Psyllid ID: psy8987

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MKYNSITYNAIEMRPTSRSDKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIKTSRYCPICDVQLNRQDPFLSLKYSYIAFASDDYDNDTRIYEQVLQIVLRIYLRKNVLRGTIHQLTRCFVRNVWWFYISIVIMFHRYHPSTD
ccccccccccccccccccccccHHHcccccEEccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHccccccccccccccccccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cccccccHcHHcccccccccEEEEEcccccEEEEccccEEEEccEHHHHHcccccccccccccccccccccHcHHHHHHHHHcccccccccEEEEcccccHEEcccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
mkynsitynaiemrptsrsdkllvrdvnphLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYiktsrycpicdvqlnrqdpflslkYSYIAfasddydndtRIYEQVLQIVLRIYLRKNVLRGTIHQLTRCFVRNVWWFYISIVIMFHRYHPSTD
mkynsitynaiemrptsrsdkllVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIKtsrycpicdvQLNRQDPFLSLKYSYIAFASDDYDNDTRIYEQVLQIVLRIYLRKNVLRGTIHQLTRCFVRNVWWFYISIVIMFHRYHPSTD
MKYNSITYNAIEMRPTSRSDKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIKTSRYCPICDVQLNRQDPFLSLKYSYIAFASDDYDNDTRIYEQVLQIVLRIYLRKNVLRGTIHQLTRCFVRNVWWFYISIVIMFHRYHPSTD
********************KLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIKTSRYCPICDVQLNRQDPFLSLKYSYIAFASDDYDNDTRIYEQVLQIVLRIYLRKNVLRGTIHQLTRCFVRNVWWFYISIVIMFHRY*****
*************************DVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIKTSRYCPICDVQLNRQDPFLSLKYSYIAFASDDYDNDTRIYEQVLQIVLRIYLRKNVLRGTIHQLTRCFVRNVWWFYISIVIMFHRYH****
MKYNSITYNAIEMRPTSRSDKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIKTSRYCPICDVQLNRQDPFLSLKYSYIAFASDDYDNDTRIYEQVLQIVLRIYLRKNVLRGTIHQLTRCFVRNVWWFYISIVIMFHRYHPSTD
****************SRSDKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIKTSRYCPICDVQLNRQDPFLSLKYSYIAFASDDYDNDTRIYEQVLQIVLRIYLRKNVLRGTIHQLTRCFVRNVWWFYISIVIMFHRYHPS**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYNSITYNAIEMRPTSRSDKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIKTSRYCPICDVQLNRQDPFLSLKYSYIAFASDDYDNDTRIYEQVLQIVLRIYLRKNVLRGTIHQLTRCFVRNVWWFYISIVIMFHRYHPSTD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query173 2.2.26 [Sep-21-2011]
Q5SDR3 326 Polycomb complex protein yes N/A 0.393 0.208 0.436 2e-17
Q7T3E6 324 Polycomb complex protein yes N/A 0.393 0.209 0.459 2e-17
P25916 324 Polycomb complex protein yes N/A 0.393 0.209 0.436 2e-17
Q5R8L2 326 Polycomb complex protein yes N/A 0.393 0.208 0.436 2e-17
P35226 326 Polycomb complex protein no N/A 0.393 0.208 0.436 2e-17
Q32KX7 326 Polycomb complex protein yes N/A 0.393 0.208 0.436 2e-17
Q9TST0 326 Polycomb complex protein N/A N/A 0.393 0.208 0.436 2e-17
Q8JIR0 320 Polycomb complex protein no N/A 0.393 0.212 0.448 2e-17
Q91648 326 Polycomb complex protein N/A N/A 0.393 0.208 0.436 3e-17
P35227 344 Polycomb group RING finge no N/A 0.393 0.197 0.425 5e-17
>sp|Q5SDR3|BMI1_CHICK Polycomb complex protein BMI-1 OS=Gallus gallus GN=BMI1 PE=2 SV=1 Back     alignment and function desciption
 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 60/87 (68%), Gaps = 19/87 (21%)

Query: 18  RSDKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCI 77
           R+ ++ + ++NPHL+CVLC GYF++AT+I+ECLH                   S CK+CI
Sbjct: 3   RTTRIKITELNPHLMCVLCGGYFIDATTIIECLH-------------------SFCKTCI 43

Query: 78  VKYIKTSRYCPICDVQLNRQDPFLSLK 104
           V+Y++TS+YCPICDVQ+++  P L+++
Sbjct: 44  VRYLETSKYCPICDVQVHKTRPLLNIR 70
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.
Gallus gallus (taxid: 9031)
>sp|Q7T3E6|BMI1B_DANRE Polycomb complex protein BMI-1-B OS=Danio rerio GN=bmi1b PE=2 SV=1 Back     alignment and function description
>sp|P25916|BMI1_MOUSE Polycomb complex protein BMI-1 OS=Mus musculus GN=Bmi1 PE=1 SV=1 Back     alignment and function description
>sp|Q5R8L2|BMI1_PONAB Polycomb complex protein BMI-1 OS=Pongo abelii GN=BMI1 PE=2 SV=1 Back     alignment and function description
>sp|P35226|BMI1_HUMAN Polycomb complex protein BMI-1 OS=Homo sapiens GN=BMI1 PE=1 SV=2 Back     alignment and function description
>sp|Q32KX7|BMI1_BOVIN Polycomb complex protein BMI-1 OS=Bos taurus GN=BMI1 PE=2 SV=1 Back     alignment and function description
>sp|Q9TST0|BMI1_FELCA Polycomb complex protein BMI-1 OS=Felis catus GN=BMI1 PE=2 SV=1 Back     alignment and function description
>sp|Q8JIR0|BMI1A_DANRE Polycomb complex protein BMI-1-A OS=Danio rerio GN=bmi1a PE=1 SV=2 Back     alignment and function description
>sp|Q91648|BMI1A_XENLA Polycomb complex protein BMI-1-A OS=Xenopus laevis GN=bmi1a PE=1 SV=1 Back     alignment and function description
>sp|P35227|PCGF2_HUMAN Polycomb group RING finger protein 2 OS=Homo sapiens GN=PCGF2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
328721663 985 PREDICTED: hypothetical protein LOC10016 0.427 0.075 0.479 2e-19
334348830 589 PREDICTED: polycomb complex protein BMI- 0.427 0.125 0.437 2e-18
395539960 802 PREDICTED: uncharacterized protein LOC10 0.393 0.084 0.436 4e-18
354474513 523 PREDICTED: polycomb complex protein BMI- 0.393 0.130 0.436 6e-18
348512208 567 PREDICTED: polycomb complex protein BMI- 0.393 0.119 0.448 6e-18
242009130 886 polycomb complex protein bmi-1, putative 0.375 0.073 0.452 8e-17
405957199 894 Polycomb complex protein BMI-1 [Crassost 0.358 0.069 0.444 5e-16
417409780 332 Putative locus-specific chromosome bindi 0.439 0.228 0.444 6e-16
74211363 324 unnamed protein product [Mus musculus] 0.393 0.209 0.436 6e-16
410908881 529 PREDICTED: polycomb complex protein BMI- 0.393 0.128 0.448 6e-16
>gi|328721663|ref|XP_001942972.2| PREDICTED: hypothetical protein LOC100162132 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 46/96 (47%), Positives = 63/96 (65%), Gaps = 22/96 (22%)

Query: 13  MRPTSRSDKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSV 72
           M+ TSR+   LV+ +NPHL+CVLC GY+++ T+IVECLHS                    
Sbjct: 1   MKETSRT---LVKSLNPHLVCVLCAGYYIDPTTIVECLHS-------------------F 38

Query: 73  CKSCIVKYIKTSRYCPICDVQLNRQDPFLSLKYSYI 108
           C+SCIVKY++TSR+CPICDVQL++  P LS++   I
Sbjct: 39  CRSCIVKYLETSRFCPICDVQLHKTRPLLSIRRDKI 74

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|334348830|ref|XP_001367832.2| PREDICTED: polycomb complex protein BMI-1-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|395539960|ref|XP_003771930.1| PREDICTED: uncharacterized protein LOC100928474 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|354474513|ref|XP_003499475.1| PREDICTED: polycomb complex protein BMI-1-like [Cricetulus griseus] Back     alignment and taxonomy information
>gi|348512208|ref|XP_003443635.1| PREDICTED: polycomb complex protein BMI-1-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|242009130|ref|XP_002425345.1| polycomb complex protein bmi-1, putative [Pediculus humanus corporis] gi|212509130|gb|EEB12607.1| polycomb complex protein bmi-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|405957199|gb|EKC23428.1| Polycomb complex protein BMI-1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|417409780|gb|JAA51381.1| Putative locus-specific chromosome binding protein, partial [Desmodus rotundus] Back     alignment and taxonomy information
>gi|74211363|dbj|BAE26436.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|410908881|ref|XP_003967919.1| PREDICTED: polycomb complex protein BMI-1-like [Takifugu rubripes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
UNIPROTKB|C9J3G7109 PCGF3 "Polycomb group RING fin 0.184 0.293 0.468 2.3e-12
UNIPROTKB|C9JYD062 PCGF3 "Polycomb group RING fin 0.184 0.516 0.468 9.7e-12
UNIPROTKB|Q5T8Z1207 BMI1 "Polycomb complex protein 0.404 0.338 0.325 8.4e-10
UNIPROTKB|Q5T8Z4150 BMI1 "Polycomb complex protein 0.404 0.466 0.325 8.4e-10
UNIPROTKB|Q5T8Z592 BMI1 "Polycomb complex protein 0.404 0.760 0.325 8.4e-10
UNIPROTKB|Q5T8Z6105 BMI1 "Polycomb complex protein 0.404 0.666 0.325 8.4e-10
RGD|1307403200 Bmi1 "Bmi1 polycomb ring finge 0.404 0.35 0.325 8.4e-10
FB|FBgn0002283222 l(3)73Ah "lethal (3) 73Ah" [Dr 0.184 0.144 0.437 1.2e-09
ZFIN|ZDB-GENE-040116-4 326 bmi1b "B lymphoma Mo-MLV inser 0.404 0.214 0.337 1.2e-09
ZFIN|ZDB-GENE-030131-224 320 bmi1a "B lymphoma Mo-MLV inser 0.404 0.218 0.325 1.5e-09
UNIPROTKB|C9J3G7 PCGF3 "Polycomb group RING finger protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 102 (41.0 bits), Expect = 2.3e-12, Sum P(2) = 2.3e-12
 Identities = 15/32 (46%), Positives = 24/32 (75%)

Query:    21 KLLVRDVNPHLLCVLCRGYFVEATSIVECLHS 52
             K+ + D+N H+ C LC GY ++AT++ ECLH+
Sbjct:     5 KIKLWDINAHITCRLCSGYLIDATTVTECLHT 36
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|C9JYD0 PCGF3 "Polycomb group RING finger protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T8Z1 BMI1 "Polycomb complex protein BMI-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T8Z4 BMI1 "Polycomb complex protein BMI-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T8Z5 BMI1 "Polycomb complex protein BMI-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T8Z6 BMI1 "Polycomb complex protein BMI-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307403 Bmi1 "Bmi1 polycomb ring finger oncogene" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0002283 l(3)73Ah "lethal (3) 73Ah" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040116-4 bmi1b "B lymphoma Mo-MLV insertion region 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-224 bmi1a "B lymphoma Mo-MLV insertion region 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 0.002
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information 
 Score = 34.0 bits (78), Expect = 0.002
 Identities = 11/59 (18%), Positives = 21/59 (35%), Gaps = 20/59 (33%)

Query: 33 CVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIK-TSRYCPIC 90
          C +C     +  +I+ C H                     C  CI+ +++  +  CP+C
Sbjct: 1  CPICLEEPKDPVTILPCGHLF-------------------CSKCILSWLESGNVTCPLC 40

The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid. Many proteins containing a RING finger play a key role in the ubiquitination pathway. Length = 40

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
KOG2660|consensus 331 99.86
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.1
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.97
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.94
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.79
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.75
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.68
KOG2177|consensus 386 98.66
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.65
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.64
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.63
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.6
PHA02929238 N1R/p28-like protein; Provisional 98.53
KOG0311|consensus 381 98.5
KOG0287|consensus 442 98.47
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.38
PHA02926242 zinc finger-like protein; Provisional 98.34
KOG0317|consensus293 98.26
PF1463444 zf-RING_5: zinc-RING finger domain 98.15
KOG0320|consensus187 98.14
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.12
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.11
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.06
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.05
KOG0823|consensus230 97.9
KOG2164|consensus 513 97.78
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.75
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.66
KOG0297|consensus 391 97.51
KOG0802|consensus 543 97.49
KOG0978|consensus698 97.48
KOG4159|consensus 398 97.36
KOG1813|consensus313 97.32
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.96
KOG4628|consensus348 96.95
KOG1039|consensus344 96.72
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 96.39
COG5152259 Uncharacterized conserved protein, contains RING a 96.39
COG5222427 Uncharacterized conserved protein, contains RING Z 96.37
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.36
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 96.25
KOG2879|consensus298 95.87
KOG4172|consensus62 95.21
KOG4265|consensus349 94.9
KOG0826|consensus357 94.86
KOG1002|consensus 791 94.68
KOG3039|consensus303 94.6
KOG0804|consensus 493 94.57
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 94.01
KOG4367|consensus 699 93.34
KOG0298|consensus 1394 92.25
KOG0824|consensus 324 92.22
KOG1001|consensus674 91.96
KOG4445|consensus 368 91.69
KOG3800|consensus 300 90.67
KOG4692|consensus489 90.59
PF04641260 Rtf2: Rtf2 RING-finger 90.47
KOG0825|consensus 1134 90.38
KOG1571|consensus355 89.88
KOG0827|consensus 465 88.98
KOG1734|consensus328 88.57
KOG1785|consensus563 88.31
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 88.27
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 88.06
KOG1645|consensus 463 87.89
KOG4739|consensus 233 86.84
KOG1493|consensus84 86.47
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 86.34
KOG0828|consensus636 85.6
COG52191525 Uncharacterized conserved protein, contains RING Z 85.5
PHA03096284 p28-like protein; Provisional 83.57
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 83.29
KOG2930|consensus114 81.44
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 81.05
KOG4275|consensus350 81.02
KOG4185|consensus 296 80.95
>KOG2660|consensus Back     alignment and domain information 
Probab=99.86  E-value=9.8e-23  Score=180.50  Aligned_cols=93  Identities=38%  Similarity=0.880  Sum_probs=86.4

Q ss_pred             cchhhhhccCCceeecccchhhhhhccccccCCccccccccchhhhhccccccchHHhHHHhhcCCCCCCcccccccCCC
Q psy8987          19 SDKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIKTSRYCPICDVQLNRQD   98 (173)
Q Consensus        19 ~~~~~v~~vn~~l~C~iC~~~f~~p~si~~C~Hs~~~~~~~~~~~~~~~~~~~fCksCI~k~i~~s~~CP~C~~~l~~~~   98 (173)
                      ...+++.++|+|.+|.+|.|||+|||+|++|+|+                   |||+||++|+..+++||.|+..++...
T Consensus         4 ~~~vk~~~~n~~itC~LC~GYliDATTI~eCLHT-------------------FCkSCivk~l~~~~~CP~C~i~ih~t~   64 (331)
T KOG2660|consen    4 PRRVKLTELNPHITCRLCGGYLIDATTITECLHT-------------------FCKSCIVKYLEESKYCPTCDIVIHKTH   64 (331)
T ss_pred             chhhhhhhcccceehhhccceeecchhHHHHHHH-------------------HHHHHHHHHHHHhccCCccceeccCcc
Confidence            4567889999999999999999999999999999                   999999999999999999999999999


Q ss_pred             CcccccccchhcccCCCCchHHHHHHHHHHHHHHHHHhhhhchh
Q psy8987          99 PFLSLKYSYIAFASDDYDNDTRIYEQVLQIVLRIYLRKNVLRGT  142 (173)
Q Consensus        99 p~~slk~~~~a~~s~~y~~d~~~qe~VykLvp~ly~re~~~rg~  142 (173)
                      |.+++++|+            ++|++||||||+++.||+-.+-+
T Consensus        65 pl~ni~~Dr------------tlqdiVyKLVPgl~erE~k~~rd   96 (331)
T KOG2660|consen   65 PLLNIRSDR------------TLQDIVYKLVPGLQEREMKRRRD   96 (331)
T ss_pred             ccccCCcch------------HHHHHHHHHcchHHHHHHHHHHH
Confidence            999999985            59999999999999998765544

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
3rpg_B117 Bmi1RING1B-Ubch5c Complex Structure Length = 117 3e-18
2ckl_A108 Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 3e-18
2h0d_A97 Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti 2e-17
2djb_A72 Solution Structure Of The Ring Domain Of The Human 3e-07
>pdb|3RPG|B Chain B, Bmi1RING1B-Ubch5c Complex Structure Length = 117 Back     alignment and structure 
Iteration: 1

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 60/87 (68%), Gaps = 19/87 (21%)
Query: 18  RSDKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCI 77
           R+ ++ + ++NPHL+CVLC GYF++AT+I+ECLH                   S CK+CI
Sbjct: 3   RTTRIKITELNPHLMCVLCGGYFIDATTIIECLH-------------------SFCKTCI 43
Query: 78  VKYIKTSRYCPICDVQLNRQDPFLSLK 104
           V+Y++TS+YCPICDVQ+++  P L+++
Sbjct: 44  VRYLETSKYCPICDVQVHKTRPLLNIR 70
>pdb|2CKL|A Chain A, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 108 Back     alignment and structure
>pdb|2H0D|A Chain A, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 97 Back     alignment and structure
>pdb|2DJB|A Chain A, Solution Structure Of The Ring Domain Of The Human Polycomb Group Ring Finger Protein 6 Length = 72 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-17
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 6e-15
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 3e-12
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 6e-12
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 6e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 7e-04
1z6u_A150 NP95-like ring finger protein isoform B; structura 9e-04
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
 Score = 72.2 bits (177), Expect = 3e-17
 Identities = 38/87 (43%), Positives = 60/87 (68%), Gaps = 19/87 (21%)

Query: 18  RSDKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCI 77
           R+ ++ + ++NPHL+CVLC GYF++AT+I+ECLHS                    CK+CI
Sbjct: 3   RTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSF-------------------CKTCI 43

Query: 78  VKYIKTSRYCPICDVQLNRQDPFLSLK 104
           V+Y++TS+YCPICDVQ+++  P L+++
Sbjct: 44  VRYLETSKYCPICDVQVHKTRPLLNIR 70
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.63
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.49
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.37
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.36
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.34
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.33
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.32
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.31
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.31
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.3
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.3
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.3
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.29
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.29
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.29
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.28
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.28
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.26
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.23
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.23
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.2
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.19
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.18
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.15
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.15
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.15
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.13
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.13
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.13
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.12
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.12
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.11
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.08
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.08
2ect_A78 Ring finger protein 126; metal binding protein, st 99.07
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.05
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.05
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.05
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.05
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.03
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.01
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.0
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.0
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.99
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.98
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.93
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.87
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.86
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.85
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.8
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.78
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.77
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.75
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.75
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.57
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.54
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.44
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.44
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.35
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.3
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.29
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.26
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.23
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.13
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.13
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.79
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.72
2ea5_A68 Cell growth regulator with ring finger domain prot 97.63
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.89
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.86
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 95.55
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.23
3nw0_A238 Non-structural maintenance of chromosomes element 93.99
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 89.47
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 86.18
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
Probab=99.63  E-value=1.3e-16  Score=114.56  Aligned_cols=95  Identities=43%  Similarity=1.011  Sum_probs=77.4

Q ss_pred             ccchhhhhccCCceeecccchhhhhhccccccCCccccccccchhhhhccccccchHHhHHHhhcCCCCCCcccccccCC
Q psy8987          18 RSDKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIKTSRYCPICDVQLNRQ   97 (173)
Q Consensus        18 r~~~~~v~~vn~~l~C~iC~~~f~~p~si~~C~Hs~~~~~~~~~~~~~~~~~~~fCksCI~k~i~~s~~CP~C~~~l~~~   97 (173)
                      |+.++.++++.+++.|+||.+.|.+|++++.|||+                   ||+.||.+|++.+..||.|+..+...
T Consensus         3 r~~~~~~~~~~~~~~C~IC~~~~~~p~~~~~CgH~-------------------fC~~Ci~~~~~~~~~CP~Cr~~~~~~   63 (108)
T 2ckl_A            3 RTTRIKITELNPHLMCVLCGGYFIDATTIIECLHS-------------------FCKTCIVRYLETSKYCPICDVQVHKT   63 (108)
T ss_dssp             ---CEEHHHHGGGTBCTTTSSBCSSEEEETTTCCE-------------------EEHHHHHHHHTSCSBCTTTCCBSCSS
T ss_pred             cccccchhccCCcCCCccCChHHhCcCEeCCCCCh-------------------hhHHHHHHHHHhCCcCcCCCcccccc
Confidence            34567778899999999999999999987799999                   99999999999999999999998876


Q ss_pred             CCcccccccchhcccCCCCchHHHHHHHHHHHHHHHHHhhhhchhh
Q psy8987          98 DPFLSLKYSYIAFASDDYDNDTRIYEQVLQIVLRIYLRKNVLRGTI  143 (173)
Q Consensus        98 ~p~~slk~~~~a~~s~~y~~d~~~qe~VykLvp~ly~re~~~rg~~  143 (173)
                      .|..++..+            ..+++++.+++++...+|...++++
T Consensus        64 ~~~~~l~~n------------~~l~~~i~~~~~~~~~~e~~~~~~~   97 (108)
T 2ckl_A           64 RPLLNIRSD------------KTLQDIVYKLVPGLFKNEMKRRRDF   97 (108)
T ss_dssp             CGGGGEEEC------------HHHHHHHHHHSTTHHHHHHHHHHHH
T ss_pred             CcccccCcC------------HHHHHHHHHHhhhHHHHHHHhHHHH
Confidence            665555554            4588888889888877776665543
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.41
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.35
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.32
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.29
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.27
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.24
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.2
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.08
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.95
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.87
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.83
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.69
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.49
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.41
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.0
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.36
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: bard1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.41  E-value=9.6e-15  Score=103.00  Aligned_cols=58  Identities=26%  Similarity=0.560  Sum_probs=49.9

Q ss_pred             chhhhhccCCceeecccchhhhhhccccccCCccccccccchhhhhccccccchHHhHHHhhcCCCCCCcccccccCCC
Q psy8987          20 DKLLVRDVNPHLLCVLCRGYFVEATSIVECLHSCDFVSYFSHFCKLLFGFVSVCKSCIVKYIKTSRYCPICDVQLNRQD   98 (173)
Q Consensus        20 ~~~~v~~vn~~l~C~iC~~~f~~p~si~~C~Hs~~~~~~~~~~~~~~~~~~~fCksCI~k~i~~s~~CP~C~~~l~~~~   98 (173)
                      .+..++++++.+.|+||.++|.+|++++.|||+                   ||+.||.+|+..  .||.|+..+...+
T Consensus        12 ~~~~l~~l~~~l~C~IC~~~~~~pv~~~~CgH~-------------------fC~~Ci~~~~~~--~CP~Cr~~~~~~~   69 (97)
T d1jm7b_          12 SRAALDRLEKLLRCSRCTNILREPVCLGGCEHI-------------------FCSNCVSDCIGT--GCPVCYTPAWIQD   69 (97)
T ss_dssp             HHHHHHHHHHTTSCSSSCSCCSSCBCCCSSSCC-------------------BCTTTGGGGTTT--BCSSSCCBCSCSS
T ss_pred             HHHHHHhhhhcCCCccCCchhhcCceeCCCCCc-------------------hhHHHHHHHHhc--cccccCCcCchhh
Confidence            344567889999999999999999988899999                   999999999854  4999998876544
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure