haloacid dehalogenase-like hydrolase; I | 99.82 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 99.81 | |
| TIGR01525 | 556 | ATPase-IB_hvy heavy metal translocating P-type ATP | 99.74 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 99.71 | |
| TIGR01512 | 536 | ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo | 99.67 | |
| TIGR01511 | 562 | ATPase-IB1_Cu copper-(or silver)-translocating P-t | 99.64 | |
| COG4087 | 152 | Soluble P-type ATPase [General function prediction | 99.46 | |
| PF13246 | 91 | Hydrolase_like2: Putative hydrolase of sodium-pota | 99.44 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 98.74 | |
| PF12710 | 192 | HAD: haloacid dehalogenase-like hydrolase; PDB: 3P | 98.7 | |
| COG0560 | 212 | SerB Phosphoserine phosphatase [Amino acid transpo | 98.62 | |
| KOG1615|consensus | 227 | 98.62 | ||
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 98.44 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 98.33 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 98.3 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 98.22 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 98.21 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 98.2 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 98.17 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 98.14 | |
| PLN02954 | 224 | phosphoserine phosphatase | 98.11 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 98.1 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 98.0 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 97.96 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.78 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 97.76 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 97.75 | |
| TIGR02726 | 169 | phenyl_P_delta phenylphosphate carboxylase, delta | 97.72 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 97.54 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 97.5 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 97.42 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 97.38 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 97.33 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 97.29 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 97.23 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 97.22 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 97.2 | |
| PRK08238 | 479 | hypothetical protein; Validated | 97.16 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 97.14 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 97.14 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 97.09 | |
| COG1778 | 170 | Low specificity phosphatase (HAD superfamily) [Gen | 97.07 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 97.03 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 97.03 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 96.81 | |
| TIGR01487 | 215 | SPP-like sucrose-phosphate phosphatase-like hydrol | 96.8 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 96.78 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 96.77 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 96.76 | |
| PRK06769 | 173 | hypothetical protein; Validated | 96.66 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 96.63 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 96.61 | |
| PF06888 | 234 | Put_Phosphatase: Putative Phosphatase; InterPro: I | 96.6 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 96.58 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 96.54 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 96.5 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 96.49 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 96.39 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 96.39 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 96.37 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 96.35 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 96.32 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 96.31 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 96.28 | |
| TIGR01545 | 210 | YfhB_g-proteo haloacid dehalogenase superfamily, s | 96.22 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 96.15 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 96.15 | |
| KOG4383|consensus | 1354 | 96.09 | ||
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 96.05 | |
| PRK11590 | 211 | hypothetical protein; Provisional | 96.04 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 96.03 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 95.98 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 95.8 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 95.8 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 95.77 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 95.77 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 95.73 | |
| PLN02811 | 220 | hydrolase | 95.68 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 95.64 | |
| PLN02940 | 382 | riboflavin kinase | 95.64 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 95.63 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 95.63 | |
| TIGR01675 | 229 | plant-AP plant acid phosphatase. This model explic | 95.52 | |
| PRK12702 | 302 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 95.46 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 95.45 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 95.22 | |
| smart00775 | 157 | LNS2 LNS2 domain. This domain is found in Saccharo | 95.12 | |
| COG3769 | 274 | Predicted hydrolase (HAD superfamily) [General fun | 94.72 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 94.61 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 94.43 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 94.29 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 93.97 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 93.79 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 93.52 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 92.8 | |
| TIGR00099 | 256 | Cof-subfamily Cof subfamily of IIB subfamily of ha | 92.64 | |
| PRK10530 | 272 | pyridoxal phosphate (PLP) phosphatase; Provisional | 92.55 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 92.35 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 92.21 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 92.15 | |
| COG4030 | 315 | Uncharacterized protein conserved in archaea [Func | 91.81 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 91.3 | |
| PF08282 | 254 | Hydrolase_3: haloacid dehalogenase-like hydrolase; | 91.28 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 91.28 | |
| KOG3120|consensus | 256 | 91.01 | ||
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 90.9 | |
| PF03767 | 229 | Acid_phosphat_B: HAD superfamily, subfamily IIIB ( | 90.53 | |
| PRK15126 | 272 | thiamin pyrimidine pyrophosphate hydrolase; Provis | 90.5 | |
| PRK01158 | 230 | phosphoglycolate phosphatase; Provisional | 90.16 | |
| PLN02645 | 311 | phosphoglycolate phosphatase | 89.78 | |
| TIGR02461 | 225 | osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat | 89.37 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 89.11 | |
| TIGR01680 | 275 | Veg_Stor_Prot vegetative storage protein. The prot | 88.54 | |
| TIGR01486 | 256 | HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph | 88.36 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 88.32 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 88.12 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 87.94 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 87.64 | |
| TIGR01452 | 279 | PGP_euk phosphoglycolate/pyridoxal phosphate phosp | 87.62 | |
| PRK10976 | 266 | putative hydrolase; Provisional | 87.54 | |
| PRK10513 | 270 | sugar phosphate phosphatase; Provisional | 87.08 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 86.54 | |
| PRK10444 | 248 | UMP phosphatase; Provisional | 86.25 | |
| PLN02887 | 580 | hydrolase family protein | 85.83 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 85.78 | |
| TIGR02463 | 221 | MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r | 85.52 | |
| TIGR01458 | 257 | HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr | 85.39 | |
| TIGR01457 | 249 | HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr | 84.19 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 84.18 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 83.59 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 83.46 | |
| PRK00192 | 273 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 83.41 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 83.1 | |
| PRK03669 | 271 | mannosyl-3-phosphoglycerate phosphatase; Reviewed | 83.04 | |
| TIGR02244 | 343 | HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd | 83.0 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 82.96 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 80.78 | |
| TIGR01482 | 225 | SPP-subfamily Sucrose-phosphate phosphatase subfam | 80.07 |
| >KOG0202|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.8e-53 Score=404.25 Aligned_cols=248 Identities=46% Similarity=0.635 Sum_probs=221.6
Q ss_pred ccCCCCCCccccCChhHHHhhhhhhhhhcceEeEeeCCCCCCceEEEEEecCCCCCCCCCccEEEEeCChHHHHHhcccc
Q psy885 11 SNSNPPNHCVSFSGRREQAIAVRQDVETKWKKEFTLEFSRDRKSMSSYCTPLKSSKLGSSGPKLFVKGAPEGVLERCTHA 90 (270)
Q Consensus 11 ~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~pF~s~~krmsviv~~~~~~~~~~~~~~l~~KGApe~Il~~c~~~ 90 (270)
+|.|.++......+..| +..|+.-+...|++++++||+|+||+|+|++.+..++. ++.+|+|||||.|+++|+.+
T Consensus 435 eKm~l~~~~~~~~s~~~-~~~c~~~~~~~~~~~~elpFssdrK~Msv~c~~~~~~~----~~~~fvKGA~E~Vl~rcs~~ 509 (972)
T KOG0202|consen 435 EKMGLPGTRSTNLSNEE-ASACNRVYSRLFKKIAELPFSSDRKSMSVKCSPAHGQS----GYKMFVKGAPESVLERCSTY 509 (972)
T ss_pred HHcCCCcchhhcccccc-cccchhHHHHhhhheeEeecccccceEEEEEecCCCCc----cceEEecCChHHHHHhhhcE
Confidence 45666666555566666 67888999999999999999999999999998776432 58999999999999999776
Q ss_pred cc-CC-eeeeccHHHHHh--------hhccceEEEeecccccceeCC-CCcccccccccchhhcccCCeEEEEEEeecCC
Q psy885 91 RI-GS-QKVSLKDFSANT--------RFENLRSLEPKSKVSAIVPWG-MKPEDMNLADSTKFASYEVNLTFVGVVGMLDP 159 (270)
Q Consensus 91 ~~-~~-~~~~l~~~~~~~--------~~~GlRvl~~~~~~~a~~~~~-~~~~~~~~~~~~~~~~ie~~l~~lG~i~~~d~ 159 (270)
.. +| ...|+++..++. +++||||||+ |+++.+ ..+..+++.+..++..+|++|+|+|++++.||
T Consensus 510 ~~~~g~~~~pLt~~~re~il~~~~~~g~~gLRvLal-----A~~~~~~~~~~~~~l~~~s~~~~~E~~LtFvGlVGi~DP 584 (972)
T KOG0202|consen 510 YGSDGQTKVPLTQASRETILANVYEMGSEGLRVLAL-----ASKDSPGQVPDDQDLNDTSNRATAESDLTFVGLVGILDP 584 (972)
T ss_pred EccCCceeeeCcHHHHHHHHHHHHHHhhccceEEEE-----EccCCcccChhhhhhcccccccccccceEEEEEeeccCC
Confidence 65 33 558998876653 8999999999 888877 45556666677788889999999999999999
Q ss_pred CchhHHHHHHHHHhCCCeEEEEcCCCHHHHHHHHHHhCCCCCCCCccceeeechhhcCCCHHHHHHhccCceEEEecChh
Q psy885 160 PRKEVFDSIARCRAAGIRVIVITGDNKATAEAICRRIGVFTEEEDTTGKSYSGREFDDLPLSEQKAAVARARLFSRVEPA 239 (270)
Q Consensus 160 lr~~~~~~I~~l~~agi~v~mlTGD~~~ta~~iA~~~gi~~~~~~~~~~~i~G~~~~~l~~~~~~~~~~~~~v~ar~tP~ 239 (270)
||++++++|+.|+++||+|+|||||+..||.+||+++||...+++..+.++||++|+.|++++++....++.+|+|++|.
T Consensus 585 PR~ev~~ai~~c~~aGIrV~mITGD~~~TA~AI~r~iGi~~~~ed~~~~~~TG~efD~ls~~~~~~~~~~~~vFaR~~P~ 664 (972)
T KOG0202|consen 585 PRPEVADAIELCRQAGIRVIMITGDNKETAEAIAREIGIFSEDEDVSSMALTGSEFDDLSDEELDDAVRRVLVFARAEPQ 664 (972)
T ss_pred CchhHHHHHHHHHHcCCEEEEEcCCCHHHHHHHHHHhCCCcCCccccccccchhhhhcCCHHHHHHHhhcceEEEecCch
Confidence 99999999999999999999999999999999999999999988888899999999999999999999999999999999
Q ss_pred hHHHHHHHHhhCCCEEEEECCcHhhhhhh
Q psy885 240 HKSKIVEFLQGMNEISAMDSSTGKTELRI 268 (270)
Q Consensus 240 ~K~~iV~~lq~~g~~V~miGDG~ND~~ai 268 (270)
+|.+||++||++|.+|+|+|||+||++||
T Consensus 665 HK~kIVeaLq~~geivAMTGDGVNDApAL 693 (972)
T KOG0202|consen 665 HKLKIVEALQSRGEVVAMTGDGVNDAPAL 693 (972)
T ss_pred hHHHHHHHHHhcCCEEEecCCCccchhhh
Confidence 99999999999999999999999999997
|
|
| >COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0204|consensus | Back alignment and domain information |
|---|
| >TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) | Back alignment and domain information |
|---|
| >TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type | Back alignment and domain information |
|---|
| >KOG0208|consensus | Back alignment and domain information |
|---|
| >TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK10517 magnesium-transporting ATPase MgtA; Provisional | Back alignment and domain information |
|---|
| >TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK15122 magnesium-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit | Back alignment and domain information |
|---|
| >PLN03190 aminophospholipid translocase; Provisional | Back alignment and domain information |
|---|
| >TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase | Back alignment and domain information |
|---|
| >TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase | Back alignment and domain information |
|---|
| >KOG0206|consensus | Back alignment and domain information |
|---|
| >KOG0203|consensus | Back alignment and domain information |
|---|
| >KOG0209|consensus | Back alignment and domain information |
|---|
| >KOG0210|consensus | Back alignment and domain information |
|---|
| >PRK14010 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK01122 potassium-transporting ATPase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR01497 kdpB K+-transporting ATPase, B subunit | Back alignment and domain information |
|---|
| >KOG0205|consensus | Back alignment and domain information |
|---|
| >TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC | Back alignment and domain information |
|---|
| >COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0207|consensus | Back alignment and domain information |
|---|
| >PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase | Back alignment and domain information |
|---|
| >COG4087 Soluble P-type ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13246 Hydrolase_like2: Putative hydrolase of sodium-potassium ATPase alpha subunit | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B | Back alignment and domain information |
|---|
| >COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1615|consensus | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >PLN02954 phosphoserine phosphatase | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >KOG4383|consensus | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >PRK11590 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01675 plant-AP plant acid phosphatase | Back alignment and domain information |
|---|
| >PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >smart00775 LNS2 LNS2 domain | Back alignment and domain information |
|---|
| >COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily | Back alignment and domain information |
|---|
| >PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >COG4030 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3120|consensus | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) | Back alignment and domain information |
|---|
| >PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK01158 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02645 phosphoglycolate phosphatase | Back alignment and domain information |
|---|
| >TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >TIGR01680 Veg_Stor_Prot vegetative storage protein | Back alignment and domain information |
|---|
| >TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family | Back alignment and domain information |
|---|
| >PRK10976 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10513 sugar phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
| >PRK10444 UMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02887 hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein | Back alignment and domain information |
|---|
| >TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 | Back alignment and domain information |
|---|
| >TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 270 | ||||
| 3tlm_A | 992 | Crystal Structure Of Endoplasmic Reticulum Ca2+-Atp | 1e-63 | ||
| 3ba6_A | 994 | Structure Of The Ca2e1p Phosphoenzyme Intermediate | 2e-62 | ||
| 2dqs_A | 995 | Crystal Structure Of The Calcium Pump With Amppcp I | 2e-62 | ||
| 1kju_A | 994 | Ca2+-Atpase In The E2 State Length = 994 | 2e-62 | ||
| 3ixz_A | 1034 | Pig Gastric H+K+-Atpase Complexed With Aluminium Fl | 5e-16 | ||
| 3b8e_A | 998 | Crystal Structure Of The Sodium-Potassium Pump Leng | 1e-15 | ||
| 3n23_A | 992 | Crystal Structure Of The High Affinity Complex Betw | 1e-15 | ||
| 2zxe_A | 1028 | Crystal Structure Of The Sodium - Potassium Pump In | 5e-15 | ||
| 3b8c_A | 885 | Crystal Structure Of A Plasma Membrane Proton Pump | 4e-09 | ||
| 1mhs_A | 920 | Model Of Neurospora Crassa Proton Atpase Length = 9 | 3e-07 |
| >pdb|3TLM|A Chain A, Crystal Structure Of Endoplasmic Reticulum Ca2+-Atpase (Serca) From Bovine Muscle Length = 992 | Back alignment and structure |
|
| >pdb|3BA6|A Chain A, Structure Of The Ca2e1p Phosphoenzyme Intermediate Of The Serca Ca2+-Atpase Length = 994 | Back alignment and structure |
| >pdb|2DQS|A Chain A, Crystal Structure Of The Calcium Pump With Amppcp In The Absence Of Calcium Length = 995 | Back alignment and structure |
| >pdb|1KJU|A Chain A, Ca2+-Atpase In The E2 State Length = 994 | Back alignment and structure |
| >pdb|3IXZ|A Chain A, Pig Gastric H+K+-Atpase Complexed With Aluminium Fluoride Length = 1034 | Back alignment and structure |
| >pdb|3B8E|A Chain A, Crystal Structure Of The Sodium-Potassium Pump Length = 998 | Back alignment and structure |
| >pdb|3N23|A Chain A, Crystal Structure Of The High Affinity Complex Between Ouabain And The E2p Form Of The Sodium-Potassium Pump Length = 992 | Back alignment and structure |
| >pdb|2ZXE|A Chain A, Crystal Structure Of The Sodium - Potassium Pump In The E2.2k+.Pi State Length = 1028 | Back alignment and structure |
| >pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump Length = 885 | Back alignment and structure |
| >pdb|1MHS|A Chain A, Model Of Neurospora Crassa Proton Atpase Length = 920 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 270 | |||
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 4e-87 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 1e-55 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 8e-49 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 2e-42 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 7e-42 | |
| 3gwi_A | 170 | Magnesium-transporting ATPase, P-type 1; P-type AT | 7e-16 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 3e-11 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 2e-10 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 3e-10 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 1e-09 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 2e-09 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 4e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 4e-04 |
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Length = 995 | Back alignment and structure |
|---|
Score = 277 bits (712), Expect = 4e-87
Identities = 136/259 (52%), Positives = 168/259 (64%), Gaps = 19/259 (7%)
Query: 14 NPPNHCVSFSGRREQAIAVRQDVETKWKKEFTLEFSRDRKSMSSYCTPLKSSKLGSSGPK 73
N N V + E+A A + KKEFTLEFSRDRKSMS YC+P S + G K
Sbjct: 454 NVFNTEVRNLSKVERANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSP-AKSSRAAVGNK 512
Query: 74 LFVKGAPEGVLERCTHARIGSQKVSLKD------FSANTRF----ENLRSLEPKSKVSAI 123
+FVKGAPEGV++RC + R+G+ +V + S + + LR L A
Sbjct: 513 MFVKGAPEGVIDRCNYVRVGTTRVPMTGPVKEKILSVIKEWGTGRDTLRCL-----ALAT 567
Query: 124 VPWGMKPEDMNLADSTKFASYEVNLTFVGVVGMLDPPRKEVFDSIARCRAAGIRVIVITG 183
K E+M L DS++F YE +LTFVGVVGMLDPPRKEV SI CR AGIRVI+ITG
Sbjct: 568 RDTPPKREEMVLDDSSRFMEYETDLTFVGVVGMLDPPRKEVMGSIQLCRDAGIRVIMITG 627
Query: 184 DNKATAEAICRRIGVFTEEEDTTGKSYSGREFDDLPLSEQKAAVARARLFSRVEPAHKSK 243
DNK TA AICRRIG+F E E+ ++Y+GREFDDLPL+EQ+ A RA F+RVEP+HKSK
Sbjct: 628 DNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSK 687
Query: 244 IVEFLQGMNEISAMDSSTG 262
IVE+LQ +EI+AM TG
Sbjct: 688 IVEYLQSYDEITAM---TG 703
|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2xzb_A 1iwc_A 1iwf_A Length = 1034 | Back alignment and structure |
|---|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Length = 1028 | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Length = 885 | Back alignment and structure |
|---|
| >3gwi_A Magnesium-transporting ATPase, P-type 1; P-type ATPase, nucleotide binding, ATP binding, MGTA, membra protein, cell inner membrane; 1.60A {Escherichia coli} Length = 170 | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Length = 263 | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Length = 736 | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Length = 280 | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Length = 287 | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 645 | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Length = 723 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Length = 232 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 270 | |||
| 3ar4_A | 995 | Sarcoplasmic/endoplasmic reticulum calcium ATPase; | 100.0 | |
| 2zxe_A | 1028 | Na, K-ATPase alpha subunit; membrane protein, ION | 100.0 | |
| 3ixz_A | 1034 | Potassium-transporting ATPase alpha; ION pump, H+, | 100.0 | |
| 1mhs_A | 920 | Proton pump, plasma membrane ATPase; ION transport | 100.0 | |
| 3b8c_A | 885 | ATPase 2, plasma membrane-type; P-type ATPase, pro | 100.0 | |
| 3rfu_A | 736 | Copper efflux ATPase; alpha helical, CPC, CXXC, AT | 99.88 | |
| 3gwi_A | 170 | Magnesium-transporting ATPase, P-type 1; P-type AT | 99.87 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 99.85 | |
| 3j08_A | 645 | COPA, copper-exporting P-type ATPase A; copper tra | 99.84 | |
| 4fe3_A | 297 | Cytosolic 5'-nucleotidase 3; substrate complex, HA | 99.44 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 99.04 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 99.23 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 99.19 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 98.43 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 98.43 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 98.38 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 98.33 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 98.32 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 98.23 | |
| 4gxt_A | 385 | A conserved functionally unknown protein; structur | 98.22 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 98.21 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 98.17 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 98.1 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 98.07 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 98.04 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 98.03 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 98.02 | |
| 1l6r_A | 227 | Hypothetical protein TA0175; structural genomics, | 97.99 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 97.99 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 97.93 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 97.92 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 97.92 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 97.88 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 97.84 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 97.84 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 97.76 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 97.74 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 97.71 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 97.71 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 97.69 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 97.67 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 97.65 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 97.65 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 97.65 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 97.62 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 97.61 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 97.53 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 97.5 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 97.49 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 97.45 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 97.43 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 97.42 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 97.42 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 97.4 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 97.38 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 97.38 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 97.34 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 97.3 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 97.29 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 97.28 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 97.25 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 97.24 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 97.24 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 97.24 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 97.2 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 97.17 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 97.16 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 97.16 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 97.15 | |
| 1y8a_A | 332 | Hypothetical protein AF1437; structural genomics, | 97.13 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 97.11 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 97.08 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 97.01 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 96.97 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 96.96 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 96.94 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 96.93 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 96.91 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 96.91 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 96.87 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 96.86 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 96.84 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 96.82 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 96.78 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 96.76 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 96.74 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 96.65 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 96.64 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 96.56 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 96.54 | |
| 1svj_A | 156 | Potassium-transporting ATPase B chain; alpha-beta | 96.5 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 96.45 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 96.41 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 96.39 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 96.33 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 96.26 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 96.24 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 96.19 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 96.05 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 96.01 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 95.97 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 95.95 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 95.94 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 95.88 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 95.84 | |
| 3mpo_A | 279 | Predicted hydrolase of the HAD superfamily; SGX, P | 95.79 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 95.78 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 95.73 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 95.57 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 95.23 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 94.47 | |
| 3zx4_A | 259 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd | 94.39 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 93.98 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 93.92 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 93.04 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 92.88 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 92.86 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 92.24 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 91.76 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 91.06 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 89.85 | |
| 1u02_A | 239 | Trehalose-6-phosphate phosphatase related protein; | 88.93 | |
| 1rkq_A | 282 | Hypothetical protein YIDA; two domain structure wi | 88.63 | |
| 3dnp_A | 290 | Stress response protein YHAX; structural PSI-2, pr | 88.58 | |
| 2pq0_A | 258 | Hypothetical conserved protein GK1056; hyopthetica | 88.11 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 87.97 | |
| 1wr8_A | 231 | Phosphoglycolate phosphatase; alpha / beta core do | 86.64 | |
| 1nf2_A | 268 | Phosphatase; structural proteomics, HAD NEW fold, | 86.25 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 86.24 | |
| 4dw8_A | 279 | Haloacid dehalogenase-like hydrolase; HAD, putativ | 85.42 | |
| 3qgm_A | 268 | P-nitrophenyl phosphatase (PHO2); structural genom | 85.19 | |
| 3kc2_A | 352 | Uncharacterized protein YKR070W; HAD-like, mitocho | 85.11 | |
| 1nrw_A | 288 | Hypothetical protein, haloacid dehalogenase-like h | 84.7 | |
| 3pdw_A | 266 | Uncharacterized hydrolase YUTF; structural genomic | 82.67 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 82.01 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 81.58 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 81.58 | |
| 2zos_A | 249 | MPGP, mannosyl-3-phosphoglycerate phosphatase; hal | 81.51 | |
| 1xvi_A | 275 | MPGP, YEDP, putative mannosyl-3-phosphoglycerate p | 81.49 | |
| 2jc9_A | 555 | Cytosolic purine 5'-nucleotidase; cytosolic 5-prim | 80.95 | |
| 2c4n_A | 250 | Protein NAGD; nucleotide phosphatase, HAD superfam | 80.94 |
| >3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=4.7e-42 Score=350.27 Aligned_cols=228 Identities=57% Similarity=0.882 Sum_probs=192.7
Q ss_pred hhhcceEeEeeCCCCCCceEEEEEecCCCCCCCCCccEEEEeCChHHHHHhccccccCCeeeeccHH--------HHHh-
Q psy885 36 VETKWKKEFTLEFSRDRKSMSSYCTPLKSSKLGSSGPKLFVKGAPEGVLERCTHARIGSQKVSLKDF--------SANT- 106 (270)
Q Consensus 36 ~~~~~~~~~~~pF~s~~krmsviv~~~~~~~~~~~~~~l~~KGApe~Il~~c~~~~~~~~~~~l~~~--------~~~~- 106 (270)
.+..|++++++||+|+||||||+++...++...+ +.++|+|||||.|+++|+.+..++...++++. ..++
T Consensus 476 ~~~~~~~~~~~pF~s~rk~msvi~~~~~g~~~~~-~~~~~~KGa~e~il~~c~~~~~~~~~~~l~~~~~~~~~~~~~~~~ 554 (995)
T 3ar4_A 476 IRQLMKKEFTLEFSRDRKSMSVYCSPAKSSRAAV-GNKMFVKGAPEGVIDRCNYVRVGTTRVPMTGPVKEKILSVIKEWG 554 (995)
T ss_dssp HHHHEEEEEEEEEETTTTEEEEEEEESSCCSCSC-CCEEEEEECHHHHHHTEEEEEETTEEEECCHHHHHHHHHHHHHHH
T ss_pred hhhhCceEEEeecCCCCCeeEEEEecCCCCcccc-ceEEEEcCCHHHHHHhcchhhcCCCcccCCHHHHHHHHHHHHHHH
Confidence 5678999999999999999999998654311001 47899999999999999987777777777643 3355
Q ss_pred -hhccceEEEeecccccceeCCCCcccccccccchhhcccCCeEEEEEEeecCCCchhHHHHHHHHHhCCCeEEEEcCCC
Q psy885 107 -RFENLRSLEPKSKVSAIVPWGMKPEDMNLADSTKFASYEVNLTFVGVVGMLDPPRKEVFDSIARCRAAGIRVIVITGDN 185 (270)
Q Consensus 107 -~~~GlRvl~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ie~~l~~lG~i~~~d~lr~~~~~~I~~l~~agi~v~mlTGD~ 185 (270)
+++|+|||++ ||++++..+......+...++.+|.+++|+|+++++||+|++++++|+.|+++||+++|+|||+
T Consensus 555 ~a~~GlRvLa~-----A~k~~~~~~~~~~~~~~~~~~~~e~~l~~lG~~~i~D~lr~~~~~~I~~l~~~Gi~v~miTGD~ 629 (995)
T 3ar4_A 555 TGRDTLRCLAL-----ATRDTPPKREEMVLDDSSRFMEYETDLTFVGVVGMLDPPRKEVMGSIQLCRDAGIRVIMITGDN 629 (995)
T ss_dssp HSTTCCEEEEE-----EEESSCCCGGGCCTTCGGGHHHHTCSEEEEEEEEEECCBCTTHHHHHHHHHHTTCEEEEEESSC
T ss_pred hhhccceEEEE-----EEEecCccccccccccchhhhhhccCcEEEEEEeecCCCchhHHHHHHHHHHcCCEEEEECCCC
Confidence 7899999999 8877754332222222234566789999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhCCCCCCCCccceeeechhhcCCCHHHHHHhccCceEEEecChhhHHHHHHHHhhCCCEEEEECCcHhhh
Q psy885 186 KATAEAICRRIGVFTEEEDTTGKSYSGREFDDLPLSEQKAAVARARLFSRVEPAHKSKIVEFLQGMNEISAMDSSTGKTE 265 (270)
Q Consensus 186 ~~ta~~iA~~~gi~~~~~~~~~~~i~G~~~~~l~~~~~~~~~~~~~v~ar~tP~~K~~iV~~lq~~g~~V~miGDG~ND~ 265 (270)
..||.++|+++||..........+++|.++..+.++++.+.+.+..+|||++|+||.++|+.||++|+.|+|+|||+||+
T Consensus 630 ~~ta~~ia~~lgi~~~~~~i~~~~~~g~~~~~l~~~~~~~~~~~~~v~~r~~P~~K~~~v~~l~~~g~~v~~~GDG~ND~ 709 (995)
T 3ar4_A 630 KGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDA 709 (995)
T ss_dssp HHHHHHHHHHHTSSCTTCCCTTTEEEHHHHHTSCHHHHHHHHHHCCEEESCCSSHHHHHHHHHHTTTCCEEEEECSGGGH
T ss_pred HHHHHHHHHHcCcCCCCCcccceEEEchhhhhCCHHHHHHHHhhCcEEEEeCHHHHHHHHHHHHHCCCEEEEEcCCchhH
Confidence 99999999999998654433456899999999999999999999999999999999999999999999999999999999
Q ss_pred hhhc
Q psy885 266 LRIF 269 (270)
Q Consensus 266 ~ai~ 269 (270)
+||.
T Consensus 710 ~alk 713 (995)
T 3ar4_A 710 PALK 713 (995)
T ss_dssp HHHH
T ss_pred HHHH
Confidence 9973
|
| >2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A | Back alignment and structure |
|---|
| >3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A | Back alignment and structure |
|---|
| >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 | Back alignment and structure |
|---|
| >3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3gwi_A Magnesium-transporting ATPase, P-type 1; P-type ATPase, nucleotide binding, ATP binding, MGTA, membra protein, cell inner membrane; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >1svj_A Potassium-transporting ATPase B chain; alpha-beta sandwich, hydrolase; NMR {Escherichia coli} SCOP: d.220.1.1 PDB: 1u7q_A 2a00_A* 2a29_A* | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 | Back alignment and structure |
|---|
| >1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A | Back alignment and structure |
|---|
| >3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* | Back alignment and structure |
|---|
| >1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A | Back alignment and structure |
|---|
| >1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 | Back alignment and structure |
|---|
| >2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* | Back alignment and structure |
|---|
| >2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 270 | ||||
| d1wpga2 | 168 | c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, ca | 9e-26 | |
| d1wpga3 | 239 | d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryc | 6e-19 | |
| d1q3ia_ | 214 | d.220.1.1 (A:) Sodium/potassium-transporting ATPas | 1e-15 | |
| d1qyia_ | 380 | c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 | 5e-11 | |
| d2b8ea1 | 135 | c.108.1.7 (A:416-434,A:548-663) Cation-transportin | 6e-11 | |
| d1wr8a_ | 230 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 7e-04 | |
| d1l6ra_ | 225 | c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPa | 0.004 |
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 168 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Meta-cation ATPase, catalytic domain P domain: Calcium ATPase, catalytic domain P species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Score = 97.5 bits (242), Expect = 9e-26
Identities = 70/111 (63%), Positives = 84/111 (75%)
Query: 147 NLTFVGVVGMLDPPRKEVFDSIARCRAAGIRVIVITGDNKATAEAICRRIGVFTEEEDTT 206
+ T LDPPRKEV SI CR AGIRVI+ITGDNK TA AICRRIG+F E E+
Sbjct: 8 DKTGTLTTNQLDPPRKEVMGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVA 67
Query: 207 GKSYSGREFDDLPLSEQKAAVARARLFSRVEPAHKSKIVEFLQGMNEISAM 257
++Y+GREFDDLPL+EQ+ A RA F+RVEP+HKSKIVE+LQ +EI+AM
Sbjct: 68 DRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAM 118
|
| >d1wpga3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 239 | Back information, alignment and structure |
|---|
| >d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} Length = 214 | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 135 | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Length = 230 | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 225 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 270 | |||
| d1wpga2 | 168 | Calcium ATPase, catalytic domain P {Rabbit (Orycto | 99.96 | |
| d1q3ia_ | 214 | Sodium/potassium-transporting ATPase alpha chain { | 99.93 | |
| d1wpga3 | 239 | Calcium ATPase {Rabbit (Oryctolagus cuniculus) [Ta | 99.89 | |
| d2b8ea1 | 135 | Cation-transporting ATPase {Archaeon Archaeoglobus | 99.88 | |
| d1qyia_ | 380 | Hypothetical protein MW1667 (SA1546) {Staphylococc | 99.8 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 98.7 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 98.49 | |
| d1k1ea_ | 177 | Probable phosphatase YrbI {Haemophilus influenzae, | 97.96 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 97.73 | |
| d1wr8a_ | 230 | Phosphoglycolate phosphatase, PGPase {Pyrococcus h | 97.72 | |
| d1l6ra_ | 225 | Phosphoglycolate phosphatase, PGPase {Archaeon The | 97.54 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 97.52 | |
| d1rkqa_ | 271 | Hypothetical protein YidA {Escherichia coli [TaxId | 97.34 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 97.22 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 97.15 | |
| d1rkua_ | 206 | Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta | 97.1 | |
| d1wzca1 | 243 | Putative mannosyl-3-phosphoglycerate phosphatase M | 97.07 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 97.06 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 97.01 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 96.93 | |
| d1rlma_ | 269 | Sugar phosphatase SupH (YbiV) {Escherichia coli [T | 96.9 | |
| d1nrwa_ | 285 | Hypothetical protein YwpJ {Bacillus subtilis [TaxI | 96.81 | |
| d1xvia_ | 232 | Putative mannosyl-3-phosphoglycerate phosphatase M | 96.8 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 96.76 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 96.5 | |
| d2b30a1 | 283 | PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 | 96.36 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 96.3 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 96.09 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 96.06 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 95.83 | |
| d2rbka1 | 260 | Sugar-phosphate phosphatase BT4131 {Bacteroides th | 95.81 | |
| d1s2oa1 | 244 | Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc | 95.6 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 95.52 | |
| d1nf2a_ | 267 | Hypothetical protein TM0651 {Thermotoga maritima [ | 94.46 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 94.45 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 94.4 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 94.22 | |
| d2b82a1 | 209 | Class B acid phosphatase, AphA {Escherichia coli [ | 94.15 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 93.34 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 92.32 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 92.02 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 91.69 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 91.6 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 89.39 | |
| d2a29a1 | 136 | Potassium-transporting ATPase B chain, KdpB {Esche | 88.34 | |
| d1u02a_ | 229 | Trehalose-6-phosphate phosphatase related protein | 85.86 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 83.64 |
| >d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: Meta-cation ATPase, catalytic domain P domain: Calcium ATPase, catalytic domain P species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Probab=99.96 E-value=5.2e-30 Score=208.72 Aligned_cols=112 Identities=61% Similarity=0.958 Sum_probs=108.5
Q ss_pred CCCchhHHHHHHHHHhCCCeEEEEcCCCHHHHHHHHHHhCCCCCCCCccceeeechhhcCCCHHHHHHhccCceEEEecC
Q psy885 158 DPPRKEVFDSIARCRAAGIRVIVITGDNKATAEAICRRIGVFTEEEDTTGKSYSGREFDDLPLSEQKAAVARARLFSRVE 237 (270)
Q Consensus 158 d~lr~~~~~~I~~l~~agi~v~mlTGD~~~ta~~iA~~~gi~~~~~~~~~~~i~G~~~~~l~~~~~~~~~~~~~v~ar~t 237 (270)
||||++++++|+.|+++||++||+|||+..||.++|+++||..++.......++|.++..++..++.+.+.+..+|||++
T Consensus 19 Dp~R~~~~~~I~~l~~~GI~v~miTGD~~~tA~~ia~~~Gi~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~v~ar~~ 98 (168)
T d1wpga2 19 DPPRKEVMGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVE 98 (168)
T ss_dssp CCBCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHHTTSSCTTCCCTTTEEEHHHHHHSCHHHHHHHHHHCCEEESCC
T ss_pred CCCchhHHHHHHHHHHCcCEEEEECCCCHHHHHHHHHHcCCCCCccccccccccccccchhhHHHHhhhhhhhhhhhccc
Confidence 99999999999999999999999999999999999999999988877777889999999999999999999999999999
Q ss_pred hhhHHHHHHHHhhCCCEEEEECCcHhhhhhhc
Q psy885 238 PAHKSKIVEFLQGMNEISAMDSSTGKTELRIF 269 (270)
Q Consensus 238 P~~K~~iV~~lq~~g~~V~miGDG~ND~~ai~ 269 (270)
|+||..+|+.||+.|++|+|+|||+||++||.
T Consensus 99 p~~K~~lv~~l~~~g~~Va~vGDG~nD~~AL~ 130 (168)
T d1wpga2 99 PSHKSKIVEYLQSYDEITAMTGDGVNDAPALK 130 (168)
T ss_dssp HHHHHHHHHHHHHTTCCEEEEECSGGGHHHHH
T ss_pred hhHHHHHHHHHHhcccceeEEecCCCCHHHHH
Confidence 99999999999999999999999999999985
|
| >d1q3ia_ d.220.1.1 (A:) Sodium/potassium-transporting ATPase alpha chain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1wpga3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d2a29a1 d.220.1.1 (A:316-451) Potassium-transporting ATPase B chain, KdpB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|