Psyllid ID: psy8996

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MEIVEKREPAFSISEVHYANNYTTESEVHYANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRIGEDANNSISTIG
cccccccccEEEcccccHHHHHHHHHHHHHHcccccEEEEcccccccccccccEEEEEEEccccccccccHHHHHHHHHHcccccccccccEEcc
ccHHHccEEEEEEccccHHHHHHHHHHHHHHHccccEEEEHHHccHHHHcccEEEEEEEEccccccccccHHHHHHHHHHHcccccccccccccc
meivekrepafsisevhyannyttesevhyannyttevlrmdeydmssIEHEALILVVAStfgngdppengQEFAQNLHALRigedannsistig
meivekrepafsisevhyannyttesevhyANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHalrigedannsistig
MEIVEKREPAFSISEVHYANNYTTESEVHYANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRIGEDANNSISTIG
***********SISEVHYANNYTTESEVHYANNYTTEVLRMDEYDMSSIEHEALILVVASTFG********************************
**********FSISEVHYANNYTTESEVHYANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRIGEDANNSISTIG
MEIVEKREPAFSISEVHYANNYTTESEVHYANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRIGEDANNSISTIG
MEIVEKREPAFSISEVHYANNYTTESEVHYANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRI************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIVEKREPAFSISEVHYANNYTTESEVHYANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRIGEDANNSISTIG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query95 2.2.26 [Sep-21-2011]
Q26240 1174 Nitric oxide synthase, sa N/A N/A 0.673 0.054 0.528 2e-16
Q27571 1349 Nitric oxide synthase OS= yes N/A 0.652 0.045 0.546 8e-15
O61608 1247 Nitric oxide synthase OS= N/A N/A 0.589 0.044 0.589 1e-14
Q62600 1202 Nitric oxide synthase, en yes N/A 0.684 0.054 0.538 2e-13
P70313 1202 Nitric oxide synthase, en yes N/A 0.684 0.054 0.538 2e-13
P29473 1205 Nitric oxide synthase, en yes N/A 0.684 0.053 0.538 2e-13
B1B557 1097 Nitric oxide synthase-lik N/A N/A 0.810 0.070 0.444 6e-13
P29474 1203 Nitric oxide synthase, en yes N/A 0.684 0.054 0.523 8e-13
Q9TUX8 1205 Nitric oxide synthase, en yes N/A 0.684 0.053 0.523 8e-13
Q8T8C0 1209 Nitric oxide synthase OS= N/A N/A 0.8 0.062 0.447 9e-13
>sp|Q26240|NOS_RHOPR Nitric oxide synthase, salivary gland OS=Rhodnius prolixus PE=2 SV=1 Back     alignment and function desciption
 Score = 84.3 bits (207), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/70 (52%), Positives = 56/70 (80%), Gaps = 6/70 (8%)

Query: 30  YANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRIGEDA-- 87
           +++ + ++VL M++YDMS IEHEAL+LVVASTFGNGDPPENGQ FAQ+L+ +++ E+   
Sbjct: 527 FSHAFHSQVLSMEDYDMSKIEHEALLLVVASTFGNGDPPENGQGFAQSLYTIKMDENGLP 586

Query: 88  ----NNSIST 93
               NN++++
Sbjct: 587 NGHTNNTLAS 596
Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. The production of NO in the salivary gland is used as a vasodilator for blood sucking.
Rhodnius prolixus (taxid: 13249)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 3EC: 9
>sp|Q27571|NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster GN=Nos PE=2 SV=3 Back     alignment and function description
>sp|O61608|NOS_ANOST Nitric oxide synthase OS=Anopheles stephensi PE=2 SV=2 Back     alignment and function description
>sp|Q62600|NOS3_RAT Nitric oxide synthase, endothelial OS=Rattus norvegicus GN=Nos3 PE=1 SV=4 Back     alignment and function description
>sp|P70313|NOS3_MOUSE Nitric oxide synthase, endothelial OS=Mus musculus GN=Nos3 PE=1 SV=4 Back     alignment and function description
>sp|P29473|NOS3_BOVIN Nitric oxide synthase, endothelial OS=Bos taurus GN=NOS3 PE=1 SV=3 Back     alignment and function description
>sp|B1B557|NOSL_BOMMO Nitric oxide synthase-like protein OS=Bombyx mori GN=NSL PE=2 SV=1 Back     alignment and function description
>sp|P29474|NOS3_HUMAN Nitric oxide synthase, endothelial OS=Homo sapiens GN=NOS3 PE=1 SV=3 Back     alignment and function description
>sp|Q9TUX8|NOS3_CANFA Nitric oxide synthase, endothelial OS=Canis familiaris GN=NOS3 PE=2 SV=1 Back     alignment and function description
>sp|Q8T8C0|NOS_BOMMO Nitric oxide synthase OS=Bombyx mori GN=NOS PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
328723781 1201 PREDICTED: nitric oxide synthase, saliva 0.642 0.050 0.622 8e-17
328723779 1190 PREDICTED: nitric oxide synthase, saliva 0.642 0.051 0.622 9e-17
8473626 1174 RecName: Full=Nitric oxide synthase, sal 0.673 0.054 0.528 8e-15
312376329 1347 hypothetical protein AND_12855 [Anophele 0.926 0.065 0.461 9e-15
322788384 1142 hypothetical protein SINV_03517 [Solenop 0.642 0.053 0.622 1e-14
221136346 1163 nitric oxide synthase [Gryllus bimaculat 0.6 0.049 0.614 4e-14
332021642 1146 Nitric oxide synthase, salivary gland [A 0.642 0.053 0.590 5e-14
61175210 1143 nitric oxide synthase [Apis mellifera] g 0.642 0.053 0.590 6e-14
383865281 1142 PREDICTED: nitric oxide synthase, saliva 0.642 0.053 0.590 6e-14
380030474 1143 PREDICTED: nitric oxide synthase, saliva 0.642 0.053 0.590 6e-14
>gi|328723781|ref|XP_001946209.2| PREDICTED: nitric oxide synthase, salivary gland-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 90.9 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 52/61 (85%)

Query: 30  YANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRIGEDANN 89
           +A+ + ++V+ M+EYDM+SIEHEAL+LVV STFGNGDPPENGQEFAQ LH++++  +  N
Sbjct: 530 FAHAFHSQVMSMEEYDMTSIEHEALLLVVVSTFGNGDPPENGQEFAQQLHSMKMEHEGTN 589

Query: 90  S 90
           S
Sbjct: 590 S 590

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328723779|ref|XP_003247939.1| PREDICTED: nitric oxide synthase, salivary gland-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|8473626|sp|Q26240.1|NOS_RHOPR RecName: Full=Nitric oxide synthase, salivary gland; Short=NOS gi|1418270|gb|AAB03810.1| nitric oxide synthase [Rhodnius prolixus] Back     alignment and taxonomy information
>gi|312376329|gb|EFR23448.1| hypothetical protein AND_12855 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|322788384|gb|EFZ14055.1| hypothetical protein SINV_03517 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|221136346|dbj|BAH14964.1| nitric oxide synthase [Gryllus bimaculatus] Back     alignment and taxonomy information
>gi|332021642|gb|EGI62001.1| Nitric oxide synthase, salivary gland [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|61175210|ref|NP_001012980.1| nitric oxide synthase [Apis mellifera] gi|59891393|dbj|BAD89803.1| nitric oxide synthase [Apis mellifera] Back     alignment and taxonomy information
>gi|383865281|ref|XP_003708103.1| PREDICTED: nitric oxide synthase, salivary gland-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380030474|ref|XP_003698873.1| PREDICTED: nitric oxide synthase, salivary gland-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
FB|FBgn0011676 1349 Nos "Nitric oxide synthase" [D 0.652 0.045 0.546 1.4e-13
MGI|MGI:97362 1202 Nos3 "nitric oxide synthase 3, 0.8 0.063 0.487 1e-11
RGD|3186 1202 Nos3 "nitric oxide synthase 3, 0.8 0.063 0.487 1e-11
UNIPROTKB|F1LQC7 1202 Nos3 "Nitric oxide synthase" [ 0.8 0.063 0.487 1e-11
UNIPROTKB|F1MY54 1205 NOS3 "Nitric oxide synthase" [ 0.684 0.053 0.538 1.3e-11
UNIPROTKB|P29473 1205 NOS3 "Nitric oxide synthase, e 0.684 0.053 0.538 1.3e-11
UNIPROTKB|E7ESA7 997 NOS3 "Nitric oxide synthase, e 0.8 0.076 0.474 2.1e-11
UNIPROTKB|F1SSJ3 1155 NOS3 "Nitric oxide synthase" [ 0.8 0.065 0.474 2.5e-11
UNIPROTKB|P29474 1203 NOS3 "Nitric oxide synthase, e 0.8 0.063 0.474 2.7e-11
UNIPROTKB|F1PV06 1205 NOS3 "Nitric oxide synthase" [ 0.8 0.063 0.474 2.7e-11
FB|FBgn0011676 Nos "Nitric oxide synthase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 191 (72.3 bits), Expect = 1.4e-13, P = 1.4e-13
 Identities = 35/64 (54%), Positives = 51/64 (79%)

Query:    34 YTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRIGEDANNSI-- 91
             +  ++  M +YD+SSIEHEAL++VVASTFGNGDPPENG+ F+Q L+A+R+ E + + +  
Sbjct:   697 FNAQIYCMSDYDISSIEHEALLIVVASTFGNGDPPENGELFSQELYAMRVQESSEHGLQD 756

Query:    92 STIG 95
             S+IG
Sbjct:   757 SSIG 760
GO:0004517 "nitric-oxide synthase activity" evidence=ISS;IMP;IDA;TAS
GO:0046620 "regulation of organ growth" evidence=TAS
GO:0005516 "calmodulin binding" evidence=IEA;NAS
GO:0008285 "negative regulation of cell proliferation" evidence=TAS
GO:0006809 "nitric oxide biosynthetic process" evidence=IEA;TAS
GO:0007444 "imaginal disc development" evidence=TAS
GO:0008156 "negative regulation of DNA replication" evidence=TAS
GO:0007416 "synapse assembly" evidence=TAS
GO:0020037 "heme binding" evidence=IEA;NAS
GO:0006952 "defense response" evidence=NAS
GO:0005575 "cellular_component" evidence=ND
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0010181 "FMN binding" evidence=IEA
GO:0007399 "nervous system development" evidence=IMP
GO:0005829 "cytosol" evidence=IBA
GO:0007263 "nitric oxide mediated signal transduction" evidence=IBA
GO:0031284 "positive regulation of guanylate cyclase activity" evidence=IBA
GO:0003958 "NADPH-hemoprotein reductase activity" evidence=IBA
MGI|MGI:97362 Nos3 "nitric oxide synthase 3, endothelial cell" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3186 Nos3 "nitric oxide synthase 3, endothelial cell" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQC7 Nos3 "Nitric oxide synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY54 NOS3 "Nitric oxide synthase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P29473 NOS3 "Nitric oxide synthase, endothelial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E7ESA7 NOS3 "Nitric oxide synthase, endothelial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSJ3 NOS3 "Nitric oxide synthase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P29474 NOS3 "Nitric oxide synthase, endothelial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PV06 NOS3 "Nitric oxide synthase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q62600NOS3_RAT1, ., 1, 4, ., 1, 3, ., 3, 90.53840.68420.0540yesN/A
Q28969NOS3_PIG1, ., 1, 4, ., 1, 3, ., 3, 90.52300.68420.0539yesN/A
Q27571NOS_DROME1, ., 1, 4, ., 1, 3, ., 3, 90.54680.65260.0459yesN/A
Q9TUX8NOS3_CANFA1, ., 1, 4, ., 1, 3, ., 3, 90.52300.68420.0539yesN/A
P70313NOS3_MOUSE1, ., 1, 4, ., 1, 3, ., 3, 90.53840.68420.0540yesN/A
P29473NOS3_BOVIN1, ., 1, 4, ., 1, 3, ., 3, 90.53840.68420.0539yesN/A
P29474NOS3_HUMAN1, ., 1, 4, ., 1, 3, ., 3, 90.52300.68420.0540yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
pfam00258142 pfam00258, Flavodoxin_1, Flavodoxin 3e-07
COG0369 587 COG0369, CysJ, Sulfite reductase, alpha subunit (f 8e-07
TIGR01931 597 TIGR01931, cysJ, sulfite reductase [NADPH] flavopr 1e-06
PRK10953 600 PRK10953, cysJ, sulfite reductase subunit alpha; P 0.004
>gnl|CDD|215823 pfam00258, Flavodoxin_1, Flavodoxin Back     alignment and domain information 
 Score = 44.7 bits (106), Expect = 3e-07
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 36 TEVLRMDEYDMSS-IEHEALILVVASTFGNGDPPENGQEFAQNLHALRIGEDA 87
            V+ +D+ D +  I  E L+L V ST+G+G+PP+N + F   L    +  + 
Sbjct: 28 VVVVSLDDVDETEEILEEDLVLFVTSTYGDGEPPDNAKPFEDWLLLFGLPLEG 80

Length = 142
>gnl|CDD|223446 COG0369, CysJ, Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233643 TIGR01931, cysJ, sulfite reductase [NADPH] flavoprotein, alpha-component Back     alignment and domain information
>gnl|CDD|182862 PRK10953, cysJ, sulfite reductase subunit alpha; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 95
KOG1159|consensus 574 99.94
PRK08105149 flavodoxin; Provisional 99.92
PRK09004146 FMN-binding protein MioC; Provisional 99.92
PRK10953 600 cysJ sulfite reductase subunit alpha; Provisional 99.91
PRK05723151 flavodoxin; Provisional 99.9
TIGR01931 597 cysJ sulfite reductase [NADPH] flavoprotein, alpha 99.89
PF00258143 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This 99.8
PRK07308146 flavodoxin; Validated 99.77
PRK12359172 flavodoxin FldB; Provisional 99.76
PRK06703151 flavodoxin; Provisional 99.75
COG0369 587 CysJ Sulfite reductase, alpha subunit (flavoprotei 99.71
TIGR01753140 flav_short flavodoxin, short chain. Flavodoxins ar 99.7
PRK09271160 flavodoxin; Provisional 99.7
TIGR01752167 flav_long flavodoxin, long chain. Flavodoxins are 99.68
COG0716151 FldA Flavodoxins [Energy production and conversion 99.65
PRK06756148 flavodoxin; Provisional 99.64
TIGR01754140 flav_RNR ribonucleotide reductase-associated flavo 99.64
PRK09267169 flavodoxin FldA; Validated 99.62
PRK05568142 flavodoxin; Provisional 99.54
PRK05569141 flavodoxin; Provisional 99.53
TIGR00333125 nrdI ribonucleoside-diphosphate reductase 2, opero 99.46
KOG1158|consensus 645 99.44
PRK11921394 metallo-beta-lactamase/flavodoxin domain-containin 99.37
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 99.34
PRK11104177 hemG protoporphyrinogen oxidase; Provisional 99.28
PRK02551154 flavoprotein NrdI; Provisional 99.22
KOG1160|consensus 601 99.17
PRK06242150 flavodoxin; Provisional 99.14
TIGR01755197 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV. 99.08
PRK03767200 NAD(P)H:quinone oxidoreductase; Provisional 99.06
PRK03600134 nrdI ribonucleotide reductase stimulatory protein; 99.04
PF12724143 Flavodoxin_5: Flavodoxin domain 98.97
PF12641160 Flavodoxin_3: Flavodoxin domain 98.92
PRK07116160 flavodoxin; Provisional 98.69
PF07972122 Flavodoxin_NdrI: NrdI Flavodoxin like ; InterPro: 98.46
COG4635175 HemG Flavodoxin [Energy production and conversion 98.37
COG0426388 FpaA Uncharacterized flavoproteins [Energy product 98.35
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 98.16
PF12682156 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A. 97.94
COG1780141 NrdI Protein involved in ribonucleotide reduction 97.84
PRK06934221 flavodoxin; Provisional 97.17
TIGR03567171 FMN_reduc_SsuE FMN reductase, SsuE family. Members 97.06
PRK10569191 NAD(P)H-dependent FMN reductase; Provisional 96.98
TIGR03566174 FMN_reduc_MsuE FMN reductase, MsuE subfamily. Memb 96.86
COG0655207 WrbA Multimeric flavodoxin WrbA [General function 96.78
PRK00170201 azoreductase; Reviewed 96.46
PRK01355199 azoreductase; Reviewed 96.28
PRK09739199 hypothetical protein; Provisional 95.88
TIGR02690219 resist_ArsH arsenical resistance protein ArsH. Mem 94.61
PF02525199 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR0 93.68
PRK13556208 azoreductase; Provisional 92.89
KOG3135|consensus203 92.8
cd0556689 PTS_IIB_galactitol PTS_IIB_galactitol: subunit IIB 90.58
COG0431184 Predicted flavoprotein [General function predictio 89.87
PF09651136 Cas_APE2256: CRISPR-associated protein (Cas_APE225 88.49
PF06283 217 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A. 87.27
cd0556885 PTS_IIB_bgl_like PTS_IIB_bgl_like: the PTS (phosph 86.77
TIGR0082985 FRU PTS system, fructose-specific, IIB component. 85.76
cd03142 215 GATase1_ThuA Type 1 glutamine amidotransferase (GA 85.52
cd05014128 SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5 83.54
cd0556996 PTS_IIB_fructose PTS_IIB_fructose: subunit IIB of 83.43
PRK10427114 putative PTS system fructose-like transporter subu 82.67
cd0556787 PTS_IIB_mannitol PTS_IIB_mannitol: subunit IIB of 81.37
cd0013384 PTS_IIB PTS_IIB: subunit IIB of enzyme II (EII) is 80.14
>KOG1159|consensus Back     alignment and domain information 
Probab=99.94  E-value=1.3e-27  Score=181.55  Aligned_cols=88  Identities=22%  Similarity=0.255  Sum_probs=83.8

Q ss_pred             ccccEEEeCCCchHHHHHHHHH-HHHhCCCceEEeeCCCCCcccccccCeEEEEeccCCCCCCCCcHHHHHHHHhhCCCC
Q psy8996           6 KREPAFSISEVHYANNYTTESE-VHYANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRIG   84 (95)
Q Consensus         6 ~~~~~~ygS~tG~ae~~A~~l~-~~~~~g~~~~v~~l~~~~~~~l~~~~~vi~v~ST~G~Ge~Pdn~~~F~~~L~~~~~~   84 (95)
                      ++++|+||||||||+++|++|. ++.++|+++.|++|++||+.+|.+.+++||||||+|+|++|+|++.||++|..+++|
T Consensus         1 ~~i~ILYGSqTGtA~dvAe~l~Re~~r~~~~~~V~s~Deyd~~~ll~~~~vvFVcSTTGqGe~P~Nmk~~WrfL~rknLp   80 (574)
T KOG1159|consen    1 MKILILYGSQTGTAQDVAESLGREAHRRGLQCLVMSMDEYDVEKLLDERLVVFVCSTTGQGEEPDNMKKFWRFLLRKNLP   80 (574)
T ss_pred             CceEEEeecCcccHHHHHHHHHHHHHhccCCceEeeccccCHhHhccCceEEEEEecCCCCCCCccHHHHHHHHhhccch
Confidence            3678999999999999999995 578899999999999999999999999999999999999999999999999999999


Q ss_pred             CccccCCCc
Q psy8996          85 EDANNSIST   93 (95)
Q Consensus        85 ~~~l~~l~~   93 (95)
                      +++|+||+.
T Consensus        81 s~~L~~~~~   89 (574)
T KOG1159|consen   81 STILQHMQF   89 (574)
T ss_pred             HHHHhhhhh
Confidence            999999975

>PRK08105 flavodoxin; Provisional Back     alignment and domain information
>PRK09004 FMN-binding protein MioC; Provisional Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information
>PRK05723 flavodoxin; Provisional Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component Back     alignment and domain information
>PF00258 Flavodoxin_1: Flavodoxin; InterPro: IPR008254 This domain is found in a number of proteins including flavodoxin and nitric-oxide synthase Back     alignment and domain information
>PRK07308 flavodoxin; Validated Back     alignment and domain information
>PRK12359 flavodoxin FldB; Provisional Back     alignment and domain information
>PRK06703 flavodoxin; Provisional Back     alignment and domain information
>COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01753 flav_short flavodoxin, short chain Back     alignment and domain information
>PRK09271 flavodoxin; Provisional Back     alignment and domain information
>TIGR01752 flav_long flavodoxin, long chain Back     alignment and domain information
>COG0716 FldA Flavodoxins [Energy production and conversion] Back     alignment and domain information
>PRK06756 flavodoxin; Provisional Back     alignment and domain information
>TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative Back     alignment and domain information
>PRK09267 flavodoxin FldA; Validated Back     alignment and domain information
>PRK05568 flavodoxin; Provisional Back     alignment and domain information
>PRK05569 flavodoxin; Provisional Back     alignment and domain information
>TIGR00333 nrdI ribonucleoside-diphosphate reductase 2, operon protein nrdI Back     alignment and domain information
>KOG1158|consensus Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PRK11104 hemG protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK02551 flavoprotein NrdI; Provisional Back     alignment and domain information
>KOG1160|consensus Back     alignment and domain information
>PRK06242 flavodoxin; Provisional Back     alignment and domain information
>TIGR01755 flav_wrbA NAD(P)H:quinone oxidoreductase, type IV Back     alignment and domain information
>PRK03767 NAD(P)H:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK03600 nrdI ribonucleotide reductase stimulatory protein; Reviewed Back     alignment and domain information
>PF12724 Flavodoxin_5: Flavodoxin domain Back     alignment and domain information
>PF12641 Flavodoxin_3: Flavodoxin domain Back     alignment and domain information
>PRK07116 flavodoxin; Provisional Back     alignment and domain information
>PF07972 Flavodoxin_NdrI: NrdI Flavodoxin like ; InterPro: IPR004465 Ribonucleotide reductases (RNRs) are enzymes that provide the precursors of DNA synthesis Back     alignment and domain information
>COG4635 HemG Flavodoxin [Energy production and conversion / Coenzyme metabolism] Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>PF12682 Flavodoxin_4: Flavodoxin; PDB: 3EDO_B 3KLB_A Back     alignment and domain information
>COG1780 NrdI Protein involved in ribonucleotide reduction [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06934 flavodoxin; Provisional Back     alignment and domain information
>TIGR03567 FMN_reduc_SsuE FMN reductase, SsuE family Back     alignment and domain information
>PRK10569 NAD(P)H-dependent FMN reductase; Provisional Back     alignment and domain information
>TIGR03566 FMN_reduc_MsuE FMN reductase, MsuE subfamily Back     alignment and domain information
>COG0655 WrbA Multimeric flavodoxin WrbA [General function prediction only] Back     alignment and domain information
>PRK00170 azoreductase; Reviewed Back     alignment and domain information
>PRK01355 azoreductase; Reviewed Back     alignment and domain information
>PRK09739 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02690 resist_ArsH arsenical resistance protein ArsH Back     alignment and domain information
>PF02525 Flavodoxin_2: Flavodoxin-like fold; InterPro: IPR003680 This family consists of a domain with a flavodoxin-like fold Back     alignment and domain information
>PRK13556 azoreductase; Provisional Back     alignment and domain information
>KOG3135|consensus Back     alignment and domain information
>cd05566 PTS_IIB_galactitol PTS_IIB_galactitol: subunit IIB of enzyme II (EII) of the galactitol-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>COG0431 Predicted flavoprotein [General function prediction only] Back     alignment and domain information
>PF09651 Cas_APE2256: CRISPR-associated protein (Cas_APE2256); InterPro: IPR013442 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes [] Back     alignment and domain information
>PF06283 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A Back     alignment and domain information
>cd05568 PTS_IIB_bgl_like PTS_IIB_bgl_like: the PTS (phosphotransferase system) IIB domain of a family of sensory systems composed of a membrane-bound sugar-sensor (similar to BglF) and a transcription antiterminator (similar to BglG) which regulate expression of genes involved in sugar utilization Back     alignment and domain information
>TIGR00829 FRU PTS system, fructose-specific, IIB component Back     alignment and domain information
>cd03142 GATase1_ThuA Type 1 glutamine amidotransferase (GATase1)-like domain found in Sinorhizobium meliloti Rm1021 ThuA (SmThuA) Back     alignment and domain information
>cd05014 SIS_Kpsf KpsF-like protein Back     alignment and domain information
>cd05569 PTS_IIB_fructose PTS_IIB_fructose: subunit IIB of enzyme II (EII) of the fructose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PRK10427 putative PTS system fructose-like transporter subunit EIIB; Provisional Back     alignment and domain information
>cd05567 PTS_IIB_mannitol PTS_IIB_mannitol: subunit IIB of enzyme II (EII) of the mannitol-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>cd00133 PTS_IIB PTS_IIB: subunit IIB of enzyme II (EII) is the central energy-coupling domain of the phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
1tll_A 688 Crystal Structure Of Rat Neuronal Nitric-Oxide Synt 1e-11
3hr4_A219 Human Inos Reductase And Calmodulin Complex Length 3e-09
>pdb|1TLL|A Chain A, Crystal Structure Of Rat Neuronal Nitric-Oxide Synthase Reductase Module At 2.3 A Resolution. Length = 688 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/53 (50%), Positives = 39/53 (73%)
Query: 30 YANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALR 82
          + + +  + + M+EYD+  +EHEAL+LVV STFGNGDPPENG++F   L  +R
Sbjct: 36 FKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMR 88
>pdb|3HR4|A Chain A, Human Inos Reductase And Calmodulin Complex Length = 219 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
3hr4_A219 Nitric oxide synthase, inducible; inducible nitric 4e-15
1ykg_A167 SIR-FP, sulfite reductase [NADPH] flavoprotein alp 3e-14
1tll_A 688 Nitric-oxide synthase, brain; reductase module, FM 7e-13
2hna_A147 Protein MIOC, flavodoxin; alpha-beta sandwich, fla 2e-11
3qe2_A 618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 2e-10
2bpo_A 682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 6e-10
1bvy_F191 Protein (cytochrome P450 BM-3); fatty acid monooxy 3e-08
1f4p_A147 Flavodoxin; electron transport, flavoprotein, FMN, 8e-07
3f6r_A148 Flavodoxin; FMN binding, oxidized, electron transp 1e-05
2fcr_A173 Flavodoxin; electron transport; HET: FMN; 1.80A {C 2e-04
1obo_A169 Flavodoxin; electron transfer, flavoprotein, elect 2e-04
1ag9_A175 Flavodoxin; electron transport, reductive activati 2e-04
2wc1_A182 Flavodoxin; electron transport, flavoprotein; HET: 3e-04
1yob_A179 Flavodoxin 2, flavodoxin II; alpha-beta fold, non- 5e-04
1czn_A169 Flavodoxin; FMN binding, redox potential, electron 5e-04
>3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, alternative splicing, calcium, calmodulin-binding, FAD, FMN, heme, iron, metal-binding; HET: FMN; 2.50A {Homo sapiens} Length = 219 Back     alignment and structure
 Score = 66.4 bits (162), Expect = 4e-15
 Identities = 23/49 (46%), Positives = 35/49 (71%)

Query: 34  YTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALR 82
           +  +V+ MD+Y +S +E E L+LVV STFGNGD P NG++  ++L  L+
Sbjct: 69  FNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPGNGEKLKKSLFMLK 117
>1ykg_A SIR-FP, sulfite reductase [NADPH] flavoprotein alpha- component; electron transport; HET: FMN; NMR {Escherichia coli} SCOP: c.23.5.2 Length = 167 Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Length = 688 Back     alignment and structure
>2hna_A Protein MIOC, flavodoxin; alpha-beta sandwich, flavodoxin fold, electron transport; NMR {Escherichia coli} PDB: 2hnb_A Length = 147 Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Length = 618 Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Length = 682 Back     alignment and structure
>1bvy_F Protein (cytochrome P450 BM-3); fatty acid monooxygenase, hemoprotein, flavoprotein, electron transfer, oxidoreductase; HET: HEM FMN; 2.03A {Bacillus megaterium} SCOP: c.23.5.1 Length = 191 Back     alignment and structure
>1f4p_A Flavodoxin; electron transport, flavoprotein, FMN, 3D-STRCTURE, anisotropic refinement, redox protein; HET: FMN; 1.30A {Desulfovibrio vulgaris} SCOP: c.23.5.1 PDB: 1bu5_A* 1c7f_A* 1c7e_A* 1akr_A* 1fx1_A* 1akt_A* 1akq_A* 1aku_A* 1akv_A* 1azl_A* 1j8q_A* 2fx2_A* 3fx2_A* 4fx2_A* 5fx2_A* 1akw_A* 1i1o_A* 1wsw_A* 1wsb_A* 1xyv_A* ... Length = 147 Back     alignment and structure
>3f6r_A Flavodoxin; FMN binding, oxidized, electron transport, flavoprotein, FMN, transport; HET: FMN; 2.00A {Desulfovibrio desulfuricans} PDB: 3f6s_A* 3f90_A* 3kap_A* 3kaq_A* Length = 148 Back     alignment and structure
>2fcr_A Flavodoxin; electron transport; HET: FMN; 1.80A {Chondrus crispus} SCOP: c.23.5.1 Length = 173 Back     alignment and structure
>1obo_A Flavodoxin; electron transfer, flavoprotein, electron transport; HET: FMN; 1.2A {Anabaena SP} SCOP: c.23.5.1 PDB: 2v5v_A* 1dx9_A 1rcf_A* 1flv_A* 1obv_A* 2v5u_A* 1ftg_A 1qhe_A 2kqu_A 3esy_A* 3esz_A* 3esx_A* Length = 169 Back     alignment and structure
>1ag9_A Flavodoxin; electron transport, reductive activation; HET: FMN BTB; 1.80A {Escherichia coli} SCOP: c.23.5.1 PDB: 1ahn_A* Length = 175 Back     alignment and structure
>2wc1_A Flavodoxin; electron transport, flavoprotein; HET: FMN; 2.17A {Rhodobacter capsulatus} Length = 182 Back     alignment and structure
>1yob_A Flavodoxin 2, flavodoxin II; alpha-beta fold, non- covalently bound FMN, electron transport; HET: FMN; 2.25A {Azotobacter vinelandii} SCOP: c.23.5.1 Length = 179 Back     alignment and structure
>1czn_A Flavodoxin; FMN binding, redox potential, electron transport; HET: FMN; 1.70A {Synechococcus elongatus} SCOP: c.23.5.1 PDB: 1czl_A* 1czu_A* 1d04_A* 1ofv_A* 1czr_A* 1czk_A* 1czo_A* 1czh_A* 1d03_A* Length = 169 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
3hr4_A219 Nitric oxide synthase, inducible; inducible nitric 99.91
1tll_A 688 Nitric-oxide synthase, brain; reductase module, FM 99.88
3qe2_A 618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 99.83
2bpo_A 682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 99.81
1bvy_F191 Protein (cytochrome P450 BM-3); fatty acid monooxy 99.79
1ykg_A167 SIR-FP, sulfite reductase [NADPH] flavoprotein alp 99.77
3f6r_A148 Flavodoxin; FMN binding, oxidized, electron transp 99.75
2hna_A147 Protein MIOC, flavodoxin; alpha-beta sandwich, fla 99.75
5nul_A138 Flavodoxin; electron transport, flavoprotein, FMN; 99.74
1yob_A179 Flavodoxin 2, flavodoxin II; alpha-beta fold, non- 99.72
2bmv_A164 Flavodoxin; electron transport, flavoprotein, FMN, 99.71
1czn_A169 Flavodoxin; FMN binding, redox potential, electron 99.7
1obo_A169 Flavodoxin; electron transfer, flavoprotein, elect 99.69
1f4p_A147 Flavodoxin; electron transport, flavoprotein, FMN, 99.69
2fcr_A173 Flavodoxin; electron transport; HET: FMN; 1.80A {C 99.68
2wc1_A182 Flavodoxin; electron transport, flavoprotein; HET: 99.68
1ag9_A175 Flavodoxin; electron transport, reductive activati 99.68
2fz5_A137 Flavodoxin; alpha/beta doubly-wound topology, non- 99.64
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 99.55
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 99.53
2xod_A119 NRDI protein, NRDI; flavoprotein, redox protein, r 99.46
1rlj_A139 NRDI protein; flavoprotein, FMN, thioredoxin, alph 99.41
2ark_A188 Flavodoxin; FMN, structural genomics, PSI, structu 99.35
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.24
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.18
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactama 99.15
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 99.15
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like doma 99.13
4dik_A410 Flavoprotein; TM0755, electron transport, DI-iron 99.11
3b6i_A198 Flavoprotein WRBA; flavoproteins, NADH:quinone oxi 99.09
2zki_A199 199AA long hypothetical Trp repressor binding prot 99.0
4ici_A171 Putative flavoprotein; PF12682 family protein, fla 99.0
3d7n_A193 Flavodoxin, WRBA-like protein; structural genomics 98.98
3edo_A151 Flavoprotein, putative Trp repressor binding prote 98.98
3klb_A162 Putative flavoprotein; structural genomi center fo 98.96
1ydg_A211 Trp repressor binding protein WRBA; tetramer, stru 98.91
3n3a_C153 Protein NRDI; ribonucleotide reductase, four-helix 98.91
2vzf_A197 NADH-dependent FMN reductase; oxidoreductase; 2.50 98.71
1rtt_A193 Conserved hypothetical protein; protein structure 98.4
1t5b_A201 Acyl carrier protein phosphodiesterase; structural 98.34
3gfs_A174 FMN-dependent NADPH-azoreductase; flavoproteins, q 98.33
1t0i_A191 YLR011WP; FMN binding protein, flavodoxin, azoredu 98.26
2q62_A 247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 98.22
3fvw_A192 Putative NAD(P)H-dependent FMN reductase; Q8DWD8_s 98.19
1sqs_A 242 Conserved hypothetical protein; structural genomic 98.1
1rli_A184 Trp repressor binding protein; structural genomics 98.06
2fzv_A 279 Putative arsenical resistance protein; flavin bind 98.0
4hs4_A199 Chromate reductase; triple-layered, A/B/A structur 97.86
2hpv_A208 FMN-dependent NADH-azoreductase; structural genomi 97.85
3s2y_A199 Chromate reductase; uranium reductase, oxidoreduct 96.84
3u7r_A190 NADPH-dependent FMN reductase; alpha/beta twisted 97.62
3r6w_A212 FMN-dependent NADH-azoreductase 1; nitrofurazone, 97.43
3svl_A193 Protein YIEF; E. coli CHRR enzyme, chromate biorem 97.25
1d4a_A 273 DT-diaphorase, quinone reductase; flavoprotein, ro 97.2
3lcm_A196 SMU.1420, putative oxidoreductase; NADPH:quinone o 97.15
3k1y_A191 Oxidoreductase; structural genomics, PSI-2, protei 97.14
3f2v_A192 General stress protein 14; alpha-beta protein., st 96.93
3rpe_A218 MDAB, modulator of drug activity B; structural gen 96.92
3tem_A228 Ribosyldihydronicotinamide dehydrogenase [quinone; 96.92
2amj_A204 Modulator of drug activity B; oxidoreductase, mena 96.86
3p0r_A211 Azoreductase; structural genomics, center for stru 96.16
3u7i_A223 FMN-dependent NADH-azoreductase 1; structural geno 95.39
4gi5_A 280 Quinone reductase; protein structure initiative, F 93.94
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 93.46
3ha2_A177 NADPH-quinone reductase; structural genomics, PSI- 92.33
1tvm_A113 PTS system, galactitol-specific IIB component; pho 89.21
1t0b_A 252 THUA-like protein; trehalose metabolism, NCS symme 88.95
3rht_A 259 (gatase1)-like protein; structural genomics, PSI-b 85.81
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_ 84.97
1jeo_A180 MJ1247, hypothetical protein MJ1247; RUMP pathway, 83.38
4e5v_A 281 Putative THUA-like protein; THUA-like proteins, tr 82.47
>3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, CALM binding, FAD, FMN, heme, iron, metal-binding, NADP, oxidore phosphoprotein; HET: FMN; 2.50A {Homo sapiens} Back     alignment and structure
Probab=99.91  E-value=1.5e-24  Score=151.25  Aligned_cols=77  Identities=32%  Similarity=0.537  Sum_probs=72.6

Q ss_pred             cccccEEEeCCCchHHHHHHHHHHHHhCCCceEEeeCCCCCcccccccCeEEEEeccCCCCCCCCcHHHHHHHHhhC
Q psy8996           5 EKREPAFSISEVHYANNYTTESEVHYANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHAL   81 (95)
Q Consensus         5 ~~~~~~~ygS~tG~ae~~A~~l~~~~~~g~~~~v~~l~~~~~~~l~~~~~vi~v~ST~G~Ge~Pdn~~~F~~~L~~~   81 (95)
                      ++++.|+|||+|||||.+|++|++.+.+|+.+++.+|+++++++|..++.+||+|||||+|+||+|++.||++|...
T Consensus        40 ~~kv~IlYgS~tGnte~~A~~La~~l~~g~~v~v~~l~~~~~~~l~~~~~vI~~tsTyG~Ge~Pdna~~F~~~L~~~  116 (219)
T 3hr4_A           40 RVRVTILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPGNGEKLKKSLFML  116 (219)
T ss_dssp             SCEEEEEEECSSSHHHHHHHHHHHHHTTTSEEEEEEGGGCCGGGGGTCSEEEEEEECBTTTBCCGGGHHHHHHHHHC
T ss_pred             CCcEEEEEECCchHHHHHHHHHHHHHHcCCCeEEEEcccCCHhHhccCCeEEEEEeccCCCcCCHHHHHHHHHHHhc
Confidence            56889999999999999999998866789999999999999999999999999999999999999999999999875
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Back     alignment and structure
>1bvy_F Protein (cytochrome P450 BM-3); fatty acid monooxygenase, hemoprotein, flavoprotein, electron transfer, oxidoreductase; HET: HEM FMN; 2.03A {Bacillus megaterium} SCOP: c.23.5.1 Back     alignment and structure
>1ykg_A SIR-FP, sulfite reductase [NADPH] flavoprotein alpha- component; electron transport; HET: FMN; NMR {Escherichia coli} SCOP: c.23.5.2 Back     alignment and structure
>3f6r_A Flavodoxin; FMN binding, oxidized, electron transport, flavoprotein, FMN, transport; HET: FMN; 2.00A {Desulfovibrio desulfuricans} SCOP: c.23.5.0 PDB: 3f6s_A* 3f90_A* 3kap_A* 3kaq_A* Back     alignment and structure
>2hna_A Protein MIOC, flavodoxin; alpha-beta sandwich, flavodoxin fold, electron transport; NMR {Escherichia coli} PDB: 2hnb_A Back     alignment and structure
>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* Back     alignment and structure
>1yob_A Flavodoxin 2, flavodoxin II; alpha-beta fold, non- covalently bound FMN, electron transport; HET: FMN; 2.25A {Azotobacter vinelandii} SCOP: c.23.5.1 Back     alignment and structure
>2bmv_A Flavodoxin; electron transport, flavoprotein, FMN, transport protein; 2.11A {Helicobacter pylori} PDB: 2w5u_A* 1fue_A* Back     alignment and structure
>1czn_A Flavodoxin; FMN binding, redox potential, electron transport; HET: FMN; 1.70A {Synechococcus elongatus} SCOP: c.23.5.1 PDB: 1czl_A* 1czu_A* 1d04_A* 1ofv_A* 1czr_A* 1czk_A* 1czo_A* 1czh_A* 1d03_A* Back     alignment and structure
>1obo_A Flavodoxin; electron transfer, flavoprotein, electron transport; HET: FMN; 1.2A {Anabaena SP} SCOP: c.23.5.1 PDB: 2v5v_A* 1dx9_A 1rcf_A* 1flv_A* 1obv_A* 2v5u_A* 1ftg_A 1qhe_A 2kqu_A 3esy_A* 3esz_A* 3esx_A* Back     alignment and structure
>1f4p_A Flavodoxin; electron transport, flavoprotein, FMN, 3D-STRCTURE, anisotropic refinement, redox protein; HET: FMN; 1.30A {Desulfovibrio vulgaris} SCOP: c.23.5.1 PDB: 1bu5_A* 1c7f_A* 1c7e_A* 1akr_A* 1fx1_A* 1akt_A* 1akq_A* 1aku_A* 1akv_A* 1azl_A* 1j8q_A* 2fx2_A* 3fx2_A* 4fx2_A* 5fx2_A* 1akw_A* 1i1o_A* 1wsw_A* 1wsb_A* 1xyv_A* ... Back     alignment and structure
>2fcr_A Flavodoxin; electron transport; HET: FMN; 1.80A {Chondrus crispus} SCOP: c.23.5.1 Back     alignment and structure
>2wc1_A Flavodoxin; electron transport, flavoprotein; HET: FMN; 2.17A {Rhodobacter capsulatus} Back     alignment and structure
>1ag9_A Flavodoxin; electron transport, reductive activation; HET: FMN BTB; 1.80A {Escherichia coli} SCOP: c.23.5.1 PDB: 1ahn_A* Back     alignment and structure
>2fz5_A Flavodoxin; alpha/beta doubly-wound topology, non-covalently bound FMN, electron transport; HET: FNR; NMR {Megasphaera elsdenii} SCOP: c.23.5.1 Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>2xod_A NRDI protein, NRDI; flavoprotein, redox protein, ribonucleotide reductase; HET: FMN; 0.96A {Bacillus anthracis} PDB: 2xoe_A* 2x2o_A* 2x2p_A* Back     alignment and structure
>1rlj_A NRDI protein; flavoprotein, FMN, thioredoxin, alpha/beta/alpha sandwich, structural genomics, PSI, protein structure initiative; HET: FMN; 2.00A {Bacillus subtilis} SCOP: c.23.5.7 Back     alignment and structure
>2ark_A Flavodoxin; FMN, structural genomics, PSI, structure initiative, midwest center for structural genomic electron transport; 2.40A {Aquifex aeolicus} SCOP: c.23.5.8 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>4ici_A Putative flavoprotein; PF12682 family protein, flavodoxin_4, structural genomics, J center for structural genomics, JCSG; HET: MSE FMN EPE; 1.40A {Bacteroides eggerthii} Back     alignment and structure
>3d7n_A Flavodoxin, WRBA-like protein; structural genomics, PSI, MCS protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens} Back     alignment and structure
>3edo_A Flavoprotein, putative Trp repressor binding protein; YP_193882.1, flavoprotein in complex with FMN, structural genomics; HET: MSE FMN; 1.20A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3klb_A Putative flavoprotein; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: FMN; 1.75A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* Back     alignment and structure
>3n3a_C Protein NRDI; ribonucleotide reductase, four-helix bundle, dimanganese CLU flavoprotein, oxidoreductase; HET: FMN; 1.99A {Escherichia coli} PDB: 3n39_C* 3n3b_C* Back     alignment and structure
>2vzf_A NADH-dependent FMN reductase; oxidoreductase; 2.50A {Edta-degrading bacterium BNC1} PDB: 2vzh_A* 2vzj_A* Back     alignment and structure
>1rtt_A Conserved hypothetical protein; protein structure initiative, SAD with sulfur, putative REDU PSI; 1.28A {Pseudomonas aeruginosa} SCOP: c.23.5.4 PDB: 1x77_A* Back     alignment and structure
>1t5b_A Acyl carrier protein phosphodiesterase; structural genomics, FMN, alpha/beta/alpha sandwich, PSI, protein structure initiative; HET: FMN; 1.40A {Salmonella typhimurium} SCOP: c.23.5.3 PDB: 1tik_A 2z98_A* 2d5i_A* 1v4b_A* 2z9b_A* 2z9c_A* 2z9d_A* Back     alignment and structure
>3gfs_A FMN-dependent NADPH-azoreductase; flavoproteins, quinone reductase, flavodoxin, oligomerization, flavoprotein, oxidoreductase; HET: FMN; 2.10A {Bacillus subtilis} SCOP: c.23.5.4 PDB: 1nni_1* 2gsw_A* 3gfr_A* 3gfq_A* Back     alignment and structure
>1t0i_A YLR011WP; FMN binding protein, flavodoxin, azoreductase, oxidoreductase; HET: FMN; 2.00A {Saccharomyces cerevisiae} SCOP: c.23.5.4 Back     alignment and structure
>2q62_A ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>3fvw_A Putative NAD(P)H-dependent FMN reductase; Q8DWD8_strmu, SMR99, NESG, structural genomics, PSI-2, protein structure initiative; 2.30A {Streptococcus mutans} Back     alignment and structure
>1sqs_A Conserved hypothetical protein; structural genomics, alpha beta protein, PSI, protein struct initiative; HET: TLA; 1.50A {Streptococcus pneumoniae} SCOP: c.23.5.5 PDB: 2oys_A* Back     alignment and structure
>1rli_A Trp repressor binding protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.80A {Bacillus subtilis} SCOP: c.23.5.6 Back     alignment and structure
>2fzv_A Putative arsenical resistance protein; flavin binding protein, structural genomics, PSI, protein ST initiative; 1.70A {Shigella flexneri 2A} SCOP: c.23.5.4 Back     alignment and structure
>4hs4_A Chromate reductase; triple-layered, A/B/A structure, NAD(P)H-dependent FMN reduc oxidoreductase; HET: FMN; 2.10A {Gluconacetobacter hansenii} PDB: 3s2y_A* 4h6p_A* Back     alignment and structure
>2hpv_A FMN-dependent NADH-azoreductase; structural genomics, PS protein structure initiative, southeast collaboratory for S genomics, secsg; HET: FMN; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3s2y_A Chromate reductase; uranium reductase, oxidoreductase; HET: FMN PG4; 2.24A {Gluconacetobacter hansenii} Back     alignment and structure
>3u7r_A NADPH-dependent FMN reductase; alpha/beta twisted open-sheet, lavoprotein, quinone reductas oxidoreductase; HET: MSE FNR 2PE; 1.40A {Paracoccus denitrificans} Back     alignment and structure
>3r6w_A FMN-dependent NADH-azoreductase 1; nitrofurazone, P. aeruginosa, nitroreductase, flavodoxin, oxidoreductase; HET: FMN NFZ; 2.08A {Pseudomonas aeruginosa} PDB: 3lt5_A* 2v9c_A* 3keg_A* Back     alignment and structure
>3svl_A Protein YIEF; E. coli CHRR enzyme, chromate bioremediation, tetramer role, mutant enzymes, oxidoreductase; HET: FMN; 2.20A {Escherichia coli} Back     alignment and structure
>1d4a_A DT-diaphorase, quinone reductase; flavoprotein, rossman fold, oxidoreductase; HET: FAD; 1.70A {Homo sapiens} SCOP: c.23.5.3 PDB: 1dxo_A* 1gg5_A* 1kbo_A* 1kbq_A* 2f1o_A* 3jsx_A* 1h69_A* 1h66_A* 1qbg_A* 1dxq_A* 1qrd_A* Back     alignment and structure
>3lcm_A SMU.1420, putative oxidoreductase; NADPH:quinone oxidoreductase, MDAB; HET: FAD NAP; 1.80A {Streptococcus mutans} PDB: 4f8y_A* Back     alignment and structure
>3k1y_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, CDR100D; 2.50A {Corynebacterium diphtheriae} PDB: 3k20_A Back     alignment and structure
>3f2v_A General stress protein 14; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: FMN; 2.00A {Treponema denticola} Back     alignment and structure
>3rpe_A MDAB, modulator of drug activity B; structural genomics, center for structural genomics of infec diseases, csgid, flavodoxin-like fold; HET: FAD; 1.10A {Yersinia pestis} Back     alignment and structure
>3tem_A Ribosyldihydronicotinamide dehydrogenase [quinone; oxidoreductase-oxidoreductase inhibitor complex; HET: FAD 6A1 IMD; 1.45A {Homo sapiens} SCOP: c.23.5.3 PDB: 3te7_A* 3tzb_A* 3fw1_A* 2qwx_A* 1zx1_A* 3g5m_A* 3gam_A* 3ovm_A* 3owh_A* 3owx_A* 3ox1_A* 3ox2_A* 3ox3_A* 1sg0_A* 1qr2_A* 1xi2_A* 2qmy_A* 2qmz_A* 2qr2_A* 2qx4_A* ... Back     alignment and structure
>2amj_A Modulator of drug activity B; oxidoreductase, menadione, DT-diaphorase, montreal-kingston structural genomics initiative, BSGI; 1.80A {Escherichia coli} PDB: 2b3d_A* Back     alignment and structure
>3p0r_A Azoreductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 1.80A {Bacillus anthracis} Back     alignment and structure
>3u7i_A FMN-dependent NADH-azoreductase 1; structural genomics, the center for structural genomics of I diseases, csgid, oxidoreductase; HET: MSE; 1.75A {Bacillus anthracis} Back     alignment and structure
>4gi5_A Quinone reductase; protein structure initiative, FAD bound, structural genomics, PSI-biology; HET: FAD; 1.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3ha2_A NADPH-quinone reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics, consortium, NESG; HET: MSE; 1.80A {Pediococcus pentosaceus atcc 25745} Back     alignment and structure
>1tvm_A PTS system, galactitol-specific IIB component; phosphotransferase system (PTS), P-loop; NMR {Escherichia coli} Back     alignment and structure
>1t0b_A THUA-like protein; trehalose metabolism, NCS symmetry, structural genomics, PSI, protein structure initiative; 1.70A {Geobacillus stearothermophilus} SCOP: c.23.16.6 Back     alignment and structure
>3rht_A (gatase1)-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.83A {Planctomyces limnophilus} Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure
>1jeo_A MJ1247, hypothetical protein MJ1247; RUMP pathway, phosphosugar, 3-hexulose-6-phosphate isomerase structural genomics; HET: CME CIT; 2.00A {Methanocaldococcus jannaschii} SCOP: c.80.1.3 Back     alignment and structure
>4e5v_A Putative THUA-like protein; THUA-like proteins, trehalose utilisation, structural genomi center for structural genomics, JCSG; 1.75A {Parabacteroides merdae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 95
d1tlla2 202 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FM 3e-07
d1yoba1179 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelan 3e-06
d1oboa_169 c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7 3e-05
d2fcra_173 c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 3e-05
d1czna_169 c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus 4e-05
d1fuea_163 c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [Tax 2e-04
d1ykga1146 c.23.5.2 (A:63-208) Sulfite reductase alpha-compon 2e-04
d1ja1a2177 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductas 5e-04
d1ag9a_175 c.23.5.1 (A:) Flavodoxin {Escherichia coli [TaxId: 6e-04
>d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 202 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: Cytochrome p450 reductase N-terminal domain-like
domain: Nitric oxide (NO) synthase FMN domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 43.7 bits (102), Expect = 3e-07
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 31 ANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRIGEDANNS 90
           + +  + + M+EYD+  +EHEAL+LVV STFGNGDPPENG++F   L  +R        
Sbjct: 29 KHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEE 88

Query: 91 IST 93
            +
Sbjct: 89 RKS 91
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} Length = 179 Back     information, alignment and structure
>d1oboa_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} Length = 169 Back     information, alignment and structure
>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]} Length = 173 Back     information, alignment and structure
>d1czna_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]} Length = 169 Back     information, alignment and structure
>d1fuea_ c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [TaxId: 210]} Length = 163 Back     information, alignment and structure
>d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1ja1a2 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 Back     information, alignment and structure
>d1ag9a_ c.23.5.1 (A:) Flavodoxin {Escherichia coli [TaxId: 562]} Length = 175 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
d1ykga1146 Sulfite reductase alpha-component CysJ N-terminal 99.94
d1tlla2 202 Nitric oxide (NO) synthase FMN domain {Rat (Rattus 99.92
d1ja1a2177 NADPH-cytochrome p450 reductase, N-terminal domain 99.91
d1czna_169 Flavodoxin {Synechococcus elongatus PCC 7942 [TaxI 99.89
d1ag9a_175 Flavodoxin {Escherichia coli [TaxId: 562]} 99.87
d2fcra_173 Flavodoxin {Chondrus crispus [TaxId: 2769]} 99.87
d1oboa_169 Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 11 99.87
d1yoba1179 Flavodoxin {Azotobacter vinelandii [TaxId: 354]} 99.86
d1fuea_163 Flavodoxin {Helicobacter pylori [TaxId: 210]} 99.85
d1bvyf_152 FMN-binding domain of the cytochrome P450bm-3 {Bac 99.85
d1f4pa_147 Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} 99.83
d2fz5a1137 Flavodoxin {Megasphaera elsdenii [TaxId: 907]} 99.75
d1rlja_135 Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423] 99.74
d5nula_138 Flavodoxin {Clostridium beijerinckii [TaxId: 1520] 99.73
d1vmea1148 ROO-like flavoprotein TM0755, C-terminal domain {T 99.62
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 99.57
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 99.57
d2arka1184 Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} 99.37
d2a5la1196 Trp repressor binding protein WrbA {Pseudomonas ae 99.14
d1ydga_201 Trp repressor binding protein WrbA {Deinococcus ra 99.03
d1rlia_179 Hypothetical protein YwqN {Bacillus subtilis [TaxI 97.91
d2fzva1233 Putative arsenical resistance protein {Shigella fl 97.9
d1nni1_171 Azobenzene reductase {Bacillus subtilis [TaxId: 14 97.48
d1t0ia_185 Hypothetical protein Ylr011wp {Baker's yeast (Sacc 97.45
d1sqsa_ 232 Hypothetical protein SP1951 {(Streptococcus pneumo 97.27
d1rtta_174 Hypothetical protein PA1204 {Pseudomonas aeruginos 97.06
d2qwxa1230 Quinone reductase type 2 (menadione reductase) {Hu 97.0
d1d4aa_ 273 NAD(P)H:quinone reductase {Human (Homo sapiens) [T 96.83
d2z98a1200 ACP phosphodiesterase AcpD {Escherichia coli [TaxI 93.5
d2a9va1 196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 90.18
d3eeqa2 207 Cobalamin biosynthesis protein G, CbiG {Sulfolobus 85.42
d1vima_192 Hypothetical protein AF1796 {Archaeon Archaeoglobu 85.24
d1m3sa_186 Hypothetical protein YckF {Bacillus subtilis [TaxI 84.83
d1ka9h_ 195 GAT subunit, HisH, (or domain) of imidazoleglycero 82.34
>d1ykga1 c.23.5.2 (A:63-208) Sulfite reductase alpha-component CysJ N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Flavoproteins
family: Cytochrome p450 reductase N-terminal domain-like
domain: Sulfite reductase alpha-component CysJ N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=99.94  E-value=2.7e-27  Score=154.58  Aligned_cols=83  Identities=22%  Similarity=0.323  Sum_probs=74.5

Q ss_pred             ccEEEeCCCchHHHHHHHHHH-HHhCCCceEEeeCCCCCcccccccCeEEEEeccCCCCCCCCcHHHHHHHHhhCCCCCc
Q psy8996           8 EPAFSISEVHYANNYTTESEV-HYANNYTTEVLRMDEYDMSSIEHEALILVVASTFGNGDPPENGQEFAQNLHALRIGED   86 (95)
Q Consensus         8 ~~~~ygS~tG~ae~~A~~l~~-~~~~g~~~~v~~l~~~~~~~l~~~~~vi~v~ST~G~Ge~Pdn~~~F~~~L~~~~~~~~   86 (95)
                      +.|+|||+|||||++|++|++ +..+|+++++.+|+++++.+|.+++.+||+|||||+|++|+|+++||++|.+...|  
T Consensus         1 I~I~ygS~tGnae~~A~~l~~~l~~~g~~~~~~~~~~~~~~~l~~~~~~i~~~sT~g~G~~P~~~~~f~~~l~~~~~~--   78 (146)
T d1ykga1           1 ITIISASQTGNARRVAEALRDDLLAAKLNVKLVNAGDYKFKQIASEKLLIVVTSTQGEGEPPEEAVALHKFLFSKKAP--   78 (146)
T ss_dssp             CEEEEECSSSHHHHHHHHHHHHHHHHTCCCEEEEGGGCCGGGGGGCSEEEEEEECBGGGBCCGGGHHHHHHHTSTTCC--
T ss_pred             CEEEEECCchHHHHHHHHHHHHHHHCCCCceEeeccccchhhcccccceEEEEeecCCCcCchhHHHHHHHHHccccc--
Confidence            469999999999999999986 55689999999999999999999999999999999999999999999999776554  


Q ss_pred             cccCCC
Q psy8996          87 ANNSIS   92 (95)
Q Consensus        87 ~l~~l~   92 (95)
                      .|++++
T Consensus        79 ~l~~~~   84 (146)
T d1ykga1          79 KLENTA   84 (146)
T ss_dssp             CCTTCE
T ss_pred             ccCCCe
Confidence            366654
>d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ja1a2 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1czna_ c.23.5.1 (A:) Flavodoxin {Synechococcus elongatus PCC 7942 [TaxId: 1140]} Back     information, alignment and structure
>d1ag9a_ c.23.5.1 (A:) Flavodoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]} Back     information, alignment and structure
>d1oboa_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} Back     information, alignment and structure
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1fuea_ c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1bvyf_ c.23.5.1 (F:) FMN-binding domain of the cytochrome P450bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1f4pa_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2fz5a1 c.23.5.1 (A:1-137) Flavodoxin {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1rlja_ c.23.5.7 (A:) Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d5nula_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1rlia_ c.23.5.6 (A:) Hypothetical protein YwqN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fzva1 c.23.5.4 (A:1-233) Putative arsenical resistance protein {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1nni1_ c.23.5.4 (1:) Azobenzene reductase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t0ia_ c.23.5.4 (A:) Hypothetical protein Ylr011wp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sqsa_ c.23.5.5 (A:) Hypothetical protein SP1951 {(Streptococcus pneumoniae) [TaxId: 1313]} Back     information, alignment and structure
>d1rtta_ c.23.5.4 (A:) Hypothetical protein PA1204 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2qwxa1 c.23.5.3 (A:1-230) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4aa_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z98a1 c.23.5.3 (A:1-200) ACP phosphodiesterase AcpD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d3eeqa2 c.152.1.1 (A:8-214) Cobalamin biosynthesis protein G, CbiG {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vima_ c.80.1.3 (A:) Hypothetical protein AF1796 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m3sa_ c.80.1.3 (A:) Hypothetical protein YckF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure