Psyllid ID: psy8898


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------
YGRKDVVEYLLASGASIHARDDGGLHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTPLHEAAAKGKTDVCIGIYFAEHSSKSNQYVYGIGGGTGCPMHKDRSCYLAHGADPFLKNQEGQTPLDLTVAEDVRSLLQDAMAQYPGAPSCAETASVPPPSQYSNTSCGDNVSLPPPAQYSGSGGDSVSLPPTSPPQPLALETVIMPSGQAVALGLVPLHNACSYGHFEVTEMLIKAGANVNAMDLWQFTPLHEAASKSRLEVCSLLLSEGADPTLHNCHSKSAIDVAPTRELQQRLSNEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGYTALQVAGENSKKLLQEPPSVVDLESQLLEASKGGDMTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKDNATDKWGFTPLHEAAQKGRTQLSALLPLSPSAANDPLRELFEACKGGDLTKVKKLVNPQTVNARDTAGRKSTPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEAAAKALLQHGADINLKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCCKMELMFMPRIKDEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQTALHRTARDDKTQAVRVLLSHNADTSIVSLLVIFSCSTNLGLKHLLELFEREQITLDILAEMNHEDLKQVGVSAYGYRHKLLKGIEKLCSSPSFSQPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGIFSRYNIIRIQKVQNRKLWERYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAIRYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGKRVWLGDVKQGVDQLSMAGGLETGTKKKKKNMYYGTLTPHNVKHGANVNVADLWKFTPLHEAAAKGKADIVRLLLQHGADPSKKNRDGATPLDLVREGDQDVSDLLRGNSALLDAAKKGNLGRVQKLLTADNINCRDAQGRNSTPLHLAAGEKRHLLMCRVTLGKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQVILINGYL
cccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccccccccHHcccccccccccccccccHHHHHcccccHHHHHHHHHccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHccccHHHHHHccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccccHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccHHHHHHHcccHHHHHHHHccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHccccccccccHHHHHHHHHHHcccccccccccHHHHHccccccHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHHccccccHHHHHHccccHHHHHHHHHHcccccccccccHHHHHHHccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHccHHHHHHHHcccHHHHHHHHccccccHHHHHccccHHHHHHccccHHHHHHHcccHHHHHHHHcccccccccccccccHHHHHHHcccccccEEEEHHccccccccccccccccccHHHHHccHHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHcccHHHHHHHccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccccHHHHHHHccccccccccccccccccHHHHHHHHHccccHHHHHHHHcccccccccccc
HccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHcccHHcccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccHHHHHHHcccHHHHHHHHHccccEEEccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHcccHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccHcccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccccHHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHcccccccEEccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccHHHHHHHHHHHHcccccHHHcccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHccHccccHHHHHHccccHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHcccEEEEccccc
YGRKDVVEYLLASGasiharddgglhplhnacsfgHADVVRLLLEadanpntrdnwnftplheaaakgktdVCIGIYFaehssksnqyvygigggtgcpmhkdrscylahgadpflknqegqtpldlTVAEDVRSLLQDAMaqypgapscaetasvpppsqysntscgdnvslpppaqysgsggdsvslpptsppqplaletvimpsgqavalglvplhnacsyghFEVTEMLIKAGAnvnamdlwqftplheaaSKSRLEVCSLLLsegadptlhnchsksaidvapTRELQQRLSNEFKGHCLleacrqgdpsrvkkfltsdvvnfkhpytgdtplpgtLLIDLLSDDKEFITVAEEMQATVREhrdngqsggyTALQVAGEnskkllqeppsvvDLESQLleaskggdmTVVTRLLSscphivncrdldgrhstplhfaaGYNRVAVVEYLLAHgadvhskdnatdkwgftplheAAQKGRTQlsallplspsaandPLRELFEackggdltkvkklvnpqtvnardtagrkstplhfaaglvplhnacsyghYEVTEMLVKHGanvnvadlwkftPLHEAAAKALLQHgadinlkntdgktaldlavpctravlsgdhKKEELLEAARMMGgglhrytwplgttdigwcsccckmelmfmprikdefKGHCLleacrqgdpsrvkkfltsdvvnfkhpytgdtplhcavtspypkRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQtalhrtardDKTQAVRVLLSHNADTSIVSLLVIFSCSTNLGLKHLLELFEREQITLDILAEMNHEDLKQVGVSAYGYRHKLLKGIEklcsspsfsqpgtLLIDLLSDDKEFITVAEEMQATVREhrdngqsggifsryNIIRIQKVQNRKLWERYVHRRAevadenggqaHERMLFHGSPFINAIVQKGFDERHAIRYVHRRaevadenggqaHERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGKRVWLGDVKQGVDqlsmaggletgtkkkkknmyygtltphnvkhganvnvadlwkftplheaaaKGKADIVRLLLqhgadpskknrdgatpldlvregdqDVSDLLRGNSALLDAAKKGNLGRVQKLLtadnincrdaqgrnstplhlaAGEKRHLLMCRVTLGKSFLQFNaikmahappghhsvmgrpssgglyfpeyvvYRGEQVILINGYL
YGRKDVVEYLLASGASIHARDDGGLHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTPLHEAAAKGKTDVCIGIYFAEHSSKSNQYVYGIGGGTGCPMHKDRSCYLAHGADPFLKNQEGQTPLDLTVAEDVRSLLQDAMAQYPGAPSCAETASVPPPSQYSNTSCGDNVSLPPPAQYSGSGGDSVSLPPTSPPQPLALETVIMPSGQAVALGLVPLHNACSYGHFEVTEMLIKAGANVNAMDLWQFTPLHEAASKSRLEVCSLLLSEGADPTLHNCHSKSAIDVAPTRELQQRLSNEFKGHCLLEacrqgdpsrvKKFLTSDVVnfkhpytgdtplpGTLLIDLLSDDKEFITVAEEMQATvrehrdngqSGGYTALQVAGENSKKLLQEPPSVVDLESQLLEASKGGDMTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKDNATDKWGFTPLHEAAQKGRTQLSALLPLSPSAANDPLRELFEACkggdltkvkklvnpqtvnardtagrksTPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEAAAKALLQHGADINLKNTDGKTALDLAVPCTravlsgdhKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCCKMELMFMPRIKDEFKGHCLLEacrqgdpsrvKKFLTSDVVNfkhpytgdtplhcavtspYPKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQtalhrtarddkTQAVRVLLSHNADTSIVSLLVIFSCSTNLGLKHLLELFEREQITLDILAEMNHEDLKQVGVSAYGYRHKLLKGIEKLCSSPSFSQPGTLLIDLLSDDKEFITVAEEMQATvrehrdngqsggifsryniirIQKVQNRKLWERYVHRRAevadenggqAHERMLFHGSPFINAIVQKGFDERHAIRYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGKRVWLGDVKQGVDQLsmaggletgtkkkkknMYYGTLTphnvkhganVNVADLWKFTPLHEAAAKGKADIVRLLLqhgadpskknrdgatpldlvregdQDVSDLLRGNSAlldaakkgnlgrVQKLLTadnincrdaqgrnstPLHLAAGEKRHLLMCRVTLGKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQVILINGYL
YGRKDVVEYLLASGASIHARDDGGLHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTPLHEAAAKGKTDVCIGIYFAEHSSKSNQYVYGIGGGTGCPMHKDRSCYLAHGADPFLKNQEGQTPLDLTVAEDVRSLLQDAMAQYPGAPSCAETASVPPPSQYSNTSCGDNVSLPPPAQYSGSGGDSVSLPPTSPPQPLALETVIMPSGQAVALGLVPLHNACSYGHFEVTEMLIKAGANVNAMDLWQFTPLHEAASKSRLEVCSLLLSEGADPTLHNCHSKSAIDVAPTRELQQRLSNEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGYTALQVAGENSKKLLQEPPSVVDLESQLLEASKGGDMTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKDNATDKWGFTPLHEAAQKGRTQlsallplspsaandplRELFEACKGGDLTKVKKLVNPQTVNARDTAGRKSTPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEAAAKALLQHGADINLKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCCKMELMFMPRIKDEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQTALHRTARDDKTQAVRVLLSHNADTSIVSLLVIFSCSTNLGLKHLLELFEREQITLDILAEMNHEDLKQVGVSAYGYRHKLLKGIEKLCSSPSFSQPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGIFSRYNIIRIQKVQNRKLWERYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAIRYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGKRVWLGDVKQGVDQLSMAGGLETGTkkkkkNMYYGTLTPHNVKHGANVNVADLWKFTPLHEAAAKGKADIVRLLLQHGADPSKKNRDGATPLDLVREGDQDVSDLLRGNSALLDAAKKGNLGRVQKLLTADNINCRDAQGRNSTPLHLAAGEKRHLLMCRVTLGKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQVILINGYL
*****VVEYLLASGASIHARDDGGLHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTPLHEAAAKGKTDVCIGIYFAEHSSKSNQYVYGIGGGTGCPMHKDRSCYLAHGADPFLK*******LDLTVA*********************************************************************LETVIMPSGQAVALGLVPLHNACSYGHFEVTEMLIKAGANVNAMDLWQFTPLHEAASKSRLEVCSLLLSEGADPTLHNCHS**AIDV*********LSNEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLPGTLLIDLLSDDKEFITVAE***************************************************GDMTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKDNATDKWGFTPLH**************************ELFEACKGGDLTKVKKLVN**************TPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEAAAKALLQHGADINLKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCCKMELMFMPRIKDEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQTALHRTARDDKTQAVRVLLSHNADTSIVSLLVIFSCSTNLGLKHLLELFEREQITLDILAEMNHEDLKQVGVSAYGYRHKLLKGIEKLCSSPSFSQPGTLLIDLLSDDKEFITVAEEMQA**********SGGIFSRYNIIRIQKVQNRKLWERYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAIRYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGKRVWLGDVKQGV********************YYGTLTPHNVKHGANVNVADLWKFTPLHEAAAKGKADIVRLLLQ***********************************LLDAAKKGNLGRVQKLLTADNINCRDAQ****TPLHLAAGEKRHLLMCRVTLGKSFLQFNAIKMAHA************SGGLYFPEYVVYRGEQVILINGY*
YGRKDVVEYLLASGASIHARDDGGLHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTPLHEAAAKGKTDVCIGIYFAEHSSKSNQYVYGIGGGTGCPMHKDRSCYLAHGADPFLKNQEGQTPLDLTVAEDVRSLLQDAMAQYPGAPSCAETASVPPPSQYSNTSCGDNVSLPPPAQYSGSGGDSVSLPPTSPPQPLALETVIMPSGQAVALGLVPLHNACSYGHFEVTEMLIKAGANVNAMDLWQFTPLHEAASKSRLEVCSLLLSEGADPTLHNCHSKSAIDVAPTRELQQRLSNEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGYTALQVAGENSKKLLQEPPSVVDLESQLLEASKGGDMTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKDNATDKWGFTPLHEAAQKGRTQLSALLPLSPSAANDPLRELFEACKGGDLTKVKKLVNPQTVNARDTAGRKSTPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEAAAKALLQHGADINLKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCCKMELMFMPRIKDEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQTALHRTARDDKTQAVRVLLSHNADTSIVSLLVIFSCSTNLGLKHLLELFEREQITLDILAEMNHEDLKQVGVSAYGYRHKLLKGIEKLCSSPSFSQPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGIFSRYNIIRIQKVQNRKLWERYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAIRYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGKRVWLGDVKQGVDQLSMAGGLETGTKKKKKNMYYGTLTPHNVKHGANVNVADLWKFTPLHEAAAKGKADIVRLLLQHGADPSKKNRDGATPLDLVREGDQDVSDLLRGNSALLDAAKKGNLGRVQKLLTADNINCRDAQGRNSTPLHLAAGEKRHLLMCRVTLGKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQVILINGYL
YGRKDVVEYLLASGASIHARDDGGLHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTPLHEAAAKGKTDVCIGIYFAEHSSKSNQYVYGIGGGTGCPMHKDRSCYLAHGADPFLKNQEGQTPLDLTVAEDVRSLLQDAMAQYPGAPSCAETASVPPPSQYSNTSCGDNVSLPPPA*************PTSPPQPLALETVIMPSGQAVALGLVPLHNACSYGHFEVTEMLIKAGANVNAMDLWQFTPLHEAASKSRLEVCSLLLSEGADPTLHNCHSKSAIDVAPTRELQQRLSNEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGYTALQVAGENSKKLLQEPPSVVDLESQLLEASKGGDMTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKDNATDKWGFTPLHEAAQKGRTQLSALLPLSPSAANDPLRELFEACKGGDLTKVKKLVNPQTVNARDTAGRKSTPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEAAAKALLQHGADINLKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCCKMELMFMPRIKDEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQTALHRTARDDKTQAVRVLLSHNADTSIVSLLVIFSCSTNLGLKHLLELFEREQITLDILAEMNHEDLKQVGVSAYGYRHKLLKGIEKLCSSPSFSQPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGIFSRYNIIRIQKVQNRKLWERYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAIRYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGKRVWLGDVKQGVDQLSMAGGLETGTKKKKKNMYYGTLTPHNVKHGANVNVADLWKFTPLHEAAAKGKADIVRLLLQHGADPSKKNRDGATPLDLVREGDQDVSDLLRGNSALLDAAKKGNLGRVQKLLTADNINCRDAQGRNSTPLHLAAGEKRHLLMCRVTLGKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQVILINGYL
YGRKDVVEYLLASGASIHARDDGGLHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTPLHEAAAKGKTDVCIGIYFAEHSSKSNQYVYGIGGGTGCPMHKDRSCYLAHGADPFLKNQEGQTPLDLTVAEDVRSLLQDAMAQYPGAPSCAETASVPPPSQYSNTSCGDNVSLPPPAQYSGSGGDSVSLPPTSPPQPLALETVIMPSGQAVALGLVPLHNACSYGHFEVTEMLIKAGANVNAMDLWQFTPLHEAASKSRLEVCSLLLSEGADPTLHNCHSKSAIDVAPTRELQQRLSNEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGYTALQVAGENSKKLLQEPPSVVDLESQLLEASKGGDMTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKDNATDKWGFTPLHEAAQKGRTQLSALLPLSPSAANDPLRELFEACKGGDLTKVKKLVNPQTVN*******KSTPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEAAAKALLQHGADINLKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCCKMELMFMPRIKDEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQTALHRTARDDKTQAVRVLLSHNADTSIVSLLVIFSCSTNLGLKHLLELFEREQITLDILAEMNHEDLKQVGVSAYGYRHKLLKGIEKLCSSPSFSQPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGIFSRYNIIRIQKVQNRKLWERYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAIRYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGKRVWLGDVKQGVDQLSMAGGLETGTKKKKKNMYYGTLTPHNVKHGANVNVADLWKFTPLHEAAAKGKADIVRLLLQHGADPSKKNRDGATPLDLVREGDQDVSDLLRGNSALLDAAKKGNLGRVQKLLTADNINCRDAQGRNSTPLHLAAGEKRHLLMCRVTLGKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQVILING*L
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YGRKDVVEYLLASGASIHARDDGGLHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTPLHEAAAKGKTDVCIGIYFAEHSSKSNQYVYGIGGGTGCPMHKDRSCYLAHGADPFLKNQEGQTPLDLTVAEDVRSLLQDAMAQYPGAPSCAETASVPPPSQYSNTSCGDNVSLPPPAQYSGSGGDSVSLPPTSPPQPLALETVIMPSGQAVALGLVPLHNACSYGHFEVTEMLIKAGANVNAMDLWQFTPLHEAASKSRLEVCSLLLSEGADPTLHNCHSKSAIDVAPTRELQQRLSNEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGYTALQVAGENSKKLLQEPPSVVDLESQLLEASKGGDMTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKDNATDKWGFTPLHEAAQKGRTQLSALLPLSPSAANDPLRELFEACKGGDLTKVKKLVNPQTVNARDTAGRKSTPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEAAAKALLQHGADINLKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCCKMELMFMPRIKDEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQTALHRTARDDKTQAVRVLLSHNADTSIVSLLVIFSCSTNLGLKHLLELFEREQITLDILAEMNHEDLKQVGVSAYGYRHKLLKGIEKLCSSPSFSQPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGIFSRYNIIRIQKVQNRKLWERYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAIRYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGKRVWLGDVKQGVDQLSMAGGLETGTKKKKKNMYYGTLTPHNVKHGANVNVADLWKFTPLHEAAAKGKADIVRLLLQHGADPSKKNRDGATPLDLVREGDQDVSDLLRGNSALLDAAKKGNLGRVQKLLTADNINCRDAQGRNSTPLHLAAGEKRHLLMCRVTLGKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQVILINGYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1236 2.2.26 [Sep-21-2011]
Q3UES31166 Tankyrase-2 OS=Mus muscul yes N/A 0.453 0.481 0.423 1e-140
Q9H2K21166 Tankyrase-2 OS=Homo sapie yes N/A 0.453 0.481 0.420 1e-140
Q6PFX91320 Tankyrase-1 OS=Mus muscul no N/A 0.455 0.426 0.413 1e-136
O952711327 Tankyrase-1 OS=Homo sapie no N/A 0.455 0.424 0.411 1e-135
Q8N8A2993 Serine/threonine-protein no N/A 0.567 0.706 0.250 3e-27
B2RXR6993 Serine/threonine-protein no N/A 0.594 0.740 0.253 4e-26
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.538 0.339 0.253 5e-26
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no N/A 0.304 0.096 0.318 3e-25
Q01484 3957 Ankyrin-2 OS=Homo sapiens no N/A 0.304 0.095 0.318 9e-25
Q12955 4377 Ankyrin-3 OS=Homo sapiens no N/A 0.402 0.113 0.281 1e-24
>sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 Back     alignment and function desciption
 Score =  500 bits (1287), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 324/765 (42%), Positives = 410/765 (53%), Gaps = 204/765 (26%)

Query: 1   YGRKDVVEYLLASGASIHARDDGGLHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTP 60
           +GRKDVVEYLL +GA++ ARDDGGL PLHNACSFGHA+VV LLL+  A+PN RDNWN+TP
Sbjct: 68  FGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLQHGADPNARDNWNYTP 127

Query: 61  LHEAAAKGKTDVCIGIYFAEHSSKSNQYVYGIGGGTGCPMHKDRSCYLAHGADPFLKNQE 120
           LHEAA KGK DVCI +                               L HGA+P ++N +
Sbjct: 128 LHEAAIKGKIDVCIVL-------------------------------LQHGAEPTIRNTD 156

Query: 121 GQTPLDLTVAEDVRSLL-----QDAMAQYPGAPSCAETASVPPPSQYSNTSCGDNVSLPP 175
           G+T LDL      +++L     +D + +   + +  +  ++  P    N +C        
Sbjct: 157 GRTALDLA-DPSAKAVLTGDYKKDELLESARSGNEEKMMALLTPL---NVNC-------- 204

Query: 176 PAQYSGSGGDSVSLPPTSPPQPLALETVIMPSGQAVAL----GLVPLHNACSYGHFEVTE 231
              ++  G  S  L   +    + +  +++  G  V       LVPLHNACSYGH+EVTE
Sbjct: 205 ---HASDGRKSTPLHLAAGYNRVKIVQLLLHHGADVHAKDKGDLVPLHNACSYGHYEVTE 261

Query: 232 MLIKAGANVNAMDLWQFTPLHEAASKSRLEVCSLLLSEGADPTLHNCHSKSAIDVAPTRE 291
           +L+K GA VNAMDLWQFTPLHEAASK+R+EVCSLLLS GADPTL NCH+KSAID+APT +
Sbjct: 262 LLVKHGACVNAMDLWQFTPLHEAASKNRIEVCSLLLSYGADPTLLNCHNKSAIDLAPTAQ 321

Query: 292 LQQRLSNEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDT--------PLPGTLL 343
           L++RLS EFKGH LL+A R+ D +R+KK L+ ++VNFKHP T +T        P P    
Sbjct: 322 LKERLSYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKHPQTHETALHCAAASPYPKRKQ 381

Query: 344 I-DLL--------SDDKEFIT---------------VAEEMQATVREHRDNGQSG----- 374
           I +LL           KEF+T               V  + +A V      GQ+      
Sbjct: 382 ICELLLRKGANTNEKTKEFLTPLHVASENAHNDVVEVVVKHEAKVNALDSLGQTSLHRAA 441

Query: 375 ------------------------GYTALQVAGENSKKLLQEPPSV--VDLESQLLEASK 408
                                   G+TALQ+  EN ++LLQE  S+   + + QLLEA+K
Sbjct: 442 HCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQLLQEGASLGHSEADRQLLEAAK 501

Query: 409 GGDMTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKD--- 465
            GD+  V +L +     VNCRD++GR STPLHFAAGYNRV+VVEYLL HGADVH+KD   
Sbjct: 502 AGDVETVKKLCTV--QSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGG 559

Query: 466 --------------------------NATDKWGFTPLHEAAQKGRTQLSALL---PLSPS 496
                                     N  D W FTPLHEAA KG+ ++  LL      P+
Sbjct: 560 LVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPT 619

Query: 497 AAN------------------DPLR---ELFEACKGGDLTKVKKLVNPQTVNARDTAGRK 535
             N                  D LR    L +A K G L +VKKL +P  VN RDT GR 
Sbjct: 620 KKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVKKLSSPDNVNCRDTQGRH 679

Query: 536 STPLHFAA------------------------GLVPLHNACSYGHYEVTEMLVKHGANVN 571
           STPLH AA                        GL+PLHNA SYGH +V  +L+K+ A VN
Sbjct: 680 STPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVN 739

Query: 572 VADLWKFTPLHEAAAKA-------LLQHGADINLKNTDGKTALDL 609
             D W FTPLHEAA K        LL HGAD  LKN +G+T LDL
Sbjct: 740 ATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDL 784




Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates poly-ADP-ribosylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates poly-ADP-ribosylation of TERF1, thereby contributing to the regulation of telomere length. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles (By similarity).$.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 3EC: 0
>sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 Back     alignment and function description
>sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 Back     alignment and function description
>sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 Back     alignment and function description
>sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 Back     alignment and function description
>sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=2 SV=1 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1236
1936214861166 PREDICTED: tankyrase-1-like [Acyrthosiph 0.739 0.783 0.398 0.0
4174133411011 Putative ankyrin, partial [Desmodus rotu 0.706 0.863 0.398 0.0
4174057091053 Putative ankyrin [Desmodus rotundus] 0.673 0.790 0.417 0.0
3453227741172 PREDICTED: tankyrase-1 [Ornithorhynchus 0.725 0.765 0.373 1e-177
910763681166 PREDICTED: similar to tankyrase [Triboli 0.456 0.483 0.458 1e-159
2700025511203 hypothetical protein TcasGA2_TC004859 [T 0.456 0.468 0.458 1e-159
2420172391151 Tankyrase-1, putative [Pediculus humanus 0.459 0.493 0.454 1e-156
3454908511219 PREDICTED: tankyrase-1-like [Nasonia vit 0.457 0.463 0.451 1e-154
312376647 1930 hypothetical protein AND_12459 [Anophele 0.457 0.292 0.450 1e-152
4408952261336 Tankyrase-1 [Bos grunniens mutus] 0.707 0.654 0.346 1e-151
>gi|193621486|ref|XP_001950172.1| PREDICTED: tankyrase-1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/1172 (39%), Positives = 597/1172 (50%), Gaps = 258/1172 (22%)

Query: 1    YGRKDVVEYLLASGASIHARDDGGLHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTP 60
            +GR+D+VE LLA+GASI A DDGGLHPLHNACSFGH DVV LLLEA A+PNTRDNWN+TP
Sbjct: 66   FGRRDIVELLLAAGASIQAHDDGGLHPLHNACSFGHEDVVGLLLEAGADPNTRDNWNYTP 125

Query: 61   LHEAAAKGKTDVCIGIYFAEHSSKSNQYVYGIGGGTGCPMHKDRSCYLAHGADPFLKNQE 120
            LHEAA KGK ++CI +                               L HGADP ++N E
Sbjct: 126  LHEAAVKGKIEICIAL-------------------------------LQHGADPTIRNSE 154

Query: 121  GQTPLDLTVAEDVRSLLQDAMAQYPGAPSCAETASVPPPSQYSNTSCGDNVSLPPPAQYS 180
             ++P+DL     V  + +  + ++       E++     ++ S+     NV+      ++
Sbjct: 155  NKSPIDLANVSGVPGINEVLVGEWR-KDEILESSRSGDDAKLSSLLTPLNVNC-----HA 208

Query: 181  GSGGDSVSLPPTSPPQPLALETVIMPSGQAVAL----GLVPLHNACSYGHFEVTEMLIKA 236
              G  S  L   +    +    +++  G  V      GLVPLHNACSYGH EVTEMLIK 
Sbjct: 209  SDGRKSTPLHLAAGFNRIRCVQLLLRHGSDVHAKDKGGLVPLHNACSYGHIEVTEMLIKH 268

Query: 237  GANVNAMDLWQFTPLHEAASKSRLEVCSLLLSEGADPTLHNCHSKSAIDVAPTRELQQRL 296
            GA VNAMDLWQFTPLHEAASKSR+EVCSLLLS+GADPTL NCHSKSAID+A TRELQ++L
Sbjct: 269  GACVNAMDLWQFTPLHEAASKSRVEVCSLLLSKGADPTLLNCHSKSAIDLASTRELQEKL 328

Query: 297  SNEFKGHCLLEACR-----------QGDPSRVKKFLTSDVVNFKHPYTGDTPLPGTLLID 345
            S EFKG+CLLE+CR             D ++ K  LT D  N  H            +I+
Sbjct: 329  SYEFKGYCLLESCRTADVSKVKKLLSSDIAKFKHHLTGD--NAFHIVAASLGSKRKQVIE 386

Query: 346  LLS--------DDKEFIT---VAEE------MQATVR-EHRDNGQSG------------- 374
            LLS         +K+ +T   +A +      M+  +R   R N   G             
Sbjct: 387  LLSRKGAQINESNKDLLTPLHIAADYGHFDVMETFIRLGARVNATDGLGQTALHRCARND 446

Query: 375  ---------------------GYTALQVAGENSKKLLQEPPSVVDLESQLLEASKGGDMT 413
                                 G+ A+ +A +N KK+LQEPP V+DLES+LLEASK G++ 
Sbjct: 447  CLQGCKILLSYNIDTNITSIQGFKAIDMATDNIKKILQEPPVVLDLESELLEASKAGELD 506

Query: 414  VVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKD-------- 465
             V R+L++ PHIVNCRDLDGRHSTPLHFAAGYNRVAV +YLL+HGADVH+KD        
Sbjct: 507  KVQRVLTAYPHIVNCRDLDGRHSTPLHFAAGYNRVAVCQYLLSHGADVHAKDKGGLVPLH 566

Query: 466  ---------------------NATDKWGFTPLHEAAQKGRTQLSALLPLSPSAANDPLRE 504
                                 N +D W FTPLHEAA KG+ ++              +R 
Sbjct: 567  NACSYGHFEVTDMLIQHGANVNVSDLWKFTPLHEAAAKGKYEI--------------VRL 612

Query: 505  LFEACKGGDLTKVKKLVNPQTVNARDTAGRKSTPLHFAAGLVPLHNACSYGHYEVTEMLV 564
            L +   G D TK  +  +      RD     +  L   A L+   +A   G     + L+
Sbjct: 613  LLQ--HGADDTKKNRDGHTPLGLVRDNDNEVADLLRGNAALL---DAAKKGILARVQRLL 667

Query: 565  KHGANVNVADLW--KFTPLHEAA-------AKALLQHGADINLKNTDGKTALDLAVPCTR 615
                N+N  D      TPLH AA       A+ LL+ GAD+   N   K  L   +P   
Sbjct: 668  T-SENINCRDTQGRNSTPLHLAAGYNNLEVAEFLLEQGADV---NAQDKGGL---IPLHN 720

Query: 616  AVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCCKMELMFMPRIKDEFKGHC 675
            A   G       L+ A +    L ++   +  TD  W          F P          
Sbjct: 721  ASSYGH------LDLAAL----LIKHNTTVNATD-NWG---------FTP---------- 750

Query: 676  LLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRK-GAHL 734
            L EA ++G        L      F     G TPL  A       R  + +++     A+ 
Sbjct: 751  LHEAAQKGRTQLSALLLAHGADPFLRNQEGQTPLELATAEDV--RSLLTDAMASHPSANS 808

Query: 735  NEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQTALHRTARDDKTQAVRVLL 794
             E N     P      L   +    ++  GA V L    G T            +V    
Sbjct: 809  VENNASTYVPT--PPQLSPEETATVVMPSGASVALPSP-GGTGRSFMLGSQGDGSVNGYE 865

Query: 795  SHNADTSIVSLLVIFSCSTNLGLKHLLELFEREQITLDILAEMNHEDLKQVGVSAYGYRH 854
            S +   + ++L  +    ++L L+HL E+FEREQITLDILAEM HEDLKQ+G++AYGYRH
Sbjct: 866  SAHPHPNCITLSTVQGFLSSLCLEHLNEIFEREQITLDILAEMEHEDLKQIGITAYGYRH 925

Query: 855  KLLKGIEKL-------CSSPSFSQPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSG 907
            KL+KG+EKL       CS  S   P TLLIDLL +DKEFITV +E+Q+T+REHRDNGQSG
Sbjct: 926  KLIKGMEKLVSKHGGVCSGLSGGMPCTLLIDLLPEDKEFITVEQELQSTIREHRDNGQSG 985

Query: 908  GIFSRYNIIRIQKVQNRKLWERYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDE 967
            GIF+RYNI+RIQK+QNRKLW+RY+HR+ EV+ ENG QA+ERMLFHGSPFINAIVQKGFDE
Sbjct: 986  GIFNRYNIVRIQKIQNRKLWDRYIHRKREVSLENGNQANERMLFHGSPFINAIVQKGFDE 1045

Query: 968  RHAIRYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGKRVWL 1027
            RH                                           AYIGGMFGAG  ++ 
Sbjct: 1046 RH-------------------------------------------AYIGGMFGAG--IYF 1060

Query: 1028 GDVKQGVDQLSMAGGLETGTKKKKKNMYYGTL 1059
             +     +Q     G  TG    K    Y  L
Sbjct: 1061 AENSSKSNQYVYGIGGGTGCPSHKDRSCYQCL 1092




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|417413341|gb|JAA53005.1| Putative ankyrin, partial [Desmodus rotundus] Back     alignment and taxonomy information
>gi|417405709|gb|JAA49558.1| Putative ankyrin [Desmodus rotundus] Back     alignment and taxonomy information
>gi|345322774|ref|XP_001508887.2| PREDICTED: tankyrase-1 [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|91076368|ref|XP_967640.1| PREDICTED: similar to tankyrase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270002551|gb|EEZ98998.1| hypothetical protein TcasGA2_TC004859 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242017239|ref|XP_002429099.1| Tankyrase-1, putative [Pediculus humanus corporis] gi|212513963|gb|EEB16361.1| Tankyrase-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345490851|ref|XP_001607870.2| PREDICTED: tankyrase-1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|312376647|gb|EFR23671.1| hypothetical protein AND_12459 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|440895226|gb|ELR47482.1| Tankyrase-1 [Bos grunniens mutus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1236
FB|FBgn00275081181 tankyrase "tankyrase" [Drosoph 0.124 0.130 0.751 7.1e-201
ZFIN|ZDB-GENE-030131-48651267 si:ch211-155m12.3 "si:ch211-15 0.252 0.246 0.413 2e-188
UNIPROTKB|E1BMY01149 TNKS2 "Uncharacterized protein 0.298 0.321 0.452 1.9e-186
UNIPROTKB|F1P1N01269 TNKS "Uncharacterized protein" 0.252 0.245 0.406 2e-186
MGI|MGI:19217431166 Tnks2 "tankyrase, TRF1-interac 0.449 0.476 0.389 8.1e-172
UNIPROTKB|F1P4A91167 TNKS2 "Uncharacterized protein 0.446 0.473 0.384 9.8e-172
RGD|13050261166 Tnks2 "tankyrase, TRF1-interac 0.449 0.476 0.387 4e-170
UNIPROTKB|F6Y5Y41151 TNKS2 "Uncharacterized protein 0.450 0.483 0.381 6.1e-170
UNIPROTKB|F1SCW91166 TNKS2 "Uncharacterized protein 0.450 0.477 0.381 9.6e-170
UNIPROTKB|Q9H2K21166 TNKS2 "Tankyrase-2" [Homo sapi 0.450 0.477 0.381 9.6e-170
FB|FBgn0027508 tankyrase "tankyrase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 615 (221.5 bits), Expect = 7.1e-201, Sum P(6) = 7.1e-201
 Identities = 118/157 (75%), Positives = 135/157 (85%)

Query:   817 LKHLLELFEREQITLDILAEMNHEDLKQVGVSAYGYRHKLLKGIEKLCSSPSFSQPG--- 873
             L HL+ELFEREQITLDILAEM H+DLKQVGVSAYG+RHK+LKGI +L S+          
Sbjct:   903 LHHLIELFEREQITLDILAEMGHDDLKQVGVSAYGFRHKILKGIAQLRSTTGIGNNVNLC 962

Query:   874 TLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGIFSRYNIIRIQKVQNRKLWERYVHR 933
             TLL+DLL DDKEF+ V EEMQAT+REHRDNGQ+GG F+RYNIIR+QKVQNRKLWERY HR
Sbjct:   963 TLLVDLLPDDKEFVAVEEEMQATIREHRDNGQAGGYFTRYNIIRVQKVQNRKLWERYAHR 1022

Query:   934 RAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHA 970
             R E+A+EN  Q++ERMLFHGSPFINAIVQ+GFDERHA
Sbjct:  1023 RQEIAEENFLQSNERMLFHGSPFINAIVQRGFDERHA 1059


GO:0007016 "cytoskeletal anchoring at plasma membrane" evidence=ISS
GO:0005200 "structural constituent of cytoskeleton" evidence=ISS
GO:0003950 "NAD+ ADP-ribosyltransferase activity" evidence=IEA
GO:0035220 "wing disc development" evidence=IGI
GO:0022416 "chaeta development" evidence=IGI
ZFIN|ZDB-GENE-030131-4865 si:ch211-155m12.3 "si:ch211-155m12.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMY0 TNKS2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1N0 TNKS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1921743 Tnks2 "tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4A9 TNKS2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1305026 Tnks2 "tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y5Y4 TNKS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCW9 TNKS2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2K2 TNKS2 "Tankyrase-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.20.766
3rd Layer2.4.2.300.824

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1236
cd01438223 cd01438, tankyrase_like, Tankyrases interact with 1e-47
cd0952466 cd09524, SAM_tankyrase1,2, SAM domain of tankyrase 2e-26
cd01438223 cd01438, tankyrase_like, Tankyrases interact with 3e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-23
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-20
cd01438223 cd01438, tankyrase_like, Tankyrases interact with 2e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-18
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-16
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 5e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-15
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-14
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-13
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 7e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-12
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-12
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-10
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-10
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-10
cd0948756 cd09487, SAM_superfamily, SAM (Sterile alpha motif 3e-10
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-10
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 9e-10
cd01438223 cd01438, tankyrase_like, Tankyrases interact with 1e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-09
pfam0764766 pfam07647, SAM_2, SAM domain (Sterile alpha motif) 1e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-09
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-09
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-09
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-09
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 6e-09
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 7e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-09
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 9e-09
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-08
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-08
smart0045468 smart00454, SAM, Sterile alpha motif 2e-08
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-08
pfam0053662 pfam00536, SAM_1, SAM domain (Sterile alpha motif) 5e-08
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 6e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-08
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 8e-08
cd0952365 cd09523, SAM_TAL, SAM domain of TAL subfamily 8e-08
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-07
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-07
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-07
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-07
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-07
cd0952065 cd09520, SAM_BICC1, SAM domain of BICC1 (bicaudal) 3e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-07
cd0953565 cd09535, SAM_BOI-like_fungal, SAM domain of BOI-li 3e-07
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-07
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 9e-07
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-06
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-06
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-06
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-06
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-06
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-06
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-06
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 8e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-06
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 8e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-06
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 8e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 9e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-06
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 9e-06
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-05
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-05
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-05
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-05
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-05
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-05
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-05
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-05
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-05
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-05
cd0952164 cd09521, SAM_ASZ1, SAM domain of ASZ1 subfamily 4e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-05
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-05
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 6e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 8e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 9e-05
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-04
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 1e-04
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-04
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-04
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-04
cd0953358 cd09533, SAM_Ste50-like_fungal, SAM domain of Ste5 2e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 2e-04
pfam00644206 pfam00644, PARP, Poly(ADP-ribose) polymerase catal 2e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-04
cd0950870 cd09508, SAM_HD, SAM domain of HD-phosphohydrolase 3e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-04
smart0024830 smart00248, ANK, ankyrin repeats 5e-04
smart0024830 smart00248, ANK, ankyrin repeats 5e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 5e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 6e-04
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 6e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-04
cd0951964 cd09519, SAM_ANKS3, SAM domain of ANKS3 subfamily 7e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 8e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 9e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 9e-04
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.001
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.001
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 0.001
cd0953462 cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fun 0.001
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 0.002
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.003
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.003
smart0024830 smart00248, ANK, ankyrin repeats 0.003
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.003
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 0.003
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 0.003
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.004
smart0024830 smart00248, ANK, ankyrin repeats 0.004
>gnl|CDD|238718 cd01438, tankyrase_like, Tankyrases interact with the telomere reverse transcriptase complex (TERT) Back     alignment and domain information
 Score =  169 bits (429), Expect = 1e-47
 Identities = 78/150 (52%), Positives = 92/150 (61%), Gaps = 43/150 (28%)

Query: 873  GTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGIFSRYNIIRIQKVQNRKLWERYVH 932
            GT+L+DL  DDKE+ +V EEMQ+T+REHRD G +GGIF+RYNIIRIQKV N+KL ERY H
Sbjct: 15   GTILLDLAPDDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNIIRIQKVVNKKLRERYCH 74

Query: 933  RRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAIRYVHRRAEVADENGGQAHERM 992
            R+ E+A+EN    +ERMLFHG                                       
Sbjct: 75   RQKEIAEENHNHHNERMLFHG--------------------------------------- 95

Query: 993  LFHGSPFINAIVQKGFDERHAYIGGMFGAG 1022
                SPFINAI+ KGFDERHAYIGGMFGAG
Sbjct: 96   ----SPFINAIIHKGFDERHAYIGGMFGAG 121


Tankyrase 1 poly-ADP-ribosylates Telomere Repeat Binding Factor 1 (TRF1) while Tankyrase 2 can poly-ADP-ribosylate itself or TRF1. The tankyrases also contain multiple ankyrin repeats that mediate protein-protein interaction (binding TRF1 and insulin-responsive aminopeptidase) and may function as a complex. Overexpression of Tank1 promotes increased telomere length when overexpressed, while overexpressed Tank2 has been shown to promote PARP cleavage- independent cell death (necrosis). Length = 223

>gnl|CDD|188923 cd09524, SAM_tankyrase1,2, SAM domain of tankyrase1,2 subfamily Back     alignment and domain information
>gnl|CDD|238718 cd01438, tankyrase_like, Tankyrases interact with the telomere reverse transcriptase complex (TERT) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238718 cd01438, tankyrase_like, Tankyrases interact with the telomere reverse transcriptase complex (TERT) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|188886 cd09487, SAM_superfamily, SAM (Sterile alpha motif ) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238718 cd01438, tankyrase_like, Tankyrases interact with the telomere reverse transcriptase complex (TERT) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|203706 pfam07647, SAM_2, SAM domain (Sterile alpha motif) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197735 smart00454, SAM, Sterile alpha motif Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|215981 pfam00536, SAM_1, SAM domain (Sterile alpha motif) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|188922 cd09523, SAM_TAL, SAM domain of TAL subfamily Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|188919 cd09520, SAM_BICC1, SAM domain of BICC1 (bicaudal) subfamily Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|188934 cd09535, SAM_BOI-like_fungal, SAM domain of BOI-like fungal subfamily Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|188920 cd09521, SAM_ASZ1, SAM domain of ASZ1 subfamily Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|188932 cd09533, SAM_Ste50-like_fungal, SAM domain of Ste50_like (ubc2) subfamily Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|216040 pfam00644, PARP, Poly(ADP-ribose) polymerase catalytic domain Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|188907 cd09508, SAM_HD, SAM domain of HD-phosphohydrolase Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|188918 cd09519, SAM_ANKS3, SAM domain of ANKS3 subfamily Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|188933 cd09534, SAM_Ste11_fungal, SAM domain of Ste11_fungal subfamily Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1236
KOG4177|consensus1143 100.0
KOG4177|consensus 1143 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
KOG0510|consensus929 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus929 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
KOG4412|consensus226 99.98
PHA02875413 ankyrin repeat protein; Provisional 99.98
PHA02875413 ankyrin repeat protein; Provisional 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
KOG4369|consensus 2131 99.97
KOG4369|consensus 2131 99.96
KOG0509|consensus600 99.96
KOG0509|consensus600 99.95
PHA02795437 ankyrin-like protein; Provisional 99.93
PHA02859209 ankyrin repeat protein; Provisional 99.92
PHA02795437 ankyrin-like protein; Provisional 99.92
PHA02859209 ankyrin repeat protein; Provisional 99.92
KOG0505|consensus527 99.9
KOG0502|consensus296 99.89
PLN03192823 Voltage-dependent potassium channel; Provisional 99.88
KOG0514|consensus452 99.87
KOG0502|consensus296 99.87
KOG0507|consensus 854 99.86
KOG0507|consensus854 99.86
KOG0505|consensus 527 99.85
TIGR00870743 trp transient-receptor-potential calcium channel p 99.84
TIGR00870743 trp transient-receptor-potential calcium channel p 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.83
PLN03192823 Voltage-dependent potassium channel; Provisional 99.83
PHA02743166 Viral ankyrin protein; Provisional 99.82
KOG0514|consensus452 99.81
PHA02736154 Viral ankyrin protein; Provisional 99.78
PHA02741169 hypothetical protein; Provisional 99.77
PHA02741169 hypothetical protein; Provisional 99.77
PHA02884300 ankyrin repeat protein; Provisional 99.75
PHA02736154 Viral ankyrin protein; Provisional 99.74
KOG0512|consensus228 99.74
KOG0512|consensus228 99.72
PHA02884300 ankyrin repeat protein; Provisional 99.71
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.66
KOG0195|consensus448 99.64
KOG0195|consensus448 99.62
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.6
KOG3676|consensus782 99.6
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.55
KOG4214|consensus117 99.52
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.51
KOG4214|consensus117 99.5
KOG3676|consensus782 99.48
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.47
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.41
KOG1710|consensus396 99.36
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.35
KOG0515|consensus752 99.35
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.29
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.28
KOG1710|consensus396 99.25
KOG0515|consensus752 99.23
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.21
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.21
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.12
cd01438223 tankyrase_like Tankyrases interact with the telome 98.89
PF1360630 Ank_3: Ankyrin repeat 98.8
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.74
PF1360630 Ank_3: Ankyrin repeat 98.69
KOG0783|consensus 1267 98.69
KOG0506|consensus622 98.61
KOG0818|consensus 669 98.59
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.58
KOG0818|consensus669 98.55
KOG0506|consensus622 98.55
KOG0783|consensus 1267 98.47
KOG0782|consensus1004 98.44
KOG0705|consensus749 98.3
KOG0522|consensus560 98.26
KOG2384|consensus223 98.26
KOG0522|consensus 560 98.17
KOG0782|consensus1004 98.12
KOG2384|consensus223 98.09
KOG0705|consensus749 98.03
KOG3609|consensus822 98.03
KOG3609|consensus 822 97.98
KOG0511|consensus516 97.91
KOG0521|consensus785 97.88
KOG0511|consensus516 97.83
KOG0521|consensus785 97.81
KOG0520|consensus975 97.28
KOG0520|consensus975 97.14
KOG2505|consensus591 97.02
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.69
KOG2505|consensus591 96.25
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.2
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.47
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.92
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 88.66
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 87.92
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 80.19
>KOG4177|consensus Back     alignment and domain information
Probab=100.00  E-value=1.6e-61  Score=579.53  Aligned_cols=622  Identities=27%  Similarity=0.289  Sum_probs=485.3

Q ss_pred             HHHHHHhcCcHHHHHHHHhcCCCCCCCCCCCCcHHHHHHHcCcHHHHHHHHhCCCCCCCCCCCCCCccccccchhHHHHh
Q psy8898         217 PLHNACSYGHFEVTEMLIKAGANVNAMDLWQFTPLHEAASKSRLEVCSLLLSEGADPTLHNCHSKSAIDVAPTRELQQRL  296 (1236)
Q Consensus       217 ~L~~Aa~~g~~~iv~~Ll~~ga~~n~~d~~g~TpL~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~a~~~~~~~~~  296 (1236)
                      +++.|+..++.+++++|+...++.+..+..|.||||+|+..++.+++++++.+|+++...+..|.||             
T Consensus       179 ~~~~~~~~~~~~~~~ll~~~~~~~~a~~~~~~tpl~~a~~~nri~~~eLll~~gadv~a~d~~gl~~-------------  245 (1143)
T KOG4177|consen  179 RLHVAAHCGHARVAKLLLDKKADPNASALNGFTPLHIACKKNRIKVVELLLKHGADVSAKDESGLTP-------------  245 (1143)
T ss_pred             hhhHHhhcchHHHHhhhhcccCCccccccCCCCchhhhccccccceeeeeeeccCcCCcccccCccH-------------
Confidence            6688888888888888888888888888888888888888888888888888888888888888877             


Q ss_pred             hhccCcchHHHHHHcCChHHHHHhhhcccccCCCCCCCCCCCchhHHHHHhhcChhHHHHHHHHHHHhhhhccCCCCCCc
Q psy8898         297 SNEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGY  376 (1236)
Q Consensus       297 ~~~~~~~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~t~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~  376 (1236)
                              ++.|+..|+++++++++..+......+                                             
T Consensus       246 --------lh~a~~~g~~~i~~~l~~~ga~~~~~~---------------------------------------------  272 (1143)
T KOG4177|consen  246 --------LHVAAFMGHLDIVKLLLQHGASVNVST---------------------------------------------  272 (1143)
T ss_pred             --------HHHHHhccchhHHHHHHhcccccCccc---------------------------------------------
Confidence                    555778888888888876654332222                                             


Q ss_pred             cHHHHhhhhhhhhhcCCCCcCchhhHHHHHHhCCCHHHHHHHHhhCCCcccccCCCCCCchHHHHHHhcCCHHHHHHHHh
Q psy8898         377 TALQVAGENSKKLLQEPPSVVDLESQLLEASKGGDMTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLA  456 (1236)
Q Consensus       377 t~l~~a~~~~~~~l~~~~~~~~~~~~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~  456 (1236)
                                          ..++||+|.|+..+..+++++|+++ +.++........  ||+|+|...|+.++++++++
T Consensus       273 --------------------vr~~tplh~AA~~~~~e~~~~ll~~-ga~~~~~~~~~k--t~l~~a~~~g~~~i~~~~l~  329 (1143)
T KOG4177|consen  273 --------------------VRGETPLHMAARAGQVEVCKLLLQN-GADVLAKARDDQ--TPLHIASRLGHEEIVHLLLQ  329 (1143)
T ss_pred             --------------------ccccCcchhhhccchhhhHhhhhcc-Cccccccccccc--ChhhhhcccchHHHHHHHhh
Confidence                                2344567788888899999999988 777777777664  99999999999999999999


Q ss_pred             cCCCCCCCCCCCccCCCChHHHHHhcCchHHHhhcCCCCCC----CCCchhHHHHHHhcCChHHHHHHhCCCCc-ccccc
Q psy8898         457 HGADVHSKDNATDKWGFTPLHEAAQKGRTQLSALLPLSPSA----ANDPLRELFEACKGGDLTKVKKLVNPQTV-NARDT  531 (1236)
Q Consensus       457 ~ga~~~~~~~~~d~~g~t~L~~A~~~~~~~iv~~L~~~~~~----~~~~~~~L~~A~~~g~~~~v~~Ll~~~~~-~~~~~  531 (1236)
                      .++.++..    +..|.||+|+++..++.++..++......    ...+.++++.|++.|..+.+++++..+.. +....
T Consensus       330 ~~~~~~aa----r~~g~t~lHlaa~~~~~~~~~~l~~~~~~~~~a~~k~~~pl~la~~~g~~~~v~Lll~~ga~~~~~gk  405 (1143)
T KOG4177|consen  330 AGATPNAA----RTAGYTPLHLAAKEGQVEVAGALLEHGAQRRQAEEKGFTPLHLAVKSGRVSVVELLLEAGADPNSAGK  405 (1143)
T ss_pred             ccCCcccc----CcCCcccccHhhhhhhHHHHHHhhccccccCcccccCCcchhhhcccCchhHHHhhhhccCCcccCCC
Confidence            99988544    44899999999999998877777655543    45678899999999999999999887543 22222


Q ss_pred             cCCCCchhhhhccchhHHHHHhcCcHHHHHHHHhCCCCCccCCCCCCCHHHHHHHH--------HHHhcCCCCcccCCCC
Q psy8898         532 AGRKSTPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEAAAK--------ALLQHGADINLKNTDG  603 (1236)
Q Consensus       532 ~~~~~t~l~~~~g~t~L~~A~~~g~~~iv~~Ll~~g~~v~~~d~~g~tpL~~a~~~--------~Ll~~g~d~~~~~~~g  603 (1236)
                                 .|+||||.|+..++.++|+.++++|++++..+..|.||+|+|+.+        .+++.|+++|..-..|
T Consensus       406 -----------~gvTplh~aa~~~~~~~v~l~l~~gA~~~~~~~lG~T~lhvaa~~g~~~~~~~~l~~~g~~~n~~s~~G  474 (1143)
T KOG4177|consen  406 -----------NGVTPLHVAAHYGNPRVVKLLLKRGASPNAKAKLGYTPLHVAAKKGRYLQIARLLLQYGADPNAVSKQG  474 (1143)
T ss_pred             -----------CCcceeeehhhccCcceEEEEeccCCChhhHhhcCCChhhhhhhcccHhhhhhhHhhcCCCcchhcccc
Confidence                       288999999999999999999999999999999999999999844        6788899999999999


Q ss_pred             CChhhhhcccCcccccCCchhHHHHHHHHHhCCCcccccCCCCCCCCCcccccccccccccccchhhccccHHHHHHHcC
Q psy8898         604 KTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCCKMELMFMPRIKDEFKGHCLLEACRQG  683 (1236)
Q Consensus       604 ~t~L~~a~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~A~~~g  683 (1236)
                      .||||+|+      ..++.+.+.++....                              ...+...+.+-+++|.+...+
T Consensus       475 ~T~Lhlaa------q~Gh~~~~~llle~~------------------------------~~~~~~~~~~l~~lhla~~~~  518 (1143)
T KOG4177|consen  475 FTPLHLAA------QEGHTEVVQLLLEGG------------------------------ANDNLDAKKGLTPLHLAADED  518 (1143)
T ss_pred             Ccchhhhh------ccCCchHHHHhhhcC------------------------------CccCccchhccchhhhhhhhh
Confidence            99999996      778888888776611                              112445566778888888888


Q ss_pred             CHHHHHHhhccCCcccCCCCCCChHHHHHhhCCCCChHHHHHHHHHcCCCCCCCCCCCchHHHHHHHhCCHHHHHHHHHC
Q psy8898         684 DPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRL  763 (1236)
Q Consensus       684 ~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~iv~~Ll~~gadin~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~  763 (1236)
                      ...+++.+++++.....++..|+||||.|+..   |+..+|++|+++|+|++.+|+.|+||||.||..|+.+|+.+|+++
T Consensus       519 ~v~~~~~l~~~ga~v~~~~~r~~TpLh~A~~~---g~v~~VkfLLe~gAdv~ak~~~G~TPLH~Aa~~G~~~i~~LLlk~  595 (1143)
T KOG4177|consen  519 TVKVAKILLEHGANVDLRTGRGYTPLHVAVHY---GNVDLVKFLLEHGADVNAKDKLGYTPLHQAAQQGHNDIAELLLKH  595 (1143)
T ss_pred             hHHHHHHHhhcCCceehhcccccchHHHHHhc---CCchHHHHhhhCCccccccCCCCCChhhHHHHcChHHHHHHHHHc
Confidence            88888888888887777777788888888886   788888888888888888888888888888888888888888888


Q ss_pred             CCCccccCCCCCcHHHHHHHcCCHHHHHHHHhCCCCC-----Cccccc--------------------------------
Q psy8898         764 GAKVNLVDVLGQTALHRTARDDKTQAVRVLLSHNADT-----SIVSLL--------------------------------  806 (1236)
Q Consensus       764 ga~~n~~d~~G~tpL~~A~~~~~~~iv~~Ll~~ga~~-----~~~~~~--------------------------------  806 (1236)
                      ||++|..|.+|.|||++|+..|+++++++|+..++++     ...+-.                                
T Consensus       596 GA~vna~d~~g~TpL~iA~~lg~~~~~k~l~~~~~~~~~~~~~~e~~~g~~p~~v~e~~~~~~~~~i~~~~~rL~~~~~~  675 (1143)
T KOG4177|consen  596 GASVNAADLDGFTPLHIAVRLGYLSVVKLLKVVTATPAATDPVKENRKGAVPEDVAEELDTDRQDLIRGKLQRLDARPKP  675 (1143)
T ss_pred             CCCCCcccccCcchhHHHHHhcccchhhHHHhccCccccccchhhhhcccChhhHHHHhhhhhhhhhccchHHhhccchh
Confidence            8888888888888888888888888888888888772     111000                                


Q ss_pred             --------------------------------------------------------------------------------
Q psy8898         807 --------------------------------------------------------------------------------  806 (1236)
Q Consensus       807 --------------------------------------------------------------------------------  806 (1236)
                                                                                                      
T Consensus       676 ~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~l~~~g~~v~~~dn~~~~~~~h~gf~~~~~vda~~i~~r~~  755 (1143)
T KOG4177|consen  676 EEAVGLDLIPPQINTRLLQGRESTPLALELGLNSPEVAEHLLEEGADVQLGDNVGLLDPIHSGFLGSFMVDARGGAMRGC  755 (1143)
T ss_pred             hhhhcccCCCCcccccccccccccchhhhhcCchHHHHHHhhcchhhhcccccccccccccccchhhHHHHhhcccccee
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q psy8898         807 --------------------------------------------------------------------------------  806 (1236)
Q Consensus       807 --------------------------------------------------------------------------------  806 (1236)
                                                                                                      
T Consensus       756 ~~~~~~~~~~~~~e~~~~~~tcr~~~~~~~~~~~~~~~~e~~a~~~~~~~p~~~~~l~~~~~~~~~~~~~~~~~~~s~~~  835 (1143)
T KOG4177|consen  756 RHAGDRIIIPPLAEAAPKRITCRRVKLLKLAHPPPLAEREGLASRLLAMAPDGAAFLGPPHFASLLKDERELVVLRSWKE  835 (1143)
T ss_pred             ecccceeeccchhhhcccceehhhcccccccCCCCCccccccchhhhccCCchhhhcCchhHHHHhcCcceEEEeecHhh
Confidence                                                                                            


Q ss_pred             -----------------------------------------------------chhHHHhhhchHHHHHHHHHhcCCHHH
Q psy8898         807 -----------------------------------------------------VIFSCSTNLGLKHLLELFEREQITLDI  833 (1236)
Q Consensus       807 -----------------------------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~  833 (1236)
                                                                           ....+..+....++...+..+.++++.
T Consensus       836 ~~~~~~~~~~~~~l~~~~~l~~~~~~~~~~~~~v~~~~~~~g~~~~~~~~~~~~~~~f~~~~~~~~~r~~~~~~~~~~~~  915 (1143)
T KOG4177|consen  836 HDCNYGEDKLYEILNSAEELDTKRICRIITSDRVRQEYLASGPEGGVSTLVPLVQAVFPENALTKRIRVSLQAQPVPLEV  915 (1143)
T ss_pred             hhhccCcchhhhccchHHHhcccchhhHHhhhhhccccccccCCCCcCcccceehhhcCCCcchHHHHHHHhcccccHHH
Confidence                                                                 000011112223344445667888888


Q ss_pred             HhhcChhhhhhhCcccchhhhhhHHHHHHhhcCCCC---CCCCcceeeccCCChhhhhHHHHHHHHHHhhccCCCCCCcc
Q psy8898         834 LAEMNHEDLKQVGVSAYGYRHKLLKGIEKLCSSPSF---SQPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGIF  910 (1236)
Q Consensus       834 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  910 (1236)
                      +..+.++.++...+.+++.+++..+.+..+...+..   ....+..+.++.....+.+..+.++.....+...+...+.+
T Consensus       916 ~~~~~~~~~~~~~i~~~e~r~~~~~~~~~l~~~~~~~~~~~~~t~~l~ll~~~~~~~~~a~~~~~t~~~h~~~~~~~~~f  995 (1143)
T KOG4177|consen  916 VTKLLGNKATFSPIVTVEPRRRKFHKPITLRIAPGSNNAYSGDTPTLRLLCSITGGVAPAQWEDITGTTHLTFANDCGSF  995 (1143)
T ss_pred             HHHhcCCcccccceeeecchHHHhhhhhhhccccccCcccCCCCchhhhhhcccCCcCcchhhcccceeeccccccccee
Confidence            889999999999999999999888887766553222   22346678888888888888889998888888888888999


Q ss_pred             ccceeeeehhhchhhHHHHHHHHHHHHhhhcCCcchhhhhccCCchhhhhhhcccchhhHHHHhhhhhhhhcccCccchh
Q psy8898         911 SRYNIIRIQKVQNRKLWERYVHRRAEVADENGGQAHERMLFHGSPFINAIVQKGFDERHAIRYVHRRAEVADENGGQAHE  990 (1236)
Q Consensus       911 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~  990 (1236)
                      ..++..++.+..+++.++++.+....+++.+.-                                           ....
T Consensus       996 ~~~~~~r~~~~~~~~~~e~~~~~~~~~~e~~~~-------------------------------------------~~~~ 1032 (1143)
T KOG4177|consen  996 TTNVSARFWLVDCRKTREAVTHATQLYNELIFV-------------------------------------------YMAK 1032 (1143)
T ss_pred             ehhhhhHhhhhhcchhhhhhhHHHHHHHHHHHH-------------------------------------------HHHH
Confidence            999998888888999998887766554433311                                           1245


Q ss_pred             hhhccCchHHHHHHhcCcccccccccccccccce
Q psy8898         991 RMLFHGSPFINAIVQKGFDERHAYIGGMFGAGKR 1024 (1236)
Q Consensus       991 ~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~ 1024 (1236)
                      .++|+++.+..+....+|+..+.+++++++++++
T Consensus      1033 ~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1066 (1143)
T KOG4177|consen 1033 FVVFAKSNFPNEGRLRCFCMTDDKVDKTLEQQEY 1066 (1143)
T ss_pred             HhhhccCCcchhhccccccccCCccCcchhhHHH
Confidence            5667777777777777788777777777776666



>KOG4177|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>cd01438 tankyrase_like Tankyrases interact with the telomere reverse transcriptase complex (TERT) Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1236
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 4e-66
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-15
4hki_A191 Tankyrase 2 In Complex With Flavone Length = 191 3e-40
3kr7_A240 Human Tankyrase 2 - Catalytic Parp Domain Length = 2e-39
3kr7_A240 Human Tankyrase 2 - Catalytic Parp Domain Length = 2e-18
3mhk_A223 Human Tankyrase 2 - Catalytic Parp Domain In Comple 4e-39
3mhk_A223 Human Tankyrase 2 - Catalytic Parp Domain In Comple 3e-18
4dvi_A217 Crystal Structure Of Tankyrase 1 With Iwr2 Length = 7e-36
4dvi_A217 Crystal Structure Of Tankyrase 1 With Iwr2 Length = 3e-19
2rf5_A258 Crystal Structure Of Human Tankyrase 1- Catalytic P 7e-36
2rf5_A258 Crystal Structure Of Human Tankyrase 1- Catalytic P 1e-19
3udd_A224 Tankyrase-1 In Complex With Small Molecule Inhibito 9e-36
3udd_A224 Tankyrase-1 In Complex With Small Molecule Inhibito 2e-19
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-35
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-27
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-07
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-35
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-30
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 3e-07
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-35
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-27
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-07
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-19
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-16
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 6e-13
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-10
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 6e-08
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 5e-06
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-17
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-09
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-16
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 9e-14
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 5e-08
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-16
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-14
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-09
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 6e-16
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-14
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-09
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 7e-16
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 6e-14
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 8e-09
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-15
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 5e-14
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 8e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 5e-05
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-15
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-09
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 3e-09
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-15
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 8e-08
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-15
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 9e-07
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-15
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-13
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 4e-09
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-15
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-09
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 7e-09
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-04
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-15
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-13
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-08
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-15
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-10
2xee_A157 Structural Determinants For Improved Thermal Stabil 5e-15
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-14
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-10
2xeh_A157 Structural Determinants For Improved Thermal Stabil 5e-15
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-14
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-10
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-15
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-14
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-14
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 6e-15
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-09
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 8e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-15
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 7e-08
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 7e-15
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-14
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-06
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-14
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-14
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 1e-14
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 6e-10
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 9e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-07
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-14
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-08
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-14
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-13
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-07
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-14
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-09
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-13
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-09
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 6e-08
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-13
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-07
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-06
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-13
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-12
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-06
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 5e-13
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 5e-13
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-09
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 7e-13
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-08
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 3e-12
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 8e-09
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 9e-06
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 5e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-11
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 5e-09
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-06
1uoh_A226 Human Gankyrin Length = 226 2e-11
1uoh_A226 Human Gankyrin Length = 226 1e-10
1uoh_A226 Human Gankyrin Length = 226 9e-08
1uoh_A226 Human Gankyrin Length = 226 8e-07
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-11
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-10
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 9e-08
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 9e-07
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-11
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 4e-11
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 3e-09
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 8e-08
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-05
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-11
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-05
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 5e-11
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-10
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-07
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-06
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-10
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-10
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 6e-09
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-09
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-07
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 8e-07
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-06
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 1e-09
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 5e-07
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 4e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-09
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-09
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 3e-09
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 3e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 3e-06
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 4e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 4e-09
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 3e-04
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 5e-09
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-04
4hki_C49 Tankyrase 2 In Complex With Flavone Length = 49 1e-08
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 5e-08
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 9e-08
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 5e-06
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 6e-08
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 1e-07
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 7e-06
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 8e-08
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-05
1ycs_B239 P53-53bp2 Complex Length = 239 8e-08
1ycs_B239 P53-53bp2 Complex Length = 239 2e-05
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 2e-07
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 4e-07
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 2e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 4e-07
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-07
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 6e-05
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 7e-07
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 7e-07
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 7e-07
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-06
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 4e-04
2xen_A91 Structural Determinants For Improved Thermal Stabil 4e-06
2xen_A91 Structural Determinants For Improved Thermal Stabil 9e-06
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 1e-05
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 2e-05
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 7e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 3e-05
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 3e-05
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-05
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 5e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 5e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 5e-05
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 6e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 6e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 6e-05
3goy_A193 Crystal Structure Of Human Poly(Adp-Ribose) Polymer 6e-05
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 7e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 8e-05
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 8e-05
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 8e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 8e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 1e-04
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 2e-04
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 2e-04
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-04
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 2e-04
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 4e-04
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 4e-04
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 5e-04
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 6e-04
3blj_A221 Crystal Structure Of Human Poly(adp-ribose) Polymer 7e-04
4f0e_A200 Human Adp-Ribosyltransferase 7 (Artd7PARP15), CATAL 8e-04
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure

Iteration: 1

Score = 250 bits (638), Expect = 4e-66, Method: Compositional matrix adjust. Identities = 146/333 (43%), Positives = 187/333 (56%), Gaps = 79/333 (23%) Query: 504 ELFEACKGGDLTKVKKLVNPQTVNARDTAGRKSTPLHFAAG------------------- 544 EL EA + G+ K+ L+ P VN + GRKSTPLH AAG Sbjct: 27 ELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHA 86 Query: 545 -----LVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEAAAK-------ALLQH 592 LVPLHNACSYGHYEVTE+L+KHGA VN DLW+FTPLHEAA+K LL H Sbjct: 87 KDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSH 146 Query: 593 GADINLKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGW 652 GAD L N GK+A+D+A EL E Sbjct: 147 GADPTLVNCHGKSAVDMA------------PTPELRE----------------------- 171 Query: 653 CSCCCKMELMFMPRIKDEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCA 712 R+ EFKGH LL+A R+ D ++VKK L +++NFK P + +T LHCA Sbjct: 172 -------------RLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCA 218 Query: 713 VTSPYPKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDV 772 V S +PKRK + E L+RKGA++NEKNK+ + P+H+AA+ H DV++ L + GAK+N +D Sbjct: 219 VASLHPKRKQVAELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDS 278 Query: 773 LGQTALHRTARDDKTQAVRVLLSHNADTSIVSL 805 LGQTALHR A Q R+LLS+ +D SI+SL Sbjct: 279 LGQTALHRAALAGHLQTCRLLLSYGSDPSIISL 311
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|4HKI|A Chain A, Tankyrase 2 In Complex With Flavone Length = 191 Back     alignment and structure
>pdb|3KR7|A Chain A, Human Tankyrase 2 - Catalytic Parp Domain Length = 240 Back     alignment and structure
>pdb|3KR7|A Chain A, Human Tankyrase 2 - Catalytic Parp Domain Length = 240 Back     alignment and structure
>pdb|3MHK|A Chain A, Human Tankyrase 2 - Catalytic Parp Domain In Complex With 2-(2- Pyridyl)-7,8-Dihydro-5h-Thiino[4,3-D]pyrimidin-4-Ol Length = 223 Back     alignment and structure
>pdb|3MHK|A Chain A, Human Tankyrase 2 - Catalytic Parp Domain In Complex With 2-(2- Pyridyl)-7,8-Dihydro-5h-Thiino[4,3-D]pyrimidin-4-Ol Length = 223 Back     alignment and structure
>pdb|4DVI|A Chain A, Crystal Structure Of Tankyrase 1 With Iwr2 Length = 217 Back     alignment and structure
>pdb|4DVI|A Chain A, Crystal Structure Of Tankyrase 1 With Iwr2 Length = 217 Back     alignment and structure
>pdb|2RF5|A Chain A, Crystal Structure Of Human Tankyrase 1- Catalytic Parp Domain Length = 258 Back     alignment and structure
>pdb|2RF5|A Chain A, Crystal Structure Of Human Tankyrase 1- Catalytic Parp Domain Length = 258 Back     alignment and structure
>pdb|3UDD|A Chain A, Tankyrase-1 In Complex With Small Molecule Inhibitor Length = 224 Back     alignment and structure
>pdb|3UDD|A Chain A, Tankyrase-1 In Complex With Small Molecule Inhibitor Length = 224 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|4HKI|C Chain C, Tankyrase 2 In Complex With Flavone Length = 49 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|3GOY|A Chain A, Crystal Structure Of Human Poly(Adp-Ribose) Polymerase 14, Catalytic Fragment In Complex With An Inhibitor 3-Aminobenzamide Length = 193 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|3BLJ|A Chain A, Crystal Structure Of Human Poly(adp-ribose) Polymerase 15, Catalytic Fragment Length = 221 Back     alignment and structure
>pdb|4F0E|A Chain A, Human Adp-Ribosyltransferase 7 (Artd7PARP15), CATALYTIC DOMAIN IN Complex With Sto1102 Length = 200 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1236
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-78
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-63
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-40
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-35
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-35
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-29
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-25
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-22
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-21
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-18
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-18
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-08
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-05
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-73
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-69
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-60
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-48
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-26
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-24
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-23
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-23
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-23
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-21
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-05
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-57
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-44
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-42
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-38
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-26
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-26
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-22
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-21
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-13
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-48
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-43
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-40
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-40
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-39
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-33
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-28
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-21
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-19
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-12
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 8e-05
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-45
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-42
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-40
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-40
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-37
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-24
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-23
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-18
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-17
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-44
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-42
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-41
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-38
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-35
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-23
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-21
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-20
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-10
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-44
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-40
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-30
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-24
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-23
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-21
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-21
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-15
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-06
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-43
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-41
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-29
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-23
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-21
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-21
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-20
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-20
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-19
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-18
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-43
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-41
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-28
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-27
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-24
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-21
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-20
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-18
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-18
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-18
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-16
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-13
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-42
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-33
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-17
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-42
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-40
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-24
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-23
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-20
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-20
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-19
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-42
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-35
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-30
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-16
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-42
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-33
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-23
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-20
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-19
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-19
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-17
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-16
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-42
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-41
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-34
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-25
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-17
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-17
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-17
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-42
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-35
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-31
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-29
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-22
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-21
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-16
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-13
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-42
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-41
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-33
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-31
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-24
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-22
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-21
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-19
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-14
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-08
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-42
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-36
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-21
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-21
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-17
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-41
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-32
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-21
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-21
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-20
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-19
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-19
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-18
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-18
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-16
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-16
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-16
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-41
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-39
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-35
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-24
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-22
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-21
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-20
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-20
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-20
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-18
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-17
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-17
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-17
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-41
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-35
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-24
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-21
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-20
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-20
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-20
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-18
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-18
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-18
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-18
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-41
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-40
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-40
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-35
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-28
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-23
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-23
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-21
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-21
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-08
2rfa_A232 Transient receptor potential cation channel subfa 8e-41
2rfa_A232 Transient receptor potential cation channel subfa 6e-33
2rfa_A232 Transient receptor potential cation channel subfa 1e-21
2rfa_A232 Transient receptor potential cation channel subfa 1e-21
2rfa_A232 Transient receptor potential cation channel subfa 2e-18
2rfa_A232 Transient receptor potential cation channel subfa 9e-18
2rfa_A232 Transient receptor potential cation channel subfa 3e-17
2rfa_A232 Transient receptor potential cation channel subfa 7e-17
2rfa_A232 Transient receptor potential cation channel subfa 8e-17
2rfa_A232 Transient receptor potential cation channel subfa 2e-16
2rfa_A232 Transient receptor potential cation channel subfa 1e-15
2rfa_A232 Transient receptor potential cation channel subfa 2e-15
2rfa_A232 Transient receptor potential cation channel subfa 2e-13
2rfa_A232 Transient receptor potential cation channel subfa 3e-13
2rfa_A232 Transient receptor potential cation channel subfa 1e-12
2rfa_A232 Transient receptor potential cation channel subfa 2e-11
2rfa_A232 Transient receptor potential cation channel subfa 2e-07
2rfa_A 232 Transient receptor potential cation channel subfa 2e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-38
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-31
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-30
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-25
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-22
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-20
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-18
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-38
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-32
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-26
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-25
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-19
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-19
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-19
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-17
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-37
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-37
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-33
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-30
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-25
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-24
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-23
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-23
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-21
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-21
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-37
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-34
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-30
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-26
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-22
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-21
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-21
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-18
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-37
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-28
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-22
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-19
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-19
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-17
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-36
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-34
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-32
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-22
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-22
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-20
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-09
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 3e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-36
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-36
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-25
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-21
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-19
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-36
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-31
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-22
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-19
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-18
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-18
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-18
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-17
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-17
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-16
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-16
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-36
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-35
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-22
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-20
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-20
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-36
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-28
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-23
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-23
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-22
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-19
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-19
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-06
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-35
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-35
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-30
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-29
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-27
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-23
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-19
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-16
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-35
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-30
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-19
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-17
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-17
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-17
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-13
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-04
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-35
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-33
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-29
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-26
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-22
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-19
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-19
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-19
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-15
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-15
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-13
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-34
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-31
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-28
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-23
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-22
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-19
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-19
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-18
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-15
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-13
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-10
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-33
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-29
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-23
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-22
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-20
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-20
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-19
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-09
2etb_A256 Transient receptor potential cation channel subfam 3e-32
2etb_A256 Transient receptor potential cation channel subfam 2e-22
2etb_A256 Transient receptor potential cation channel subfam 7e-21
2etb_A256 Transient receptor potential cation channel subfam 2e-18
2etb_A256 Transient receptor potential cation channel subfam 2e-18
2etb_A256 Transient receptor potential cation channel subfam 1e-16
2etb_A256 Transient receptor potential cation channel subfam 4e-15
2etb_A256 Transient receptor potential cation channel subfam 4e-15
2etb_A256 Transient receptor potential cation channel subfam 9e-15
2etb_A256 Transient receptor potential cation channel subfam 1e-14
2etb_A256 Transient receptor potential cation channel subfam 2e-14
2etb_A256 Transient receptor potential cation channel subfam 3e-14
2etb_A256 Transient receptor potential cation channel subfam 8e-11
2etb_A256 Transient receptor potential cation channel subfam 3e-10
2etb_A256 Transient receptor potential cation channel subfam 8e-09
2etb_A256 Transient receptor potential cation channel subfam 4e-08
2etb_A256 Transient receptor potential cation channel subfam 9e-08
2etb_A256 Transient receptor potential cation channel subfam 8e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-32
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-27
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-23
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-21
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-17
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-31
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-28
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-22
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-20
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-20
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-18
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-30
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-30
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-28
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-21
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-15
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-04
3u9h_A240 Tankyrase-2; protein-ligand complex, diphtheria to 1e-29
3u9h_A240 Tankyrase-2; protein-ligand complex, diphtheria to 8e-13
3u9h_A240 Tankyrase-2; protein-ligand complex, diphtheria to 7e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-29
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-26
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-19
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-19
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-14
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-09
2pnn_A273 Transient receptor potential cation channel subfa 3e-29
2pnn_A273 Transient receptor potential cation channel subfa 1e-28
2pnn_A273 Transient receptor potential cation channel subfa 7e-26
2pnn_A273 Transient receptor potential cation channel subfa 9e-22
2pnn_A273 Transient receptor potential cation channel subfa 4e-20
2pnn_A273 Transient receptor potential cation channel subfa 4e-18
2pnn_A273 Transient receptor potential cation channel subfa 8e-18
2pnn_A273 Transient receptor potential cation channel subfa 5e-17
2pnn_A273 Transient receptor potential cation channel subfa 4e-16
2pnn_A273 Transient receptor potential cation channel subfa 6e-15
2pnn_A273 Transient receptor potential cation channel subfa 3e-12
2pnn_A273 Transient receptor potential cation channel subfa 5e-12
2pnn_A273 Transient receptor potential cation channel subfa 2e-10
2pnn_A 273 Transient receptor potential cation channel subfa 4e-10
2pnn_A273 Transient receptor potential cation channel subfa 7e-09
2pnn_A273 Transient receptor potential cation channel subfa 2e-08
2pnn_A273 Transient receptor potential cation channel subfa 4e-06
2pnn_A273 Transient receptor potential cation channel subfa 4e-04
2pnn_A273 Transient receptor potential cation channel subfa 9e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-29
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-28
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-20
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-15
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-15
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-15
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-24
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-22
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-21
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-19
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-15
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-19
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-23
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-22
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-21
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-17
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-16
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-15
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-14
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-14
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-21
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-20
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-06
3smj_A193 Poly [ADP-ribose] polymerase 14; diphtheria toxin 2e-18
3hkv_A217 PARP-10, poly [ADP-ribose] polymerase 10; NAD, tra 4e-18
3blj_A221 Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, 6e-17
3blj_A221 Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, 4e-04
2pqf_A198 Poly [ADP-ribose] polymerase 12; enzyme-inhibitor 8e-15
2pqf_A198 Poly [ADP-ribose] polymerase 12; enzyme-inhibitor 2e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 7e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 9e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 7e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 8e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-04
2x5y_A173 Zinc finger CCCH-type antiviral protein 1; antivir 2e-12
2x5y_A173 Zinc finger CCCH-type antiviral protein 1; antivir 1e-04
3k1r_B74 Usher syndrome type-1G protein; protein-protein co 2e-11
2ean_A83 Connector enhancer of kinase suppressor of RAS 2; 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2e8o_A103 SAM domain and HD domain-containing protein 1; cel 2e-09
2f3n_A76 SH3 and multiple ankyrin repeat domains 3; postsyn 3e-09
3bs5_B80 Connector enhancer of kinase suppressor of RAS 2; 3e-09
2kg5_A100 ARF-GAP, RHO-GAP domain, ANK repeat and PH domain- 6e-09
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-04
2gle_A74 Neurabin-1; SAM domain, scaffold, protein protein 1e-08
1x40_A91 ARAP2; ASAP-related protein2, GTPase activity, sig 2e-08
3bq7_A81 Diacylglycerol kinase delta; SAM domain, polymeriz 2e-08
1b0x_A94 Protein (EPHA4 receptor tyrosine kinase); protein 2e-08
1ucv_A81 Ephrin type-A receptor 8; receptor oligomerization 4e-08
2qkq_A83 Ephrin type-B receptor 4; ATP-binding, glycoprotei 7e-08
2d3d_A88 VTS1 protein; RNA binding, SAM domain, SRE hairpin 8e-08
3h8m_A90 Ephrin type-A receptor 7; SAM domain, kinase,struc 8e-08
2eao_A99 Ephrin type-B receptor 1; cell-free protein synthe 8e-08
2b6g_A119 VTS1P; alpha-helix, pentaloop, hairpin, RNA bindin 1e-07
2es6_A101 VTS1P; SAM domain, protein structure, gene regulat 2e-07
1b4f_A82 EPHB2; SAM domain, EPH receptor, signal transducti 2e-07
2e8n_A88 Ephrin type-A receptor 2; cell-free protein synthe 2e-07
3hil_A82 Ephrin type-A receptor 1; ATP-binding, kinase, nuc 4e-07
3kka_C86 Ephrin type-A receptor 2; ATP-binding, kinase, nuc 7e-07
2kso_A82 Ephrin type-A receptor 2; SAM domain, heterodimer, 1e-06
2k4p_A86 Phosphatidylinositol-3,4,5-trisphosphate 5- phosph 1e-06
3bs7_A78 Protein aveugle; sterIle alpha motif (SAM) domain, 2e-06
1wwv_A91 Connector enhancer of kinase suppressor of RAS 1; 2e-06
2eam_A80 Putative 47 kDa protein; cell-free protein synthes 2e-06
4dqy_C506 Poly [ADP-ribose] polymerase 1; PARP, poly(ADP-rib 2e-06
3sei_A149 Caskin-1; SAM domain, protein-protein interaction, 4e-06
3bs5_A106 Protein aveugle; sterIle alpha motif, SAM domain, 4e-06
1efy_A350 Poly (ADP-ribose) polymerase; benzimidazole, inhib 5e-06
1v38_A78 SAM-domain protein samsn-1; structural genomics, h 6e-06
3c4h_A357 Poly(ADP-ribose) polymerase 3; enzyme-inhibitor co 9e-06
3c4h_A357 Poly(ADP-ribose) polymerase 3; enzyme-inhibitor co 5e-04
3kjd_A368 Poly [ADP-ribose] polymerase 2; transferase, enzym 2e-05
1ow5_A85 Serine/threonine-protein kinase STE11; MAP kinase, 2e-05
2ke7_A103 Ankyrin repeat and sterIle alpha motif domain- con 2e-05
2lmr_A101 ODIN, ankyrin repeat and SAM domain-containing pro 4e-04
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
 Score =  262 bits (671), Expect = 1e-78
 Identities = 141/385 (36%), Positives = 189/385 (49%), Gaps = 101/385 (26%)

Query: 426 VNCRDLDGRHSTPLHFAAGY-NRVAVVEYLLAHGADVHSKDNATDKWGFTPLHEAAQKGR 484
                   +    L  AA   N   ++  L     +     +A+D    TPLH AA   R
Sbjct: 17  AVLTGEYKK--DELLEAARSGNEEKLMALLTPLNVNC----HASDGRKSTPLHLAAGYNR 70

Query: 485 TQLSALLPLSPSAANDPLRELFEACKGGDLTKVKKLVNPQTVNARDTAGRKSTPLHFAAG 544
            ++  LL L                 G D            V+A+D  G           
Sbjct: 71  VRIVQLL-LQ---------------HGAD------------VHAKDKGGL---------- 92

Query: 545 LVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEAA-------AKALLQHGADIN 597
            VPLHNACSYGHYEVTE+L+KHGA VN  DLW+FTPLHEAA          LL HGAD  
Sbjct: 93  -VPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPT 151

Query: 598 LKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCC 657
           L N  GK+A+D+A        + + ++                                 
Sbjct: 152 LVNCHGKSAVDMAP-------TPELRE--------------------------------- 171

Query: 658 KMELMFMPRIKDEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPY 717
                   R+  EFKGH LL+A R+ D ++VKK L  +++NFK P + +T LHCAV S +
Sbjct: 172 --------RLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLH 223

Query: 718 PKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQTA 777
           PKRK + E L+RKGA++NEKNK+ + P+H+AA+  H DV++ L + GAK+N +D LGQTA
Sbjct: 224 PKRKQVAELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDSLGQTA 283

Query: 778 LHRTARDDKTQAVRVLLSHNADTSI 802
           LHR A     Q  R+LLS+ +D SI
Sbjct: 284 LHRAALAGHLQTCRLLLSYGSDPSI 308


>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3u9h_A Tankyrase-2; protein-ligand complex, diphtheria toxin like fold, transfer ribosylation; HET: SO4; 1.75A {Homo sapiens} PDB: 3kr8_A* 3kr7_A* 3p0n_A* 3p0p_A* 3p0q_A* 3mhj_A* 3u9y_A* 3ua9_A* 4avu_A* 4avw_A* 3mhk_A* 2rf5_A 3udd_A* 3uh2_A* 3uh4_A* 4dvi_A* Length = 240 Back     alignment and structure
>3u9h_A Tankyrase-2; protein-ligand complex, diphtheria toxin like fold, transfer ribosylation; HET: SO4; 1.75A {Homo sapiens} PDB: 3kr8_A* 3kr7_A* 3p0n_A* 3p0p_A* 3p0q_A* 3mhj_A* 3u9y_A* 3ua9_A* 4avu_A* 4avw_A* 3mhk_A* 2rf5_A 3udd_A* 3uh2_A* 3uh4_A* 4dvi_A* Length = 240 Back     alignment and structure
>3u9h_A Tankyrase-2; protein-ligand complex, diphtheria toxin like fold, transfer ribosylation; HET: SO4; 1.75A {Homo sapiens} PDB: 3kr8_A* 3kr7_A* 3p0n_A* 3p0p_A* 3p0q_A* 3mhj_A* 3u9y_A* 3ua9_A* 4avu_A* 4avw_A* 3mhk_A* 2rf5_A 3udd_A* 3uh2_A* 3uh4_A* 4dvi_A* Length = 240 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3smj_A Poly [ADP-ribose] polymerase 14; diphtheria toxin like fold, transferase, NAD+, ADP-ribosylat transferase-transferase inhibitor complex; HET: FDR; 1.50A {Homo sapiens} PDB: 3goy_A* 3smi_A* 3se2_A* Length = 193 Back     alignment and structure
>3hkv_A PARP-10, poly [ADP-ribose] polymerase 10; NAD, transferase, structural genomics, structural genomics consortium, SGC, cytoplasm, glycosyltransferase; HET: 3AB; 2.10A {Homo sapiens} Length = 217 Back     alignment and structure
>3blj_A Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, structural GE consortium, glycosyltransferase, NAD, nucleus; 2.20A {Homo sapiens} PDB: 3gey_A* Length = 221 Back     alignment and structure
>3blj_A Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, structural GE consortium, glycosyltransferase, NAD, nucleus; 2.20A {Homo sapiens} PDB: 3gey_A* Length = 221 Back     alignment and structure
>2pqf_A Poly [ADP-ribose] polymerase 12; enzyme-inhibitor complex, catalytic fragment, structural GEN structural genomics consortium, SGC, transferase; HET: GAB CIT; 2.20A {Homo sapiens} Length = 198 Back     alignment and structure
>2pqf_A Poly [ADP-ribose] polymerase 12; enzyme-inhibitor complex, catalytic fragment, structural GEN structural genomics consortium, SGC, transferase; HET: GAB CIT; 2.20A {Homo sapiens} Length = 198 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2x5y_A Zinc finger CCCH-type antiviral protein 1; antiviral defense, immune system, transferase; 1.05A {Homo sapiens} Length = 173 Back     alignment and structure
>2x5y_A Zinc finger CCCH-type antiviral protein 1; antiviral defense, immune system, transferase; 1.05A {Homo sapiens} Length = 173 Back     alignment and structure
>3k1r_B Usher syndrome type-1G protein; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} Length = 74 Back     alignment and structure
>2ean_A Connector enhancer of kinase suppressor of RAS 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2f3n_A SH3 and multiple ankyrin repeat domains 3; postsynaptic density, SAM domain, shank, scaffolding protein, structural protein; 2.10A {Rattus norvegicus} SCOP: a.60.1.2 PDB: 2f44_A Length = 76 Back     alignment and structure
>3bs5_B Connector enhancer of kinase suppressor of RAS 2; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Homo sapiens} Length = 80 Back     alignment and structure
>2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2gle_A Neurabin-1; SAM domain, scaffold, protein protein interaction, protein binding; NMR {Rattus norvegicus} Length = 74 Back     alignment and structure
>1x40_A ARAP2; ASAP-related protein2, GTPase activity, signal transduction, SAM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 91 Back     alignment and structure
>3bq7_A Diacylglycerol kinase delta; SAM domain, polymerization domain, alternative splicing, cytoplasm, membrane, metal-binding, phorbol-ester binding; 2.90A {Homo sapiens} Length = 81 Back     alignment and structure
>1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2 Length = 94 Back     alignment and structure
>1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 81 Back     alignment and structure
>2qkq_A Ephrin type-B receptor 4; ATP-binding, glycoprotein, kinase, membrane, nucleotide- binding, phosphorylation, repeat, signal, transferase; 2.10A {Homo sapiens} Length = 83 Back     alignment and structure
>2d3d_A VTS1 protein; RNA binding, SAM domain, SRE hairpin binding, RNA binding protein; 1.60A {Saccharomyces cerevisiae} PDB: 2f8k_A 2fe9_A Length = 88 Back     alignment and structure
>3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens} Length = 90 Back     alignment and structure
>2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2b6g_A VTS1P; alpha-helix, pentaloop, hairpin, RNA binding protein; NMR {Saccharomyces cerevisiae} Length = 119 Back     alignment and structure
>2es6_A VTS1P; SAM domain, protein structure, gene regulation; NMR {Saccharomyces cerevisiae} PDB: 2ese_A Length = 101 Back     alignment and structure
>1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A Length = 82 Back     alignment and structure
>2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3hil_A Ephrin type-A receptor 1; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.00A {Homo sapiens} PDB: 3kka_A Length = 82 Back     alignment and structure
>3kka_C Ephrin type-A receptor 2; ATP-binding, kinase, nucleotide-binding, transferase, tyrosine-protein kinase, signal, sterIle alpha motif; 2.40A {Homo sapiens} Length = 86 Back     alignment and structure
>2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2k4p_A Phosphatidylinositol-3,4,5-trisphosphate 5- phosphatase 2; helix bundle, signaling protein, actin-binding, alternative splicing, cell adhesion; NMR {Homo sapiens} PDB: 2kso_B Length = 86 Back     alignment and structure
>3bs7_A Protein aveugle; sterIle alpha motif (SAM) domain, cytoplasm, membrane, sensory transduction, vision, signaling protein; 1.90A {Drosophila melanogaster} Length = 78 Back     alignment and structure
>1wwv_A Connector enhancer of kinase suppressor of RAS 1; structural genomics, protein regulation, transcription; NMR {Homo sapiens} SCOP: a.60.1.2 Length = 91 Back     alignment and structure
>2eam_A Putative 47 kDa protein; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>4dqy_C Poly [ADP-ribose] polymerase 1; PARP, poly(ADP-ribose) polymerase, DNA binding protein, ADP- transferase, PARP-like zinc finger, poly(ADP-ribosyl)ation; HET: DNA; 3.25A {Homo sapiens} PDB: 2cr9_A Length = 506 Back     alignment and structure
>3sei_A Caskin-1; SAM domain, protein-protein interaction, signaling protein; 2.40A {Homo sapiens} PDB: 3sen_A Length = 149 Back     alignment and structure
>3bs5_A Protein aveugle; sterIle alpha motif, SAM domain, SAM domain dimer, SAM domain complex, cytoplasm, membrane; 2.00A {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1efy_A Poly (ADP-ribose) polymerase; benzimidazole, inhibitor, catalytic fragment, transferase; HET: BZC; 2.20A {Gallus gallus} SCOP: a.41.1.1 d.166.1.2 PDB: 1a26_A* 1pax_A* 2paw_A 2pax_A* 3pax_A* 4pax_A* 2rcw_A* 1uk1_A* 1wok_A* 1uk0_A* 2rd6_A* 3gjw_A* 3gn7_A* 3l3l_A* 3l3m_A* Length = 350 Back     alignment and structure
>1v38_A SAM-domain protein samsn-1; structural genomics, hypothetical protein, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.60.1.2 Length = 78 Back     alignment and structure
>3c4h_A Poly(ADP-ribose) polymerase 3; enzyme-inhibitor complex, catalytic fragment, structural GEN structural genomics consortium, SGC; HET: DRL; 2.10A {Homo sapiens} PDB: 3c49_A* 2pa9_A* 3ce0_A* 3fhb_A* Length = 357 Back     alignment and structure
>3c4h_A Poly(ADP-ribose) polymerase 3; enzyme-inhibitor complex, catalytic fragment, structural GEN structural genomics consortium, SGC; HET: DRL; 2.10A {Homo sapiens} PDB: 3c49_A* 2pa9_A* 3ce0_A* 3fhb_A* Length = 357 Back     alignment and structure
>3kjd_A Poly [ADP-ribose] polymerase 2; transferase, enzyme-inhibitor complex, catalytic fragment, S genomics, structural genomics consortium, SGC; HET: 78P; 1.95A {Homo sapiens} PDB: 3kcz_A* 1gs0_A Length = 368 Back     alignment and structure
>1ow5_A Serine/threonine-protein kinase STE11; MAP kinase, MAPKKK, SAM domain, pointed domain, SCM domain, STE50 regulator, transferase; NMR {Saccharomyces cerevisiae} SCOP: a.60.1.2 PDB: 1x9x_A Length = 85 Back     alignment and structure
>2ke7_A Ankyrin repeat and sterIle alpha motif domain- containing protein 1B; SAM domain, alternative splicing, ANK repeat, cell junction, cell membrane; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2lmr_A ODIN, ankyrin repeat and SAM domain-containing protein; signaling protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1236
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.98
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.98
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.97
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.97
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.96
2rfa_A232 Transient receptor potential cation channel subfa 99.96
2rfa_A232 Transient receptor potential cation channel subfa 99.96
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.95
3hra_A201 Ankyrin repeat family protein; structural protein; 99.95
2pnn_A273 Transient receptor potential cation channel subfa 99.95
2etb_A256 Transient receptor potential cation channel subfam 99.95
2pnn_A273 Transient receptor potential cation channel subfa 99.95
2etb_A256 Transient receptor potential cation channel subfam 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.93
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.92
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.92
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.92
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.92
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.92
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.92
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.92
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.92
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.91
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.91
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.91
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.91
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.91
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.9
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.9
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.89
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.89
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.88
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.87
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.87
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.86
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.86
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.85
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.85
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.83
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.81
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.81
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.8
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.8
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.79
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.79
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.78
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.78
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.77
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.77
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.77
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.77
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.77
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.74
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.73
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.73
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.71
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.71
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.71
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.7
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.65
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.59
3u9h_A240 Tankyrase-2; protein-ligand complex, diphtheria to 97.4
2kg5_A100 ARF-GAP, RHO-GAP domain, ANK repeat and PH domain- 93.46
2e8n_A88 Ephrin type-A receptor 2; cell-free protein synthe 83.2
2kso_A82 Ephrin type-A receptor 2; SAM domain, heterodimer, 82.37
3h8m_A90 Ephrin type-A receptor 7; SAM domain, kinase,struc 82.15
1ucv_A81 Ephrin type-A receptor 8; receptor oligomerization 82.13
3hkv_A217 PARP-10, poly [ADP-ribose] polymerase 10; NAD, tra 81.39
1b4f_A82 EPHB2; SAM domain, EPH receptor, signal transducti 81.06
3k1r_B74 Usher syndrome type-1G protein; protein-protein co 81.02
2eao_A99 Ephrin type-B receptor 1; cell-free protein synthe 80.66
1b0x_A94 Protein (EPHA4 receptor tyrosine kinase); protein 80.45
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=8.4e-58  Score=545.78  Aligned_cols=399  Identities=31%  Similarity=0.383  Sum_probs=300.7

Q ss_pred             HcCCCccccCCCCcchhhHHhhcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHhCCCceEEeeeccccCccccccccc
Q psy8898          12 ASGASIHARDDGGLHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTPLHEAAAKGKTDVCIGIYFAEHSSKSNQYVYG   91 (1236)
Q Consensus        12 ~~ga~~n~~d~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~n~~d~~g~t~L~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~   91 (1236)
                      +.|+++|..|..|+||||+||..|+.++|++|+++|+++|..|..|.||||+|+..|+.+++++                
T Consensus         2 ~~g~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~----------------   65 (437)
T 1n11_A            2 SPGISGGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKY----------------   65 (437)
T ss_dssp             -------------CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHH----------------
T ss_pred             CCCCCccccCCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHH----------------
Confidence            4689999999999999999999999999999999999999999999999999999999999988                


Q ss_pred             cCCCCCCCCCcchhHHHhcCCCCCCcccCCCCcchhhcccChHHHHHHHHhcCCCCCCCCCCCCCCCCCcccccccCCCC
Q psy8898          92 IGGGTGCPMHKDRSCYLAHGADPFLKNQEGQTPLDLTVAEDVRSLLQDAMAQYPGAPSCAETASVPPPSQYSNTSCGDNV  171 (1236)
Q Consensus        92 ~~~~~~~~~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~~~~~~v~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  171 (1236)
                                     |+++|++++.++..|.||||+|+..|+.++++.|++......                       
T Consensus        66 ---------------Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~-----------------------  107 (437)
T 1n11_A           66 ---------------LLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPN-----------------------  107 (437)
T ss_dssp             ---------------HHHHTCCSSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTT-----------------------
T ss_pred             ---------------HHhCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHhCCCCCC-----------------------
Confidence                           999999999999988888888888888888877776531100                       


Q ss_pred             CCCCCCccCCCCCCcccCCCCCCChhhhHHHhcCcCCccccCCchHHHHHHhcCcHHHHHHHHhcCCCCCCCCCCCCcHH
Q psy8898         172 SLPPPAQYSGSGGDSVSLPPTSPPQPLALETVIMPSGQAVALGLVPLHNACSYGHFEVTEMLIKAGANVNAMDLWQFTPL  251 (1236)
Q Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~Ll~~g~~~~~g~T~L~~Aa~~g~~~iv~~Ll~~ga~~n~~d~~g~TpL  251 (1236)
                                                           .....|.||||+|+..|+.++|++|++.|++++..+..|+|||
T Consensus       108 -------------------------------------~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L  150 (437)
T 1n11_A          108 -------------------------------------LATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPL  150 (437)
T ss_dssp             -------------------------------------CCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHH
T ss_pred             -------------------------------------CCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHH
Confidence                                                 0011377888888888888888888888888887788888888


Q ss_pred             HHHHHcCcHHHHHHHHhCCCCCCCCCCCCCCccccccchhHHHHhhhccCcchHHHHHHcCChHHHHHhhhcccccCCCC
Q psy8898         252 HEAASKSRLEVCSLLLSEGADPTLHNCHSKSAIDVAPTRELQQRLSNEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHP  331 (1236)
Q Consensus       252 ~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~a~~~~~~~~~~~~~~~~~l~~A~~~g~~~~v~~ll~~~~~~~~~~  331 (1236)
                      |+|+..|+.+++++|+++|++++..+..|.||                                                
T Consensus       151 ~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~------------------------------------------------  182 (437)
T 1n11_A          151 HVAAKYGKVRVAELLLERDAHPNAAGKNGLTP------------------------------------------------  182 (437)
T ss_dssp             HHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCH------------------------------------------------
T ss_pred             HHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCH------------------------------------------------
Confidence            88888888888888888888777766555544                                                


Q ss_pred             CCCCCCCchhHHHHHhhcChhHHHHHHHHHHHhhhhccCCCCCCccHHHHhhhhhhhhhcCCCCcCchhhHHHHHHhCCC
Q psy8898         332 YTGDTPLPGTLLIDLLSDDKEFITVAEEMQATVREHRDNGQSGGYTALQVAGENSKKLLQEPPSVVDLESQLLEASKGGD  411 (1236)
Q Consensus       332 ~~~~t~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~t~l~~a~~~~~~~l~~~~~~~~~~~~L~~A~~~g~  411 (1236)
                                                                                             |+.|+..|+
T Consensus       183 -----------------------------------------------------------------------L~~A~~~~~  191 (437)
T 1n11_A          183 -----------------------------------------------------------------------LHVAVHHNN  191 (437)
T ss_dssp             -----------------------------------------------------------------------HHHHHHTTC
T ss_pred             -----------------------------------------------------------------------HHHHHHcCC
Confidence                                                                                   344455566


Q ss_pred             HHHHHHHHhhCCCcccccCCCCCCchHHHHHHhcCCHHHHHHHHhcCCCCCCCCCCCccCCCChHHHHHhcCchHHHhhc
Q psy8898         412 MTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKDNATDKWGFTPLHEAAQKGRTQLSALL  491 (1236)
Q Consensus       412 ~~~v~~Ll~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~~d~~g~t~L~~A~~~~~~~iv~~L  491 (1236)
                      .+++++|++. +..++..+.++  +||||+|+..|+.+++++|+++|++++..+.    .                    
T Consensus       192 ~~~v~~Ll~~-g~~~~~~~~~g--~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~----~--------------------  244 (437)
T 1n11_A          192 LDIVKLLLPR-GGSPHSPAWNG--YTPLHIAAKQNQVEVARSLLQYGGSANAESV----Q--------------------  244 (437)
T ss_dssp             HHHHHHHGGG-TCCSCCCCTTC--CCHHHHHHHTTCHHHHHHHHHTTCCTTCCCT----T--------------------
T ss_pred             HHHHHHHHhC-CCCCCCcCCCC--CCHHHHHHHcCCHHHHHHHHHcCCCCCCCCC----C--------------------
Confidence            6666666665 44444444443  4777777777777777777777777643322    3                    


Q ss_pred             CCCCCCCCCchhHHHHHHhcCChHHHHHHhCCCCcccccccCCCCchhhhhccchhHHHHHhcCcHHHHHHHHhCCCCCc
Q psy8898         492 PLSPSAANDPLRELFEACKGGDLTKVKKLVNPQTVNARDTAGRKSTPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVN  571 (1236)
Q Consensus       492 ~~~~~~~~~~~~~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~t~l~~~~g~t~L~~A~~~g~~~iv~~Ll~~g~~v~  571 (1236)
                                                                          |.||||+|+..|+.+++++|+++|++++
T Consensus       245 ----------------------------------------------------g~t~L~~A~~~g~~~~v~~Ll~~~~~~~  272 (437)
T 1n11_A          245 ----------------------------------------------------GVTPLHLAAQEGHAEMVALLLSKQANGN  272 (437)
T ss_dssp             ----------------------------------------------------CCCHHHHHHHTTCHHHHHHHHTTTCCTT
T ss_pred             ----------------------------------------------------CCCHHHHHHHCCCHHHHHHHHhcCCCCC
Confidence                                                                4555666666666667777766666555


Q ss_pred             cCCCCCCCHHHHHHHHHHHhcCCCCcccCCCCCChhhhhcccCcccccCCchhHHHHHHHHHhCCCcccccCCCCCCCCC
Q psy8898         572 VADLWKFTPLHEAAAKALLQHGADINLKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIG  651 (1236)
Q Consensus       572 ~~d~~g~tpL~~a~~~~Ll~~g~d~~~~~~~g~t~L~~a~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~  651 (1236)
                      ..+..|.|||                                                                      
T Consensus       273 ~~~~~g~t~L----------------------------------------------------------------------  282 (437)
T 1n11_A          273 LGNKSGLTPL----------------------------------------------------------------------  282 (437)
T ss_dssp             CCCTTCCCHH----------------------------------------------------------------------
T ss_pred             CCCCCCCCHH----------------------------------------------------------------------
Confidence            4443333322                                                                      


Q ss_pred             cccccccccccccccchhhccccHHHHHHHcCCHHHHHHhhccCCcccCCCCCCChHHHHHhhCCCCChHHHHHHHHHcC
Q psy8898         652 WCSCCCKMELMFMPRIKDEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRKG  731 (1236)
Q Consensus       652 ~~~~~~~~~~~~~~~~~~~~~~~~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~iv~~Ll~~g  731 (1236)
                                               |.|+..|+.+++++|++.+......+..|+||||+|+..   ++.++|++|+++|
T Consensus       283 -------------------------~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~---g~~~~v~~Ll~~g  334 (437)
T 1n11_A          283 -------------------------HLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHY---GNIKLVKFLLQHQ  334 (437)
T ss_dssp             -------------------------HHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHS---SCSHHHHHHHHTT
T ss_pred             -------------------------HHHHHcCCHHHHHHHHhCCccCCCCCCCCCCHHHHHHHc---CcHHHHHHHHhcC
Confidence                                     223445666666666666665555556688888888886   7899999999999


Q ss_pred             CCCCCCCCCCchHHHHHHHhCCHHHHHHHHHCCCCccccCCCCCcHHHHHHHcCCHHHHHHHHhCC
Q psy8898         732 AHLNEKNKELLAPIHLAADLGHLDVLDTLLRLGAKVNLVDVLGQTALHRTARDDKTQAVRVLLSHN  797 (1236)
Q Consensus       732 adin~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~ga~~n~~d~~G~tpL~~A~~~~~~~iv~~Ll~~g  797 (1236)
                      +++|.+|..|+||||+|++.|+.++|++|+++|++++.+|.+|+|||++|.+.|+.+++++|....
T Consensus       335 ad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~g~~~~~~~l~~~~  400 (437)
T 1n11_A          335 ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVT  400 (437)
T ss_dssp             CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHHHHHC
T ss_pred             CCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHhcc
Confidence            999999999999999999999999999999999999999999999999999999999999997654



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3u9h_A Tankyrase-2; protein-ligand complex, diphtheria toxin like fold, transfer ribosylation; HET: SO4; 1.75A {Homo sapiens} PDB: 3kr8_A* 3kr7_A* 3p0n_A* 3p0p_A* 3p0q_A* 3mhj_A* 3u9y_A* 3ua9_A* 4avu_A* 4avw_A* 3mhk_A* 2rf5_A 3udd_A* 3uh2_A* 3uh4_A* 4dvi_A* 4hlh_A* 4hki_A* 4hkn_A* 4hl5_A* ... Back     alignment and structure
>2kg5_A ARF-GAP, RHO-GAP domain, ANK repeat and PH domain-containing protein 3; SAM domain, helix bundle, cell membrane, cell projection, cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2e8n_A Ephrin type-A receptor 2; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kso_A Ephrin type-A receptor 2; SAM domain, heterodimer, cell signaling, angiogenesis, apopt ATP-binding, cataract; NMR {Homo sapiens} Back     alignment and structure
>3h8m_A Ephrin type-A receptor 7; SAM domain, kinase,structural genomics, structural genomics consortium, SGC, alternative splicing, ATP-binding; 2.10A {Homo sapiens} Back     alignment and structure
>1ucv_A Ephrin type-A receptor 8; receptor oligomerization, developmental regulation, tyrosine kinase, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: a.60.1.2 Back     alignment and structure
>3hkv_A PARP-10, poly [ADP-ribose] polymerase 10; NAD, transferase, structural genomics, structural genomics consortium, SGC, cytoplasm, glycosyltransferase; HET: 3AB; 2.10A {Homo sapiens} Back     alignment and structure
>1b4f_A EPHB2; SAM domain, EPH receptor, signal transduction, oligomer; 1.95A {Homo sapiens} SCOP: a.60.1.2 PDB: 1f0m_A 1sgg_A Back     alignment and structure
>3k1r_B Usher syndrome type-1G protein; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} Back     alignment and structure
>2eao_A Ephrin type-B receptor 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b0x_A Protein (EPHA4 receptor tyrosine kinase); protein interaction module, dimerization domain, transferase; 2.00A {Mus musculus} SCOP: a.60.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1236
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-48
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-41
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-35
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-35
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-31
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-30
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-29
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-26
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-25
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-14
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-10
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-29
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-28
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-22
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-21
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-18
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-09
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-06
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-24
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-22
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-19
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-19
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-11
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-11
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-11
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-05
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-24
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-22
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-20
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-16
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-14
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-04
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.002
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-22
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-20
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-17
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-06
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.004
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-22
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-18
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.004
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-21
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-21
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-20
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-15
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-14
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-13
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-11
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.001
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-18
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-17
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-15
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-15
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-11
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-09
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1uoha_ 223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-17
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-16
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-16
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-13
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-06
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-16
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 9e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-15
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-14
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-14
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-11
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.002
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 6e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 6e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.001
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 8e-10
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 8e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.003
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.003
d2f3na164 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat 9e-09
d1ucva_81 a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal 1e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 8e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 7e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 9e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.002
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 9e-08
d1v38a_78 a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (M 9e-08
d1x40a178 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human 3e-07
d1dxsa_57 a.60.1.2 (A:) C-terminal domain of p73 {Human (Hom 4e-07
d1pk3a163 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly 6e-07
d1gs0a2217 d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, 7e-07
d1gs0a2217 d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, 8e-04
d1gs0a2217 d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, 0.002
d1b0xa_72 a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mou 7e-07
d1efya2215 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase 8e-07
d1efya2215 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase 1e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 9e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 8e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1kw4a_70 a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaste 2e-06
d1ow5a_60 a.60.1.2 (A:) Serine/threonine-protein kinase ste1 2e-06
d1b4fa_74 a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) 3e-06
d1oxja162 a.60.1.2 (A:594-655) RNA-binding protein Smaug {Dr 5e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 8e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-04
d1wwva178 a.60.1.2 (A:8-85) Connector enhancer of kinase sup 0.001
d2d8ca185 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 { 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  174 bits (441), Expect = 8e-48
 Identities = 103/412 (25%), Positives = 147/412 (35%), Gaps = 30/412 (7%)

Query: 403 LLEASKGGDMTVVTRLLSSCPHIVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVH 462
           L  AS  G + +V  LL       N  ++     TPLH AA      V +YLL + A V 
Sbjct: 4   LHVASFMGHLPIVKNLLQRGAS-PNVSNVKVE--TPLHMAARAGHTEVAKYLLQNKAKV- 59

Query: 463 SKDNATDKWGFTPLHEAAQKGRTQLSALLPLSPSAANDPLRELFEACKGGDLTKVKKLVN 522
              NA  K   TPLH AA+ G T +  LL  + +  N                   + V 
Sbjct: 60  ---NAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVL 116

Query: 523 PQTVNARDTAGRKSTPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLH 582
                    A           G  PLH A  YG   V E+L++  A+ N A     TPLH
Sbjct: 117 ALLEKEASQACMTKK------GFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLH 170

Query: 583 EAA-------AKALLQHGADINLKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMG 635
            A         K LL  G   +    +G T L +A    +           LL+      
Sbjct: 171 VAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQV-----EVARSLLQYGGSAN 225

Query: 636 GGLHRYTWPLGTTDIGWCSCCCKMELMFMPR--IKDEFKGHCLLEACRQGDPSRVKKFLT 693
               +   PL        +    + L       + ++     L    ++G        + 
Sbjct: 226 AESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIK 285

Query: 694 SDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRKGAHLNEKNKELLAPIHLAADLGH 753
             V+       G TPLH    + +     +V+ L++  A +N K K   +P+H AA  GH
Sbjct: 286 HGVMVDATTRMGYTPLHV---ASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGH 342

Query: 754 LDVLDTLLRLGAKVNLVDVLGQTALHRTARDDKTQAVRVLLSHNADTSIVSL 805
            D++  LL+ GA  N V   G T L    R        VL     +TS V +
Sbjct: 343 TDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLV 394


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2f3na1 a.60.1.2 (A:2-65) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Rat(Rattus norvegicus) [TaxId: 10116]} Length = 64 Back     information, alignment and structure
>d1ucva_ a.60.1.2 (A:) Ephrin type-A receptor 8, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x40a1 a.60.1.2 (A:8-85) Centaurin-delta 1 (Arap2) {Human(Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 63 Back     information, alignment and structure
>d1gs0a2 d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 217 Back     information, alignment and structure
>d1gs0a2 d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 217 Back     information, alignment and structure
>d1gs0a2 d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 217 Back     information, alignment and structure
>d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1efya2 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 215 Back     information, alignment and structure
>d1efya2 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 215 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1kw4a_ a.60.1.2 (A:) Polyhomeotic {Drosophila melanogaster [TaxId: 7227]} Length = 70 Back     information, alignment and structure
>d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1b4fa_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1oxja1 a.60.1.2 (A:594-655) RNA-binding protein Smaug {Drosophila melanogaster [TaxId: 7227]} Length = 62 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1236
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.98
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.89
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.89
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.89
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.88
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.88
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.83
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.83
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.81
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.75
d1dxsa_57 C-terminal domain of p73 {Human (Homo sapiens) [Ta 84.68
d1ow5a_60 Serine/threonine-protein kinase ste11 {Baker's yea 83.45
d1v38a_78 Sam-domain protein samsn-1 {Mouse (Mus musculus) [ 82.65
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.5e-46  Score=438.02  Aligned_cols=383  Identities=31%  Similarity=0.378  Sum_probs=278.0

Q ss_pred             cchhhHHhhcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHhCCCceEEeeeccccCccccccccccCCCCCCCCCcch
Q psy8898          25 LHPLHNACSFGHADVVRLLLEADANPNTRDNWNFTPLHEAAAKGKTDVCIGIYFAEHSSKSNQYVYGIGGGTGCPMHKDR  104 (1236)
Q Consensus        25 ~t~L~~A~~~g~~~iv~~Ll~~ga~~n~~d~~g~t~L~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~v  104 (1236)
                      .||||+||..|+.++|++|+++|+++|..|..|+||||+|+..|+.++|++                             
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~-----------------------------   51 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKY-----------------------------   51 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHH-----------------------------
T ss_pred             CChHHHHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHH-----------------------------
Confidence            499999999999999999999999999999999999999999999999988                             


Q ss_pred             hHHHhcCCCCCCcccCCCCcchhhcccChHHHHHHHHhcCCCCCCCCCCCCCCCCCcccccccCCCCCCCCCCccCCCCC
Q psy8898         105 SCYLAHGADPFLKNQEGQTPLDLTVAEDVRSLLQDAMAQYPGAPSCAETASVPPPSQYSNTSCGDNVSLPPPAQYSGSGG  184 (1236)
Q Consensus       105 ~~Ll~~ga~~~~~~~~g~t~L~~A~~~~~~~~v~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  184 (1236)
                        |+++|++++.++.+|+|||++|+..|+.++++.++..........                                 
T Consensus        52 --Ll~~gadi~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~---------------------------------   96 (408)
T d1n11a_          52 --LLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLAT---------------------------------   96 (408)
T ss_dssp             --HHHHTCCSSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCC---------------------------------
T ss_pred             --HHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHhhhcccccc---------------------------------
Confidence              999999999999999999999999999999988887642111100                                 


Q ss_pred             CcccCCCCCCChhhhHHHhcCcCCccccCCchHHHHHHhcCcHHHHHHHHhcCCCCCCCCCCCCcHHHHHHHcCcHHHHH
Q psy8898         185 DSVSLPPTSPPQPLALETVIMPSGQAVALGLVPLHNACSYGHFEVTEMLIKAGANVNAMDLWQFTPLHEAASKSRLEVCS  264 (1236)
Q Consensus       185 ~~~~~~~~~~~l~~~~~~~Ll~~g~~~~~g~T~L~~Aa~~g~~~iv~~Ll~~ga~~n~~d~~g~TpL~~A~~~g~~~iv~  264 (1236)
                                                 ....+++..+...+...........+...+..+..+.++|+.|+..++.++++
T Consensus        97 ---------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~  149 (408)
T d1n11a_          97 ---------------------------TAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAE  149 (408)
T ss_dssp             ---------------------------TTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHH
T ss_pred             ---------------------------ccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHH
Confidence                                       12445788888888888888888888888888888888888888888888888


Q ss_pred             HHHhCCCCCCCCCCCCCCccccccchhHHHHhhhccCcchHHHHHHcCChHHHHHhhhcccccCCCCCCCCCCCchhHHH
Q psy8898         265 LLLSEGADPTLHNCHSKSAIDVAPTRELQQRLSNEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLPGTLLI  344 (1236)
Q Consensus       265 ~Ll~~ga~~~~~~~~g~t~l~~a~~~~~~~~~~~~~~~~~l~~A~~~g~~~~v~~ll~~~~~~~~~~~~~~t~l~~~~~~  344 (1236)
                      +|+++|++++..+.+|.+|                                                             
T Consensus       150 ~ll~~~~~~~~~~~~~~~~-------------------------------------------------------------  168 (408)
T d1n11a_         150 LLLERDAHPNAAGKNGLTP-------------------------------------------------------------  168 (408)
T ss_dssp             HHHHTTCCTTCCCSSCCCH-------------------------------------------------------------
T ss_pred             HHHHcCCCCCcCCCcCchH-------------------------------------------------------------
Confidence            8888888776555433332                                                             


Q ss_pred             HHhhcChhHHHHHHHHHHHhhhhccCCCCCCccHHHHhhhhhhhhhcCCCCcCchhhHHHHHHhCCCHHHHHHHHhhCCC
Q psy8898         345 DLLSDDKEFITVAEEMQATVREHRDNGQSGGYTALQVAGENSKKLLQEPPSVVDLESQLLEASKGGDMTVVTRLLSSCPH  424 (1236)
Q Consensus       345 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~t~l~~a~~~~~~~l~~~~~~~~~~~~L~~A~~~g~~~~v~~Ll~~~~~  424 (1236)
                                                                                |+.|+..|+.+++++|++. +.
T Consensus       169 ----------------------------------------------------------L~~A~~~~~~~~~~~Ll~~-g~  189 (408)
T d1n11a_         169 ----------------------------------------------------------LHVAVHHNNLDIVKLLLPR-GG  189 (408)
T ss_dssp             ----------------------------------------------------------HHHHHHTTCHHHHHHHGGG-TC
T ss_pred             ----------------------------------------------------------HHHHHHcCCHHHHHHHHhc-CC
Confidence                                                                      2333334444444444444 33


Q ss_pred             cccccCCCCCCchHHHHHHhcCCHHHHHHHHhcCCCCCCCCCCCccCCCChHHHHHhcCchHHHhhcCCCCCCCCCchhH
Q psy8898         425 IVNCRDLDGRHSTPLHFAAGYNRVAVVEYLLAHGADVHSKDNATDKWGFTPLHEAAQKGRTQLSALLPLSPSAANDPLRE  504 (1236)
Q Consensus       425 ~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~~d~~g~t~L~~A~~~~~~~iv~~L~~~~~~~~~~~~~  504 (1236)
                      +++..+..+  .||+|+++...+.++..+|+..+.....    .+..                                 
T Consensus       190 ~~~~~~~~~--~t~l~~~~~~~~~~~~~~l~~~~~~~~~----~~~~---------------------------------  230 (408)
T d1n11a_         190 SPHSPAWNG--YTPLHIAAKQNQVEVARSLLQYGGSANA----ESVQ---------------------------------  230 (408)
T ss_dssp             CSCCCCTTC--CCHHHHHHHTTCHHHHHHHHHTTCCTTC----CCTT---------------------------------
T ss_pred             cccccCCCC--CCcchhhhccchhhhhhhhhhccccccc----cCCC---------------------------------
Confidence            334333333  2555555555555555555554443321    1123                                 


Q ss_pred             HHHHHhcCChHHHHHHhCCCCcccccccCCCCchhhhhccchhHHHHHhcCcHHHHHHHHhCCCCCccCCCCCCCHHHHH
Q psy8898         505 LFEACKGGDLTKVKKLVNPQTVNARDTAGRKSTPLHFAAGLVPLHNACSYGHYEVTEMLVKHGANVNVADLWKFTPLHEA  584 (1236)
Q Consensus       505 L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~~~~t~l~~~~g~t~L~~A~~~g~~~iv~~Ll~~g~~v~~~d~~g~tpL~~a  584 (1236)
                                                             +.|||++|+..++.++++++++.+..++..+..|.|     
T Consensus       231 ---------------------------------------~~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~g~~-----  266 (408)
T d1n11a_         231 ---------------------------------------GVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLT-----  266 (408)
T ss_dssp             ---------------------------------------CCCHHHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCC-----
T ss_pred             ---------------------------------------CCCHHHHHHHhCcHhHhhhhhccccccccccCCCCC-----
Confidence                                                   344555555555555555555554444333322222     


Q ss_pred             HHHHHHhcCCCCcccCCCCCChhhhhcccCcccccCCchhHHHHHHHHHhCCCcccccCCCCCCCCCccccccccccccc
Q psy8898         585 AAKALLQHGADINLKNTDGKTALDLAVPCTRAVLSGDHKKEELLEAARMMGGGLHRYTWPLGTTDIGWCSCCCKMELMFM  664 (1236)
Q Consensus       585 ~~~~Ll~~g~d~~~~~~~g~t~L~~a~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  664 (1236)
                                                                                                      
T Consensus       267 --------------------------------------------------------------------------------  266 (408)
T d1n11a_         267 --------------------------------------------------------------------------------  266 (408)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccchhhccccHHHHHHHcCCHHHHHHhhccCCcccCCCCCCChHHHHHhhCCCCChHHHHHHHHHcCCCCCCCCCCCchH
Q psy8898         665 PRIKDEFKGHCLLEACRQGDPSRVKKFLTSDVVNFKHPYTGDTPLHCAVTSPYPKRKAIVESLIRKGAHLNEKNKELLAP  744 (1236)
Q Consensus       665 ~~~~~~~~~~~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~iv~~Ll~~gadin~~d~~G~T~  744 (1236)
                                ||+.|+..++.+++++|++++......+..+.||||.++..   ++.+++++++++|+++|.+|.+|+||
T Consensus       267 ----------~l~~a~~~~~~~i~~~Ll~~g~~~~~~~~~~~t~L~~~~~~---~~~~~~~~ll~~g~~in~~d~~G~T~  333 (408)
T d1n11a_         267 ----------PLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHY---GNIKLVKFLLQHQADVNAKTKLGYSP  333 (408)
T ss_dssp             ----------HHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHS---SCSHHHHHHHHTTCCTTCCCTTSCCH
T ss_pred             ----------hhhhhhhcCcHHHHHHHHHCCCccccccccccccchhhccc---CcceeeeeeccccccccccCCCCCCH
Confidence                      22223344455555555555444444444467777777776   67899999999999999999999999


Q ss_pred             HHHHHHhCCHHHHHHHHHCCCCccccCCCCCcHHHHHHHcCCHHHHHHHH
Q psy8898         745 IHLAADLGHLDVLDTLLRLGAKVNLVDVLGQTALHRTARDDKTQAVRVLL  794 (1236)
Q Consensus       745 Lh~A~~~g~~~iv~~Ll~~ga~~n~~d~~G~tpL~~A~~~~~~~iv~~Ll  794 (1236)
                      ||+|++.|+.++|++|+++||++|.+|++|+||||+|+++|+.++|++|.
T Consensus       334 Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G~t~L~~A~~~~~~~iv~~L~  383 (408)
T d1n11a_         334 LHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLK  383 (408)
T ss_dssp             HHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHHH
T ss_pred             HHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999998664



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dxsa_ a.60.1.2 (A:) C-terminal domain of p73 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v38a_ a.60.1.2 (A:) Sam-domain protein samsn-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure