Psyllid ID: psy8916

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520
MSTGQKETLQQPNLGLTQVGWIFTDLVAEDLQLGTVRHTRNIDSHFLSAHECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTVNECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTGDKDNQVHMEGYQVSNQCMALVRDGCLIPTKDAPELGYIKESSDKQYVPDVFYKILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTIASVGLSNGDFVYMMNLSSPNDEKPSTSSNHLNIYETKKKASTTPSTPTEFKSKLSNAFSSSNNIVEDEVDKELWKTDGQVKRKRDDKFCRHGANALCIHCSPLEPYDEEYLREQNVKHMSFHAYLRKQCAGVDRGKFVVLEDLSCRIKEGCREHPPWPRGICSKCQPNAITLNRQVYRHVDNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYEPPQESSRDKIKLLPDPKAEVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYFQSR
cccHHHHHHcccccccEEEEEEEEccccccccccEEEEEcccccEEEcHHHHHHHHcccccccccccccccccccccEEEEEEccHHHHHHHHHHHHccccccccccccccccEEEEEEEccccccEEEEEEEHHHHHHHHHHcccccccccccccEEEccccccccccHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHcccccccEEEEEcccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHcccccccHHHHHHHHHcccccccccccccccEEEccccccccccccccccccccccEEccccccccccEEEEccHHHHHHHHHHHHHHccEEEEEEEEEEEEccccccccEEEEEEEEccccccccccEEEcccccHHHHHHHHHHcccEEEEEEEEccccccccccEEEEEc
ccccHHHHHHHHcccccEEEEEEEEcccccccccEEEEEcccccHHHcHHHHHHHHHHHHccccEEEccccccccccccEEEEcHHHHHHHHHHHHHccccccEccccccccEEEEEEEEccccccEEEEEEEEcHHHHHHHHHcccccccccccEEEEEccccccccccEEEEEEEEEcccccEEEEEccccccHHHHHHHHHHHccccccccEEEEcccccccccccccccHHHcccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccHHHHccccccccccccccccccHHHHHcccccEEcHHHHHHHHHcccccccccccccccEEEccccccccccccccccccccccEEEccccccEccEEEEccHHHHHHHHHHHHHHcccEEEEEEEEEcccccccccEEEEEEEEEccccccccccEEEcccccHHHHHHHHHHccccEEEEEEEccccccccccEEEEEc
mstgqketlqqpnlgltqVGWIFTDLVAEDLQLGTVRHTRNIDSHFLSAHECIMAghlqnlhpnpcrfapsgyfgskFVTICVTVNEcimaghlqnlhpnpcrfapsgyfgskFVTICVtgdkdnqvhmegyqvsNQCMALVrdgcliptkdapelgyikessdkqyvpdvFYKILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALfkqrnktdeifsSRDQTIASVGLSNGDFVYMmnlsspndekpstssnhlniyetkkkasttpstptefKSKLSnafsssnnivedevdkelwktdgqvkrkrddkfCRHGanalcihcsplepydeeylREQNVKHMSFHAYLRKqcagvdrgkfvVLEDLScrikegcrehppwprgicskcqpnaitlnrqvyrhvdnvefeNRTLVERFLEYWRVTGhqrlgllygkyqlhpdvplGIKAVVAAIyeppqessrdkikllpdpkaEVVEEIASSLGLTQVGWIFTDLVAEdlqlgtyfqsr
mstgqketlqqpnlglTQVGWIFTDLVAEDLQLGTVRHTRNIDSHFLSAHECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTVNECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTGDKDNQVHMEGYQVSNQCMALVRDGCLIPTKDAPELGYIKESSDKQYVPDVFYKILRiqspvgivkrininrsdtCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTIASVGLSNGDFVYMMNLSSPNDEKPSTSSNHLNIYEtkkkasttpstptefksklsnafsssnnivedevdkelwktdgqvkrkrdDKFCRHGANALCIHCSPLEPYDEEYLREQNVKHMSFHAYLRKQCAGVDRGKFVVLEDLSCRIKEgcrehppwprgicskCQPNAITLNRQVYRHVDNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYeppqessrdkikLLPDPKAEVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYFQSR
MSTGQKETLQQPNLGLTQVGWIFTDLVAEDLQLGTVRHTRNIDSHFLSAHECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTVNECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTGDKDNQVHMEGYQVSNQCMALVRDGCLIPTKDAPELGYIKESSDKQYVPDVFYKILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTIASVGLSNGDFVYMMNLSSPNDEKPSTSSNHLNIYEtkkkasttpstptEFKSKLSNAFSSSNNIVEDEVDKELWKTDGQVKRKRDDKFCRHGANALCIHCSPLEPYDEEYLREQNVKHMSFHAYLRKQCAGVDRGKFVVLEDLSCRIKEGCREHPPWPRGICSKCQPNAITLNRQVYRHVDNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYEPPQESSRDKIKLLPDPKAEVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYFQSR
*************LGLTQVGWIFTDLVAEDLQLGTVRHTRNIDSHFLSAHECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTVNECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTGDKDNQVHMEGYQVSNQCMALVRDGCLIPTKDAPELGYIKESSDKQYVPDVFYKILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTIASVGLSNGDFVYMM***********************************************************W**********DDKFCRHGANALCIHCSPLEPYDEEYLREQNVKHMSFHAYLRKQCAGVDRGKFVVLEDLSCRIKEGCREHPPWPRGICSKCQPNAITLNRQVYRHVDNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYE******************EVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYF***
**********QPNLGLTQVGWIFTDLVAEDLQLGTVRHTRNIDSHFLSAHECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTVNECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTGDKDNQVHMEGYQVSNQCMALVRDGCLIPTKDAPELGYIKESSDKQYVPDVFYKILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNF*******************IASVGLSNGDFVYMM************************************************************************************HCSPLEPYDEEYLREQNVKHMSFHAYLR**************EDLSCRIKEGCREHPPWPRGICSKCQPNAITLNRQVYRHVDNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYEPPQESSRDKIKLLPDPKAEVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYFQSR
*********QQPNLGLTQVGWIFTDLVAEDLQLGTVRHTRNIDSHFLSAHECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTVNECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTGDKDNQVHMEGYQVSNQCMALVRDGCLIPTKDAPELGYIKESSDKQYVPDVFYKILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTIASVGLSNGDFVYMMNLSS*********SNHLNIYETK**************SKLSNAFSSSNNIVEDEVDKELWKTDGQVKRKRDDKFCRHGANALCIHCSPLEPYDEEYLREQNVKHMSFHAYLRKQCAGVDRGKFVVLEDLSCRIKEGCREHPPWPRGICSKCQPNAITLNRQVYRHVDNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYEPPQESSRDKIKLLPDPKAEVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYFQSR
*****KETLQQPNLGLTQVGWIFTDLVAEDLQLGTVRHTRNIDSHFLSAHECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTVNECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTGDKDNQVHMEGYQVSNQCMALVRDGCLIPTKDAPELGYIKESSDKQYVPDVFYKILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTIASVGLSNGDFVYMMNLS*************************************************DEVDKELWKTDGQVKRKRDDKFCRHGANALCIHCSPLEPYDEEYLREQNVKHMSFHAYLRKQCAGVDRGKFVVLEDLSCRIKEGCREHPPWPRGICSKCQPNAITLNRQVYRHVDNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYEPPQESSRDKIKLLPDPKAEVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYFQSR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTGQKETLQQPNLGLTQVGWIFTDLVAEDLQLGTVRHTRNIDSHFLSAHECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTVNECIMAGHLQNLHPNPCRFAPSGYFGSKFVTICVTGDKDNQVHMEGYQVSNQCMALVRDGCLIPTKDAPELGYIKESSDKQYVPDVFYKILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTIASVGLSNGDFVYMMNLSSPNDEKPSTSSNHLNIYETKKKASTTPSTPTEFKSKLSNAFSSSNNIVEDEVDKELWKTDGQVKRKRDDKFCRHGANALCIHCSPLEPYDEEYLREQNVKHMSFHAYLRKQCAGVDRGKFVVLEDLSCRIKEGCREHPPWPRGICSKCQPNAITLNRQVYRHVDNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYEPPQESSRDKIKLLPDPKAEVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYFQSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query520 2.2.26 [Sep-21-2011]
Q9VBP9 652 Nuclear protein localizat yes N/A 0.632 0.504 0.514 1e-104
P60670 608 Nuclear protein localizat no N/A 0.615 0.526 0.497 2e-96
Q9ES54 608 Nuclear protein localizat yes N/A 0.615 0.526 0.497 4e-96
Q8TAT6 608 Nuclear protein localizat yes N/A 0.615 0.526 0.494 5e-96
Q9P780 572 Nuclear protein localizat yes N/A 0.617 0.561 0.384 8e-60
Q6FJI2 580 Nuclear protein localizat yes N/A 0.607 0.544 0.368 1e-55
Q4WKD7 652 Nuclear protein localizat yes N/A 0.517 0.412 0.405 4e-55
A1D4X8 652 Nuclear protein localizat N/A N/A 0.523 0.417 0.402 8e-55
Q2URI8 652 Nuclear protein localizat yes N/A 0.523 0.417 0.391 1e-54
Q1DY54 657 Nuclear protein localizat N/A N/A 0.542 0.429 0.397 3e-54
>sp|Q9VBP9|NPL4_DROME Nuclear protein localization protein 4 homolog OS=Drosophila melanogaster GN=CG4673 PE=1 SV=3 Back     alignment and function desciption
 Score =  378 bits (970), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/346 (51%), Positives = 243/346 (70%), Gaps = 17/346 (4%)

Query: 175 ILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTI 234
           ++R+QS  GI KRI I+     K L++ +    +++   F LFK+RN   E+ +S  Q +
Sbjct: 35  LIRVQSAEGI-KRIEISPKSNLKHLYDSVQNALKVD--GFGLFKERNFLTELQASGSQLV 91

Query: 235 ASVGLSNGDFVYMMNLSSPNDEKPSTSSNHLNIYETKKKASTTPSTPTEFKSKLSNAFSS 294
            +  L +GD VY+  ++  +  + ST+     + +++   ++T S P        N+   
Sbjct: 92  GT-SLRHGDMVYLKQMAGTSSRRTSTT-----VLDSQAFKTSTISNP--------NSARP 137

Query: 295 SNNIVEDEVDKELWKTDGQVKRKRDDKFCRHGANALCIHCSPLEPYDEEYLREQNVKHMS 354
           S N++ED+VD+ L K DG +KR+RD K C H AN  C+HCS LEPYDE YL+E N+KH+S
Sbjct: 138 SFNVIEDDVDQALSKADGTIKRERDSKLCHHNANGRCVHCSALEPYDESYLKEHNIKHLS 197

Query: 355 FHAYLRKQCAGVDRGKFVVLEDLSCRIKEGCREHPPWPRGICSKCQPNAITLNRQVYRHV 414
           FH+Y+RKQ +G+D+GK+ V +D++CRIK GCREHPPWP+GICSKCQP+AITLNRQ YRHV
Sbjct: 198 FHSYIRKQTSGMDQGKYFVFDDINCRIKPGCREHPPWPKGICSKCQPSAITLNRQTYRHV 257

Query: 415 DNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYEPPQESSRD 474
           DNV FEN  +VERFL YWR TGHQR+G LYG Y+ H DVPLGI+A VAAIYEPPQES+RD
Sbjct: 258 DNVMFENTKIVERFLNYWRTTGHQRMGYLYGTYEQHTDVPLGIRAKVAAIYEPPQESTRD 317

Query: 475 KIKLLPDPKAEVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYFQSR 520
            I + PD  A+ V+ +AS+LGL ++GWIFTDL+ +D  +GT  Q R
Sbjct: 318 SINIQPDEFADDVDAVASALGLKKIGWIFTDLITDDASIGTVKQIR 363
May be part of a complex that binds ubiquitinated proteins and that is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome.
Drosophila melanogaster (taxid: 7227)
>sp|P60670|NPL4_MOUSE Nuclear protein localization protein 4 homolog OS=Mus musculus GN=Nploc4 PE=1 SV=3 Back     alignment and function description
>sp|Q9ES54|NPL4_RAT Nuclear protein localization protein 4 homolog OS=Rattus norvegicus GN=Nploc4 PE=1 SV=3 Back     alignment and function description
>sp|Q8TAT6|NPL4_HUMAN Nuclear protein localization protein 4 homolog OS=Homo sapiens GN=NPLOC4 PE=1 SV=3 Back     alignment and function description
>sp|Q9P780|NPL4_SCHPO Nuclear protein localization protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npl4 PE=3 SV=2 Back     alignment and function description
>sp|Q6FJI2|NPL4_CANGA Nuclear protein localization protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NPL4 PE=3 SV=1 Back     alignment and function description
>sp|Q4WKD7|NPL4_ASPFU Nuclear protein localization protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=npl4 PE=3 SV=1 Back     alignment and function description
>sp|A1D4X8|NPL4_NEOFI Nuclear protein localization protein 4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=npl4 PE=3 SV=1 Back     alignment and function description
>sp|Q2URI8|NPL4_ASPOR Nuclear protein localization protein 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=npl4 PE=3 SV=1 Back     alignment and function description
>sp|Q1DY54|NPL4_COCIM Nuclear protein localization protein 4 OS=Coccidioides immitis (strain RS) GN=NPL4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query520
345485482 652 PREDICTED: nuclear protein localization 0.653 0.521 0.593 1e-120
350406695 647 PREDICTED: nuclear protein localization 0.640 0.514 0.586 1e-117
340721568 647 PREDICTED: nuclear protein localization 0.640 0.514 0.583 1e-116
383861559 687 PREDICTED: nuclear protein localization 0.638 0.483 0.568 1e-115
193613344 630 PREDICTED: nuclear protein localization 0.653 0.539 0.564 1e-115
332020704515 Nuclear protein localization protein 4-l 0.678 0.685 0.547 1e-114
48133028 646 PREDICTED: nuclear protein localization 0.630 0.507 0.568 1e-113
380028897 646 PREDICTED: nuclear protein localization 0.630 0.507 0.565 1e-113
307175902513 Nuclear protein localization protein 4-l 0.655 0.664 0.552 1e-113
91088135 638 PREDICTED: similar to nuclear protein lo 0.646 0.526 0.578 1e-112
>gi|345485482|ref|XP_001606190.2| PREDICTED: nuclear protein localization protein 4 homolog [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  440 bits (1131), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 203/342 (59%), Positives = 260/342 (76%), Gaps = 2/342 (0%)

Query: 175 ILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTI 234
           +LR+QS  G  KR+ +  SDT   LFEKI   FEL ++ F L+KQRN+ +EI S+R +T+
Sbjct: 8   LLRVQSAEG-TKRVEVQPSDTVSQLFEKIYDVFELQSFGFGLYKQRNQKEEIVSTRSKTV 66

Query: 235 ASVGLSNGDFVYMMNLSSPND-EKPSTSSNHLNIYETKKKASTTPSTPTEFKSKLSNAFS 293
             VGL +GD +Y+  ++     + PSTSS   ++       + + S  ++ +   +N   
Sbjct: 67  QGVGLKHGDMLYLAPINGAVLWDTPSTSSASNDVSSEPMDVTPSTSKGSQGQQTTNNFLR 126

Query: 294 SSNNIVEDEVDKELWKTDGQVKRKRDDKFCRHGANALCIHCSPLEPYDEEYLREQNVKHM 353
             +N+VEDEVD++LWK DG+++RKR DKFCRHGAN  C+HCSPLEP+DE YL+EQN+KHM
Sbjct: 127 PLSNVVEDEVDQQLWKLDGKIQRKRVDKFCRHGANGCCVHCSPLEPFDEAYLKEQNIKHM 186

Query: 354 SFHAYLRKQCAGVDRGKFVVLEDLSCRIKEGCREHPPWPRGICSKCQPNAITLNRQVYRH 413
           SFH+YLRK  AGVDRGKF+ LED+SCRIK GC++HPPWP+G CSKCQPNAITLNRQ YRH
Sbjct: 187 SFHSYLRKLTAGVDRGKFLQLEDISCRIKTGCKDHPPWPKGFCSKCQPNAITLNRQPYRH 246

Query: 414 VDNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYEPPQESSR 473
           VDNV FEN  LVERFL YWR+TGHQR+G LYG+Y+ H DVPLGI+ VVAAIYEPPQES+R
Sbjct: 247 VDNVMFENAHLVERFLNYWRITGHQRIGYLYGRYEQHSDVPLGIRTVVAAIYEPPQESTR 306

Query: 474 DKIKLLPDPKAEVVEEIASSLGLTQVGWIFTDLVAEDLQLGT 515
           D I LLPD K  +V+E+A SL L +VGWIFTDL+A+D++ GT
Sbjct: 307 DSIVLLPDEKEALVDELAQSLNLKKVGWIFTDLIADDMKKGT 348

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350406695|ref|XP_003487852.1| PREDICTED: nuclear protein localization protein 4 homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721568|ref|XP_003399190.1| PREDICTED: nuclear protein localization protein 4 homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|383861559|ref|XP_003706253.1| PREDICTED: nuclear protein localization protein 4 homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|193613344|ref|XP_001951828.1| PREDICTED: nuclear protein localization protein 4 homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332020704|gb|EGI61109.1| Nuclear protein localization protein 4-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|48133028|ref|XP_393332.1| PREDICTED: nuclear protein localization protein 4 homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|380028897|ref|XP_003698120.1| PREDICTED: nuclear protein localization protein 4 homolog [Apis florea] Back     alignment and taxonomy information
>gi|307175902|gb|EFN65715.1| Nuclear protein localization protein 4-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|91088135|ref|XP_970927.1| PREDICTED: similar to nuclear protein localization [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query520
FB|FBgn0039348 652 Npl4 "Npl4 ortholog" [Drosophi 0.609 0.486 0.516 2.1e-93
UNIPROTKB|Q7SZT9 610 nploc4 "Npl4 protein" [Xenopus 0.436 0.372 0.611 2.7e-92
MGI|MGI:2679787 608 Nploc4 "nuclear protein locali 0.440 0.376 0.616 1.1e-91
UNIPROTKB|F1PNX1 608 NPLOC4 "Uncharacterized protei 0.430 0.368 0.623 1.1e-91
RGD|620794 608 Nploc4 "nuclear protein locali 0.440 0.376 0.616 1.9e-91
UNIPROTKB|Q9ES54 608 Nploc4 "Nuclear protein locali 0.440 0.376 0.616 1.9e-91
UNIPROTKB|F1N7U2 608 NPLOC4 "Uncharacterized protei 0.430 0.368 0.619 1.9e-91
UNIPROTKB|Q8TAT6 608 NPLOC4 "Nuclear protein locali 0.430 0.368 0.623 4.9e-91
ZFIN|ZDB-GENE-030131-5658 624 nploc4 "nuclear protein locali 0.648 0.540 0.484 3.1e-90
UNIPROTKB|J9NXM8 520 NPLOC4 "Uncharacterized protei 0.430 0.430 0.623 8.7e-79
FB|FBgn0039348 Npl4 "Npl4 ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 930 (332.4 bits), Expect = 2.1e-93, P = 2.1e-93
 Identities = 175/339 (51%), Positives = 235/339 (69%)

Query:   185 VKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTIASVGLSNGDF 244
             +KRI I+     K L++ +    +++   F LFK+RN   E+ +S  Q + +  L +GD 
Sbjct:    44 IKRIEISPKSNLKHLYDSVQNALKVD--GFGLFKERNFLTELQASGSQLVGT-SLRHGDM 100

Query:   245 VYMMNLSSPNDEKPSTSSNHLNIYEXXXXXXXXXXXXXEFK-SKLSNAFSS--SNNIVED 301
             VY+  ++  +  + ST+     + +              FK S +SN  S+  S N++ED
Sbjct:   101 VYLKQMAGTSSRRTSTT-----VLDSQA-----------FKTSTISNPNSARPSFNVIED 144

Query:   302 EVDKELWKTDGQVKRKRDDKFCRHGANALCIHCSPLEPYDEEYLREQNVKHMSFHAYLRK 361
             +VD+ L K DG +KR+RD K C H AN  C+HCS LEPYDE YL+E N+KH+SFH+Y+RK
Sbjct:   145 DVDQALSKADGTIKRERDSKLCHHNANGRCVHCSALEPYDESYLKEHNIKHLSFHSYIRK 204

Query:   362 QCAGVDRGKFVVLEDLSCRIKEGCREHPPWPRGICSKCQPNAITLNRQVYRHVDNVEFEN 421
             Q +G+D+GK+ V +D++CRIK GCREHPPWP+GICSKCQP+AITLNRQ YRHVDNV FEN
Sbjct:   205 QTSGMDQGKYFVFDDINCRIKPGCREHPPWPKGICSKCQPSAITLNRQTYRHVDNVMFEN 264

Query:   422 RTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYEPPQESSRDKIKLLPD 481
               +VERFL YWR TGHQR+G LYG Y+ H DVPLGI+A VAAIYEPPQES+RD I + PD
Sbjct:   265 TKIVERFLNYWRTTGHQRMGYLYGTYEQHTDVPLGIRAKVAAIYEPPQESTRDSINIQPD 324

Query:   482 PKAEVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYFQSR 520
               A+ V+ +AS+LGL ++GWIFTDL+ +D  +GT  Q R
Sbjct:   325 EFADDVDAVASALGLKKIGWIFTDLITDDASIGTVKQIR 363
GO:0005643 "nuclear pore" evidence=ISS
GO:0017056 "structural constituent of nuclear pore" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0022008 "neurogenesis" evidence=IMP
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IMP
UNIPROTKB|Q7SZT9 nploc4 "Npl4 protein" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:2679787 Nploc4 "nuclear protein localization 4 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNX1 NPLOC4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|620794 Nploc4 "nuclear protein localization 4 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ES54 Nploc4 "Nuclear protein localization protein 4 homolog" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N7U2 NPLOC4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TAT6 NPLOC4 "Nuclear protein localization protein 4 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5658 nploc4 "nuclear protein localization 4 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXM8 NPLOC4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VBP9NPL4_DROMENo assigned EC number0.51440.63260.5046yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
COG5100 571 COG5100, NPL4, Nuclear pore protein [Nuclear struc 4e-80
pfam05020147 pfam05020, zf-NPL4, NPL4 family, putative zinc bin 8e-73
pfam05021306 pfam05021, NPL4, NPL4 family 3e-55
cd08061 274 cd08061, MPN_NPL4, Mov34/MPN/PAD-1 family: nuclear 6e-50
cd08061274 cd08061, MPN_NPL4, Mov34/MPN/PAD-1 family: nuclear 2e-44
pfam05021 306 pfam05021, NPL4, NPL4 family 9e-33
COG5100571 COG5100, NPL4, Nuclear pore protein [Nuclear struc 4e-26
pfam1154380 pfam11543, UN_NPL4, Nuclear pore localisation prot 3e-17
cd07767116 cd07767, MPN, Mpr1p, Pad1p N-terminal (MPN) domain 2e-04
>gnl|CDD|227431 COG5100, NPL4, Nuclear pore protein [Nuclear structure] Back     alignment and domain information 
 Score =  260 bits (666), Expect = 4e-80
 Identities = 129/355 (36%), Positives = 194/355 (54%), Gaps = 26/355 (7%)

Query: 175 ILRIQSPVGIVKRININRSDTCKDLFEKINKEFELN--TYNFALFKQRNKTDEIFSS-RD 231
           I R +S  G  +R+ +  SD    L  K+   FE+N      ++    +   EIFS  +D
Sbjct: 2   IFRFRSKEG-QRRVEVQESDVLGMLSPKLLAFFEVNYSPEQISVCSAPDGQGEIFSLLKD 60

Query: 232 QTIASVGLSNGDFVYMMNLSSPNDEKPSTSSNHLNIYETKKKASTTPSTPTEFKSKLSNA 291
           QT   +GL +G  +Y+                + +I    +K    P  P +  SK    
Sbjct: 61  QTPDDLGLRHGQMLYL---------------EYSDIASNNEKKRDVPGKPKQDCSKGIKR 105

Query: 292 FSSSNNIVEDEVDKELWKTDGQVKRKRDDKFCRHGANALCIHCSPLEPYDEEYLREQNVK 351
              S  +++D +D  L K DG ++R      C+HG+N +C +CSPL+P+DE+Y ++  +K
Sbjct: 106 EKDSMPVIQDPIDDSLEKEDGLIRRSMT-MLCQHGSNGMCSYCSPLDPWDEKYYKDNKIK 164

Query: 352 HMSFHAYLRKQCAGVDR----GKFVV-LEDLSCRIKEGCRE-HPPWPRGICSKCQPNAIT 405
           H+SFH+YL K  +  ++      ++V LE+ S  +KE C + H PWP GIC+KCQP+ I 
Sbjct: 165 HLSFHSYLEKMNSNKNKLGSVESYIVPLEEPSFTVKETCEDGHGPWPHGICNKCQPSNII 224

Query: 406 LNRQVYRHVDNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIY 465
           L  QV+R VD+VEF+ + +VE F+  WR +G QR G LYG+Y  + ++PLGIKAVV AIY
Sbjct: 225 LAPQVFRMVDHVEFDGKHIVENFIRNWRESGRQRFGYLYGRYMDYENIPLGIKAVVEAIY 284

Query: 466 EPPQESSRDKIKLLPDPKAEVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYFQSR 520
           EPPQE   D   +       +++  AS  GL ++G IFTDL+ E    G+    R
Sbjct: 285 EPPQEDEPDGFTIEEWADEGLMDAPASGTGLERIGMIFTDLLDEGSNRGSVTCKR 339

Length = 571
>gnl|CDD|147282 pfam05020, zf-NPL4, NPL4 family, putative zinc binding region Back     alignment and domain information
>gnl|CDD|218386 pfam05021, NPL4, NPL4 family Back     alignment and domain information
>gnl|CDD|163692 cd08061, MPN_NPL4, Mov34/MPN/PAD-1 family: nuclear protein localization-4 (Npl4) domain Back     alignment and domain information
>gnl|CDD|163692 cd08061, MPN_NPL4, Mov34/MPN/PAD-1 family: nuclear protein localization-4 (Npl4) domain Back     alignment and domain information
>gnl|CDD|218386 pfam05021, NPL4, NPL4 family Back     alignment and domain information
>gnl|CDD|227431 COG5100, NPL4, Nuclear pore protein [Nuclear structure] Back     alignment and domain information
>gnl|CDD|221132 pfam11543, UN_NPL4, Nuclear pore localisation protein NPL4 Back     alignment and domain information
>gnl|CDD|163686 cd07767, MPN, Mpr1p, Pad1p N-terminal (MPN) domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 520
COG5100 571 NPL4 Nuclear pore protein [Nuclear structure] 100.0
KOG2834|consensus 510 100.0
PF05020147 zf-NPL4: NPL4 family, putative zinc binding region 100.0
PF05021306 NPL4: NPL4 family; InterPro: IPR007717 The HRD4 ge 100.0
KOG2834|consensus510 100.0
COG5100571 NPL4 Nuclear pore protein [Nuclear structure] 100.0
cd08061 274 MPN_NPL4 Mov34/MPN/PAD-1 family: nuclear protein l 100.0
cd08061274 MPN_NPL4 Mov34/MPN/PAD-1 family: nuclear protein l 100.0
PF05021 306 NPL4: NPL4 family; InterPro: IPR007717 The HRD4 ge 100.0
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 99.8
cd08056 252 MPN_PRP8 Mpr1p, Pad1p N-terminal (MPN) domains wit 99.14
cd08056252 MPN_PRP8 Mpr1p, Pad1p N-terminal (MPN) domains wit 99.13
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 97.62
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 97.6
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 97.48
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 97.36
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 97.33
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 97.27
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 97.27
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 97.25
cd07767116 MPN Mpr1p, Pad1p N-terminal (MPN) domains. MPN (al 97.2
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 97.1
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 97.1
cd08066173 MPN_AMSH_like Mov34/MPN/PAD-1 family. AMSH (associ 97.0
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 96.91
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 96.9
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 96.89
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 96.84
PTZ0004476 ubiquitin; Provisional 96.77
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 96.74
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 96.74
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 96.73
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 96.69
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 96.59
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 96.32
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 96.32
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 96.3
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 96.06
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 96.04
smart00232135 JAB_MPN JAB/MPN domain. Domain in Jun kinase activ 96.04
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 95.82
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 95.41
PF01398114 JAB: JAB1/Mov34/MPN/PAD-1 ubiquitin protease; Inte 95.15
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 94.96
smart0016680 UBX Domain present in ubiquitin-regulatory protein 93.97
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 93.94
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 93.21
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 92.88
PLN02560308 enoyl-CoA reductase 92.74
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 92.57
KOG0010|consensus 493 91.88
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 91.6
cd07767116 MPN Mpr1p, Pad1p N-terminal (MPN) domains. MPN (al 91.55
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 91.48
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 91.28
cd08067187 MPN_2A_DUB Mov34/MPN/PAD-1 family: Histone H2A deu 91.14
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 90.56
cd08066173 MPN_AMSH_like Mov34/MPN/PAD-1 family. AMSH (associ 90.54
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 90.31
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 89.54
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 89.36
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 88.78
cd08069 268 MPN_RPN11_CSN5 Mov34/MPN/PAD-1 family: proteasomal 88.03
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 87.49
cd08070128 MPN_like Mpr1p, Pad1p N-terminal (MPN) domains wit 82.62
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 81.75
smart00232135 JAB_MPN JAB/MPN domain. Domain in Jun kinase activ 81.32
>COG5100 NPL4 Nuclear pore protein [Nuclear structure] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-111  Score=864.32  Aligned_cols=329  Identities=37%  Similarity=0.693  Sum_probs=296.0

Q ss_pred             eeeeeeCCCcceeeEEecCCcchHHHHHHHHhhcCCC--CCcceeeecCCcccccc-ccccccccccCCCCcCeEEEeec
Q psy8916         174 KILRIQSPVGIVKRININRSDTCKDLFEKINKEFELN--TYNFALFKQRNKTDEIF-SSRDQTIASVGLSNGDFVYMMNL  250 (520)
Q Consensus       174 MiIRfRSkdG~m~RVev~ptDtfs~LleKLl~~f~ls--~dsftL~~nr~~~~~l~-s~~~~tv~~lgLkHGDmlyl~~~  250 (520)
                      ||+|||||+| |.|++++++|.++.|.+||+..|..+  .+.++++.++++.+++. .++++++.+|||+|||||||.|+
T Consensus         1 Mi~rfRsk~G-~~Rve~qe~d~lg~l~~kll~~~~~n~~~e~~svc~~p~~qG~~~s~l~dqt~~dlGL~hGqmLyl~ys   79 (571)
T COG5100           1 MIFRFRSKEG-QRRVEVQESDVLGMLSPKLLAFFEVNYSPEQISVCSAPDGQGEIFSLLKDQTPDDLGLRHGQMLYLEYS   79 (571)
T ss_pred             CeEEEecCCC-ceeeeccccchhhhhhHHHHhhhccCCCccceEEEeCCCCCceeeecccccChhhhccccCcEEEEEec
Confidence            8999999999 99999999999999999999998655  45889999998888754 57899999999999999999997


Q ss_pred             CCCCCCCCCCCCCcccccc-ccccCCCCCCCCccccccccccCCCCCcccchhhhhhhhhccCcccccCCCcccccCCCc
Q psy8916         251 SSPNDEKPSTSSNHLNIYE-TKKKASTTPSTPTEFKSKLSNAFSSSNNIVEDEVDKELWKTDGQVKRKRDDKFCRHGANA  329 (520)
Q Consensus       251 ~~~~~~~~~~s~~~~~~~~-~~~~~~~~~~~p~~~~~~~~~~~~~~~~v~e~~vD~~L~K~dG~I~R~rd~klCrHG~~G  329 (520)
                      +-+++..+.-.      ++ .++.    +..+.      -.-..+..+|+||+||+.|+|+||+|+|+. ++||+||+||
T Consensus        80 d~~snne~~~~------V~~~pkq----~~skg------i~~~k~sm~v~q~~iddslekedgli~rs~-t~lC~Hg~~g  142 (571)
T COG5100          80 DIASNNEKKRD------VPGKPKQ----DCSKG------IKREKDSMPVIQDPIDDSLEKEDGLIRRSM-TMLCQHGSNG  142 (571)
T ss_pred             ccccccccccc------CCCCCcc----cCCcc------hhhcCCCCccccccchhhhhhccccchhhh-hHHhhcCCCc
Confidence            65543221100      11 1111    11111      122345689999999999999999999988 6799999999


Q ss_pred             ccCccCCCCCCCHHHHhhcCcccchHHHHHHHHhcCCCC----CCc-cccccccccccCCCC-CCCCCCccccccccCCc
Q psy8916         330 LCIHCSPLEPYDEEYLREQNVKHMSFHAYLRKQCAGVDR----GKF-VVLEDLSCRIKEGCR-EHPPWPRGICSKCQPNA  403 (520)
Q Consensus       330 mC~~C~PLeP~D~~Yl~E~~IKHlSFhaYLrkl~~~~~k----~~~-~~l~~~~~ki~~~C~-~H~PwP~GiCskCqP~a  403 (520)
                      ||+||+||||||++|+++++||||||||||+|||+.+||    .+| +||++|+|+|+..|+ ||+|||+|||+||||++
T Consensus       143 MC~yCsPL~PwDe~Y~~~NkIKhlSFhsYl~k~nsn~nk~~s~~Syi~pleep~f~vke~C~~gH~pwP~giC~kCQps~  222 (571)
T COG5100         143 MCSYCSPLDPWDEKYYKDNKIKHLSFHSYLEKMNSNKNKLGSVESYIVPLEEPSFTVKETCEDGHGPWPHGICNKCQPSN  222 (571)
T ss_pred             ccccCCCCCccchhhhhhcceeEeeHHHHHHHHhhhhhhccccccccCCcCCCcchhhccCCCCCCCCcccccccCCcce
Confidence            999999999999999999999999999999999999887    356 589999999999999 79999999999999999


Q ss_pred             eeecCCCCCCcCeeeecCHHHHHHHHHHHHhcCceeeEEEEEEEeeCCCCCccceEEEEEEecCCCCCCCCceEEcCCCC
Q psy8916         404 ITLNRQVYRHVDNVEFENRTLVERFLEYWRVTGHQRLGLLYGKYQLHPDVPLGIKAVVAAIYEPPQESSRDKIKLLPDPK  483 (520)
Q Consensus       404 ItL~~Q~~R~VDhvef~~~~~v~~Fi~~wr~~g~QR~G~LYG~Y~~~~~vPlGikAvVeAIYEPPQ~~~~dg~~ll~d~~  483 (520)
                      |+|++|+|||||||||+.+.+|++||+.||.+|.||||||||+|..|+++||||||||||||||||++++|||+|.+|.+
T Consensus       223 i~L~~Q~FRmvDHvEF~~~~iv~~Fi~~WR~sG~QRfGy~yG~y~~y~n~PLGiKaVveaIyEPpQ~de~DG~t~ee~~d  302 (571)
T COG5100         223 IILAPQVFRMVDHVEFDGKHIVENFIRNWRESGRQRFGYLYGRYMDYENIPLGIKAVVEAIYEPPQEDEPDGFTIEEWAD  302 (571)
T ss_pred             eeecccceeeeeeeeecCchHHHHHHHHHHHhhhhhheeeeeehhhccCCcchhHHHhhhhcCCccccCCCceEeeeecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHhcCCeEEEEEEecCccCCCCCceEEecC
Q psy8916         484 AEVVEEIASSLGLTQVGWIFTDLVAEDLQLGTYFQSR  520 (520)
Q Consensus       484 e~~Vd~iA~~LGL~rVG~IFTdl~~~~~~~GtV~ckR  520 (520)
                      |..+|+.|..+||+|||+|||||+++|.++|+|.|||
T Consensus       303 e~l~d~~a~~~GL~riG~IfTDl~d~gs~~GsV~ckr  339 (571)
T COG5100         303 EGLMDAPASGTGLERIGMIFTDLLDEGSNRGSVTCKR  339 (571)
T ss_pred             cccccccccccCceeeeeeeeehhhccCCCCceeeec
Confidence            9999999999999999999999999999999999998

>KOG2834|consensus Back     alignment and domain information
>PF05020 zf-NPL4: NPL4 family, putative zinc binding region; InterPro: IPR007716 The HRD4 gene is identical to NPL4, a gene previously implicated in nuclear transport Back     alignment and domain information
>PF05021 NPL4: NPL4 family; InterPro: IPR007717 The HRD4 gene is identical to NPL4, a gene previously implicated in nuclear transport Back     alignment and domain information
>KOG2834|consensus Back     alignment and domain information
>COG5100 NPL4 Nuclear pore protein [Nuclear structure] Back     alignment and domain information
>cd08061 MPN_NPL4 Mov34/MPN/PAD-1 family: nuclear protein localization-4 (Npl4) domain Back     alignment and domain information
>cd08061 MPN_NPL4 Mov34/MPN/PAD-1 family: nuclear protein localization-4 (Npl4) domain Back     alignment and domain information
>PF05021 NPL4: NPL4 family; InterPro: IPR007717 The HRD4 gene is identical to NPL4, a gene previously implicated in nuclear transport Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd08056 MPN_PRP8 Mpr1p, Pad1p N-terminal (MPN) domains without isopeptidase activity found in splicing factor Prp8 Back     alignment and domain information
>cd08056 MPN_PRP8 Mpr1p, Pad1p N-terminal (MPN) domains without isopeptidase activity found in splicing factor Prp8 Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd07767 MPN Mpr1p, Pad1p N-terminal (MPN) domains Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd08066 MPN_AMSH_like Mov34/MPN/PAD-1 family Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>smart00232 JAB_MPN JAB/MPN domain Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>PF01398 JAB: JAB1/Mov34/MPN/PAD-1 ubiquitin protease; InterPro: IPR000555 Members of this family are found in proteasome regulatory subunits, eukaryotic initiation factor 3 (eIF3) subunits and regulators of transcription factors Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>KOG0010|consensus Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd07767 MPN Mpr1p, Pad1p N-terminal (MPN) domains Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>cd08067 MPN_2A_DUB Mov34/MPN/PAD-1 family: Histone H2A deubiquitinase Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>cd08066 MPN_AMSH_like Mov34/MPN/PAD-1 family Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>cd08069 MPN_RPN11_CSN5 Mov34/MPN/PAD-1 family: proteasomal regulatory protein Rpn11 and signalosome complex subunit CSN5 Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>cd08070 MPN_like Mpr1p, Pad1p N-terminal (MPN) domains with catalytic isopeptidase activity (metal-binding) Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>smart00232 JAB_MPN JAB/MPN domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
2pjh_A80 Strctural Model Of The P97 N Domain- Npl4 Ubd Compl 2e-07
>pdb|2PJH|A Chain A, Strctural Model Of The P97 N Domain- Npl4 Ubd Complex Length = 80 Back     alignment and structure 
Iteration: 1

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
Query: 175 ILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTI 234
           I+R+QSP G VKRI   + +T     +K+ KEF      F+++  RNKT EI +S  +++
Sbjct: 6   IIRVQSPDG-VKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSL 64
Query: 235 ASVGLSNGDFVYM 247
             + + +GD +++
Sbjct: 65  HLLKIKHGDLLFL 77

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query520
2pjh_A80 Protein NPL4, nuclear protein localization protein 7e-20
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Length = 80 Back     alignment and structure
 Score = 83.0 bits (205), Expect = 7e-20
 Identities = 24/73 (32%), Positives = 44/73 (60%), Gaps = 1/73 (1%)

Query: 175 ILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTI 234
           I+R+QSP G+ KRI   + +T     +K+ KEF      F+++  RNKT EI +S  +++
Sbjct: 6   IIRVQSPDGV-KRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSL 64

Query: 235 ASVGLSNGDFVYM 247
             + + +GD +++
Sbjct: 65  HLLKIKHGDLLFL 77
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 107 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query520
2pjh_A80 Protein NPL4, nuclear protein localization protein 99.64
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.17
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 98.49
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 97.9
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 97.84
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 97.77
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 97.74
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 97.71
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 97.71
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 97.7
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 97.67
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 97.67
3v6c_B91 Ubiquitin; structural genomics, structural genomic 97.65
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 97.65
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 97.6
3m62_B106 UV excision repair protein RAD23; armadillo-like r 97.59
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 97.58
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 97.56
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 97.56
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 97.55
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 97.54
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 97.54
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 97.53
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 97.52
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 97.49
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 97.48
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 97.47
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 97.46
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 97.46
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 97.42
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 97.34
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 97.34
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 97.34
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 97.29
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 97.27
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 97.26
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 97.23
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 96.31
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 97.22
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 97.18
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 97.16
1we6_A111 Splicing factor, putative; structural genomics, ub 97.11
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 97.08
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 97.06
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 97.03
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 97.01
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 97.01
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 96.99
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 96.98
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 96.88
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 96.86
2znr_A178 AMSH-like protease; metal binding protein, alterna 96.8
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 96.79
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 96.79
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 96.77
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 96.74
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 96.71
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 96.66
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 96.66
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 96.65
3rzv_A211 STAM-binding protein; ubiquitin hydrolase, endosom 96.64
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 96.62
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 96.58
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 96.56
2p8r_A 273 PRP8, PRE-mRNA-splicing factor PRP8; alpha-beta, t 96.53
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 96.43
2og4_A 254 PRE-mRNA-splicing factor 8; isopeptidase, JAB1/MPN 96.41
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 96.35
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 96.34
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 96.34
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 96.33
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 96.32
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 96.3
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 96.12
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 96.07
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 96.03
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 96.02
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 96.01
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 95.94
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 95.92
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 95.88
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 95.87
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 95.87
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 95.8
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 95.77
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 95.72
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 95.62
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 95.6
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 95.58
4ajy_B118 Transcription elongation factor B polypeptide 2; E 95.55
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 95.54
2fnj_B118 Transcription elongation factor B polypeptide 2; b 95.36
3sbg_A 565 PRE-mRNA-splicing factor 8; PRP8P, rnaseh domain, 95.33
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 95.2
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 95.05
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 94.99
2kj6_A97 Tubulin folding cofactor B; methods development, N 94.91
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 94.57
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 94.56
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 94.2
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 93.96
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 93.68
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 93.59
3rzv_A211 STAM-binding protein; ubiquitin hydrolase, endosom 92.86
2p8r_A273 PRP8, PRE-mRNA-splicing factor PRP8; alpha-beta, t 92.84
2znr_A178 AMSH-like protease; metal binding protein, alterna 92.58
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 92.46
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 91.92
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 91.63
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 91.42
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 91.4
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 91.3
3sbg_A565 PRE-mRNA-splicing factor 8; PRP8P, rnaseh domain, 90.82
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 89.93
2og4_A254 PRE-mRNA-splicing factor 8; isopeptidase, JAB1/MPN 89.23
4b4t_V 306 26S proteasome regulatory subunit RPN11; hydrolase 89.01
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 88.58
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 88.37
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 88.01
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 87.84
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 87.26
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 85.23
2kcq_A153 MOV34/MPN/PAD-1 family; NESG, structure, structura 84.39
4b4t_V306 26S proteasome regulatory subunit RPN11; hydrolase 82.28
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 80.7
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
Probab=99.64  E-value=1.5e-16  Score=131.80  Aligned_cols=74  Identities=34%  Similarity=0.665  Sum_probs=63.8

Q ss_pred             eeeeeeCCCcceeeEEecCCcchHHHHHHHHhhcCCCCCcceeeecCCccccccccccccccccCCCCcCeEEEe
Q psy8916         174 KILRIQSPVGIVKRININRSDTCKDLFEKINKEFELNTYNFALFKQRNKTDEIFSSRDQTIASVGLSNGDFVYMM  248 (520)
Q Consensus       174 MiIRfRSkdG~m~RVev~ptDtfs~LleKLl~~f~ls~dsftL~~nr~~~~~l~s~~~~tv~~lgLkHGDmlyl~  248 (520)
                      |+||||||+| |+||++++++++.+|+++|.+.++++.+.+.++...+.++++....+.+|+++||+|||||||.
T Consensus         5 m~lRvrs~~G-~~Ri~v~~~~t~~~L~~~I~~~~~i~~~~~~l~~~~~p~~~l~~~~~~~l~~lgl~hGd~l~l~   78 (80)
T 2pjh_A            5 IIIRVQSPDG-VKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKIKHGDLLFLF   78 (80)
T ss_dssp             CCCEEECSSE-EEECCCCSSCCHHHHHHHHHHHTCCCTTTCCCCCSCCGGGGSSSCCCCTTTTTCCCTTCCEEC-
T ss_pred             EEEEEECCCC-CEEEEcCCcChHHHHHHHHHHHcCCCCCcceEEecCCCCCcccCCCCCCHHHcCCCCCCEEEEe
Confidence            8999999999 9999999999999999999999999887766654443355665558899999999999999986
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2znr_A AMSH-like protease; metal binding protein, alternative splicing, hydrolase, metal-binding, metalloprotease, UBL conjugation pathway, zinc; 1.20A {Homo sapiens} PDB: 2znv_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3rzv_A STAM-binding protein; ubiquitin hydrolase, endosome-associated deubiquitinat enzyme, hydrolase; 1.67A {Homo sapiens} PDB: 3rzu_A Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2p8r_A PRP8, PRE-mRNA-splicing factor PRP8; alpha-beta, translation; 2.10A {Caenorhabditis elegans} PDB: 2p87_A Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2og4_A PRE-mRNA-splicing factor 8; isopeptidase, JAB1/MPN domain, protein-PR interaction, PRP8P, pseudoenzyme, spliceosome activation; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>3sbg_A PRE-mRNA-splicing factor 8; PRP8P, rnaseh domain, JAB1/MPN domain; 3.28A {Saccharomyces cerevisiae} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>3rzv_A STAM-binding protein; ubiquitin hydrolase, endosome-associated deubiquitinat enzyme, hydrolase; 1.67A {Homo sapiens} PDB: 3rzu_A Back     alignment and structure
>2p8r_A PRP8, PRE-mRNA-splicing factor PRP8; alpha-beta, translation; 2.10A {Caenorhabditis elegans} PDB: 2p87_A Back     alignment and structure
>2znr_A AMSH-like protease; metal binding protein, alternative splicing, hydrolase, metal-binding, metalloprotease, UBL conjugation pathway, zinc; 1.20A {Homo sapiens} PDB: 2znv_A Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3sbg_A PRE-mRNA-splicing factor 8; PRP8P, rnaseh domain, JAB1/MPN domain; 3.28A {Saccharomyces cerevisiae} Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>2og4_A PRE-mRNA-splicing factor 8; isopeptidase, JAB1/MPN domain, protein-PR interaction, PRP8P, pseudoenzyme, spliceosome activation; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_V 26S proteasome regulatory subunit RPN11; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>2kcq_A MOV34/MPN/PAD-1 family; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Salinibacter ruber dsm 13855} Back     alignment and structure
>4b4t_V 26S proteasome regulatory subunit RPN11; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query520
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 99.12
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 97.88
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 97.72
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 97.69
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 97.68
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 97.6
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 97.57
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.52
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 97.46
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 97.45
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 97.44
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 97.41
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 97.4
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 97.38
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 97.34
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 97.25
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 97.25
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 97.22
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 97.16
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 97.09
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 97.06
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 96.74
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 96.62
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 96.57
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 96.46
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 96.43
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 96.36
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 96.35
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 96.3
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 96.28
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 96.27
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 96.17
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 96.13
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 96.12
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 95.29
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 94.24
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.21
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 92.98
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 92.93
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 92.89
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 92.44
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 92.01
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 90.34
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: NPL4-like protein 1
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.12  E-value=7.2e-11  Score=98.95  Aligned_cols=80  Identities=23%  Similarity=0.335  Sum_probs=64.7

Q ss_pred             eeeeeCCCcceeeEEecC-CcchHHHHHHHHhhcCCCCCcceeeecCC--------cccc--ccccccccccccCCCCcC
Q psy8916         175 ILRIQSPVGIVKRININR-SDTCKDLFEKINKEFELNTYNFALFKQRN--------KTDE--IFSSRDQTIASVGLSNGD  243 (520)
Q Consensus       175 iIRfRSkdG~m~RVev~p-tDtfs~LleKLl~~f~ls~dsftL~~nr~--------~~~~--l~s~~~~tv~~lgLkHGD  243 (520)
                      +||+||+|| +.||+|+. ..++++|.++|.+.|+++.....|+.|++        .-..  ..+.++.+|+++|+.||.
T Consensus         2 iiRiRsrdG-~eRv~v~~~~~Tl~~LK~~Ie~~L~VPv~~Q~LSl~~~llL~k~P~~~~~~~~l~d~~~~L~sl~i~hGs   80 (94)
T d1wf9a1           2 MLRVRSRDG-LERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFLAFTDMADPNLRISSLNLAHGS   80 (94)
T ss_dssp             EEEEECSSC-EEEEEECCTTSBHHHHHHHHHHHSCCCTTTCCCBSSGGGGTCCSHHHHTTCCSSCCTTCBGGGTCCCTTC
T ss_pred             eEEEEecCC-ceEEEecCCCCcHHHHHHHHHHHhCCCcccceeecChhhhccCCccccchhhhccCCccCHHHcCccCce
Confidence            799999999 99999974 67999999999999999988777776644        1111  124467889999999999


Q ss_pred             eEEEeecCCCCC
Q psy8916         244 FVYMMNLSSPND  255 (520)
Q Consensus       244 mlyl~~~~~~~~  255 (520)
                      |||+.|+.....
T Consensus        81 ivyL~y~~~r~i   92 (94)
T d1wf9a1          81 MVYLAYEGERTI   92 (94)
T ss_dssp             EEECCCSSCCCC
T ss_pred             EEEEEeeeeecc
Confidence            999999865443
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure