Psyllid ID: psy9102


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MAKTGTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCKKLTPVYEEVGEKA
cccccHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHcccccccccccEEEEEccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEcccccHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccEEEEcccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccEEEccccHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHccc
ccccccHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHcccccccccccEEEEEccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEcccHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHccccccccccEEEcccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEcccHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHcc
maktgtnyWRNRILKVAKGFADKFTFAISAKDDFQHELnefgfdyvpsdkplvfvraedgkkyamkdEFSVENLESFLTKVVagevdpyiksepvpednsgpvKVAVAKNFDEVVTNNEKDVLVefyapwcghctnYWRNRILKVAKGFADKFTFAISAKDDFQHELnefgfdyvpsdkplvfvraedgkkyamkdEFSVENLESFLTKVVagevdpyiksepvpednsgpvKVAVAKNFDEVVTNNEKDVLVEfyapwcghckkltpVYEEVGEKA
maktgtnywrnrILKVAKGFADKFTFAISAKDDFQHELNEFgfdyvpsdkPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIksepvpednsgpVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFgfdyvpsdkPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIksepvpednsgpVKVAVAKNFDEVVTNNEKDVLVEfyapwcghcKKLTPVYEEVGEKA
MAKTGTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCKKLTPVYEEVGEKA
*****TNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYI************VKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYI************VKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCKKLTPVYE******
***TGTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEV***********DNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAED*********FSVENLESFL***************************AVAKNFDEVVTNNEKDVLVEFYAPWCGHCKKLTPVYEEVGEK*
MAKTGTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCKKLTPVYEEVGEKA
****GTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCKKLTPVYEEVGEK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKTGTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCKKLTPVYEEVGEKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query277 2.2.26 [Sep-21-2011]
Q8JG64505 Protein disulfide-isomera yes N/A 0.877 0.481 0.369 1e-41
Q5RDG4505 Protein disulfide-isomera yes N/A 0.566 0.310 0.490 7e-41
P30101505 Protein disulfide-isomera yes N/A 0.566 0.310 0.490 7e-41
Q4VIT4505 Protein disulfide-isomera N/A N/A 0.566 0.310 0.490 7e-41
P38657505 Protein disulfide-isomera yes N/A 0.566 0.310 0.496 8e-41
P27773505 Protein disulfide-isomera yes N/A 0.512 0.281 0.510 9e-40
P11598505 Protein disulfide-isomera yes N/A 0.512 0.281 0.503 6e-39
P08003638 Protein disulfide-isomera no N/A 0.509 0.221 0.465 5e-32
Q29RV1643 Protein disulfide-isomera no N/A 0.509 0.219 0.458 6e-32
P38659643 Protein disulfide-isomera no N/A 0.509 0.219 0.458 2e-31
>sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 Back     alignment and function desciption
 Score =  169 bits (429), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 100/271 (36%), Positives = 150/271 (55%), Gaps = 28/271 (10%)

Query: 14  LKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVEN 73
           +K A    D + FA ++++    +  E G   V      +  + ED      +D+ +   
Sbjct: 170 MKAANNLRDNYRFAHTSEEQLVQKYEEDGEGVVLYRPSRLANKFEDSTVKYTEDKITSAK 229

Query: 74  LESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYA---PW 130
           ++ F+ + + G + P++      EDN   ++               KD+LV +Y      
Sbjct: 230 IKKFIQENIFG-ICPHMT-----EDNKDLIQ--------------GKDLLVAYYDVDYEK 269

Query: 131 CGHCTNYWRNRILKVAKGFAD---KFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAE 187
               +NYWRNR++ +AK F D   K +FA++++  F HEL+EFG D    + P+V +R  
Sbjct: 270 NAKGSNYWRNRVMMIAKKFLDAGHKLSFAVASRKTFGHELSEFGLDNSVGEAPVVAIRTA 329

Query: 188 DGKKYAMKDEFSVEN--LESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVT 245
            G K+ M++EFS +   LE FL     G +  Y+KSEPVPE+N GPVKV VA+NFDE+V 
Sbjct: 330 KGDKFVMQEEFSRDGKALERFLQDYFDGNLKKYLKSEPVPENNDGPVKVVVAENFDEIVN 389

Query: 246 NNEKDVLVEFYAPWCGHCKKLTPVYEEVGEK 276
             +KDVL+EFYAPWCGHCK L P Y+E+GEK
Sbjct: 390 AEDKDVLIEFYAPWCGHCKNLEPKYKELGEK 420





Gallus gallus (taxid: 9031)
EC: 5EC: .EC: 3EC: .EC: 4EC: .EC: 1
>sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 Back     alignment and function description
>sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 Back     alignment and function description
>sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 Back     alignment and function description
>sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 Back     alignment and function description
>sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 Back     alignment and function description
>sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 Back     alignment and function description
>sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 Back     alignment and function description
>sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 Back     alignment and function description
>sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
242015580 488 protein disulfide-isomerase A3 precursor 0.610 0.346 0.583 7e-56
359843226 486 protein disulfide-isomerase [Schistocerc 0.512 0.292 0.690 2e-54
195333539 488 GM20403 [Drosophila sechellia] gi|194125 0.610 0.346 0.580 4e-54
16648140364 GH13982p [Drosophila melanogaster] 0.610 0.464 0.574 7e-54
1699220 489 D-ERp60=protein disulphide isomerase iso 0.610 0.345 0.574 9e-54
195582552 489 ERp60 [Drosophila simulans] gi|194193100 0.610 0.345 0.574 1e-53
45551086 489 ERp60 [Drosophila melanogaster] gi|45445 0.610 0.345 0.574 1e-53
195119920 488 GI19593 [Drosophila mojavensis] gi|19390 0.610 0.346 0.585 1e-53
194755256 489 GF11803 [Drosophila ananassae] gi|190621 0.509 0.288 0.683 1e-53
198460839 489 GA24137 [Drosophila pseudoobscura pseudo 0.509 0.288 0.690 2e-53
>gi|242015580|ref|XP_002428431.1| protein disulfide-isomerase A3 precursor, putative [Pediculus humanus corporis] gi|212513043|gb|EEB15693.1| protein disulfide-isomerase A3 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  223 bits (568), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 133/180 (73%), Gaps = 11/180 (6%)

Query: 107 VAKNFDEVVTNNEKDVLVEFYAPWCG-----------HCTNYWRNRILKVAKGFADKFTF 155
           + KN+  +V +  +D L +F  P                TNYWRNRILKVA+ F + F+F
Sbjct: 229 IKKNYHGLVGHRNRDNLNDFQNPLVVAYYAVDYIKNIKGTNYWRNRILKVAQNFIEDFSF 288

Query: 156 AISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVENLESFLTKVVAGEV 215
           A+SAKDDFQHELNEFGFDYV  DKPL+F R ++ +K+ MKDEFS +N E FL  +    +
Sbjct: 289 AVSAKDDFQHELNEFGFDYVSGDKPLIFARNKNNQKFNMKDEFSADNFEKFLKDLKNDRL 348

Query: 216 DPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCKKLTPVYEEVGE 275
           +P++KSEP+P+DNSGPVKVAVAKNFD+VVTN+ +D L+EFYAPWCGHCKKL PVYEE+GE
Sbjct: 349 EPFLKSEPIPDDNSGPVKVAVAKNFDDVVTNSGRDSLIEFYAPWCGHCKKLAPVYEELGE 408




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|359843226|gb|AEV89748.1| protein disulfide-isomerase [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|195333539|ref|XP_002033448.1| GM20403 [Drosophila sechellia] gi|194125418|gb|EDW47461.1| GM20403 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|16648140|gb|AAL25335.1| GH13982p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|1699220|gb|AAB37398.1| D-ERp60=protein disulphide isomerase isoform/multifunctional endoplasmic reticulum luminal polypeptide [Drosophila melanogaster, Peptide, 489 aa] Back     alignment and taxonomy information
>gi|195582552|ref|XP_002081091.1| ERp60 [Drosophila simulans] gi|194193100|gb|EDX06676.1| ERp60 [Drosophila simulans] Back     alignment and taxonomy information
>gi|45551086|ref|NP_725084.2| ERp60 [Drosophila melanogaster] gi|45445579|gb|AAF58609.2| ERp60 [Drosophila melanogaster] gi|66804035|gb|AAY56659.1| Erp60 [Drosophila melanogaster] gi|255760072|gb|ACU32621.1| IP10683p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195119920|ref|XP_002004477.1| GI19593 [Drosophila mojavensis] gi|193909545|gb|EDW08412.1| GI19593 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|194755256|ref|XP_001959908.1| GF11803 [Drosophila ananassae] gi|190621206|gb|EDV36730.1| GF11803 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|198460839|ref|XP_002138913.1| GA24137 [Drosophila pseudoobscura pseudoobscura] gi|198137152|gb|EDY69471.1| GA24137 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
FB|FBgn0033663489 ERp60 "ERp60" [Drosophila mela 0.509 0.288 0.683 1.3e-55
UNIPROTKB|A5D7E8505 PDIA3 "Protein disulfide-isome 0.566 0.310 0.496 1.6e-47
UNIPROTKB|P38657505 PDIA3 "Protein disulfide-isome 0.566 0.310 0.496 1.6e-47
UNIPROTKB|P30101505 PDIA3 "Protein disulfide-isome 0.566 0.310 0.490 4.2e-47
WB|WBGene00003964488 pdi-3 [Caenorhabditis elegans 0.505 0.286 0.538 5.3e-47
UNIPROTKB|G5ED07488 pdi-3 "CeERp57" [Caenorhabditi 0.505 0.286 0.538 5.3e-47
UNIPROTKB|E2RD86505 PDIA3 "Uncharacterized protein 0.566 0.310 0.490 1.1e-46
MGI|MGI:95834505 Pdia3 "protein disulfide isome 0.566 0.310 0.478 1.1e-46
UNIPROTKB|E1CAJ5505 grp-58 "Uncharacterized protei 0.566 0.310 0.484 2.3e-46
MGI|MGI:104864638 Pdia4 "protein disulfide isome 0.505 0.219 0.468 1.3e-42
FB|FBgn0033663 ERp60 "ERp60" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 554 (200.1 bits), Expect = 1.3e-55, Sum P(2) = 1.3e-55
 Identities = 97/142 (68%), Positives = 119/142 (83%)

Query:   135 TNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAM 194
             TNYWRNR+LKVAK F  +  FAI++KDDFQHELNE+G+D+V  DKP+V  R E   KYA+
Sbjct:   270 TNYWRNRVLKVAKEFVGQINFAIASKDDFQHELNEYGYDFV-GDKPVVLARDEKNLKYAL 328

Query:   195 KDEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVE 254
             KDEFSVENL+ F+ K++A E++PYIKSEP+PE N  PVKVAVAKNFD++V NN KD L+E
Sbjct:   329 KDEFSVENLQDFVEKLLANELEPYIKSEPIPESNDAPVKVAVAKNFDDLVINNGKDTLIE 388

Query:   255 FYAPWCGHCKKLTPVYEEVGEK 276
             FYAPWCGHCKKL+P+YEE+ EK
Sbjct:   389 FYAPWCGHCKKLSPIYEELAEK 410


GO:0003756 "protein disulfide isomerase activity" evidence=ISS
GO:0006457 "protein folding" evidence=ISS
GO:0009055 "electron carrier activity" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA
GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA
GO:0006662 "glycerol ether metabolic process" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
UNIPROTKB|A5D7E8 PDIA3 "Protein disulfide-isomerase A3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P38657 PDIA3 "Protein disulfide-isomerase A3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P30101 PDIA3 "Protein disulfide-isomerase A3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00003964 pdi-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|G5ED07 pdi-3 "CeERp57" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2RD86 PDIA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:95834 Pdia3 "protein disulfide isomerase associated 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1CAJ5 grp-58 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:104864 Pdia4 "protein disulfide isomerase associated 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P11598PDIA3_RAT5, ., 3, ., 4, ., 10.50340.51260.2811yesN/A
P27773PDIA3_MOUSE5, ., 3, ., 4, ., 10.51020.51260.2811yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
TIGR01130462 TIGR01130, ER_PDI_fam, protein disulfide isomerase 8e-52
TIGR01130462 TIGR01130, ER_PDI_fam, protein disulfide isomerase 5e-44
PTZ00102477 PTZ00102, PTZ00102, disulphide isomerase; Provisio 5e-26
cd03073111 cd03073, PDI_b'_ERp72_ERp57, PDIb' family, ERp72 a 6e-25
cd03073111 cd03073, PDI_b'_ERp72_ERp57, PDIb' family, ERp72 a 4e-24
cd02995104 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal T 5e-23
PTZ00102477 PTZ00102, PTZ00102, disulphide isomerase; Provisio 8e-22
TIGR01126102 TIGR01126, pdi_dom, protein disulfide-isomerase do 6e-17
pfam00085104 pfam00085, Thioredoxin, Thioredoxin 9e-17
cd02995104 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal T 2e-16
cd02998105 cd02998, PDI_a_ERp38, PDIa family, endoplasmic ret 2e-16
pfam13848183 pfam13848, Thioredoxin_6, Thioredoxin-like domain 4e-15
cd02961101 cd02961, PDI_a_family, Protein Disulfide Isomerase 9e-15
cd03002109 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like su 2e-12
cd03001103 cd03001, PDI_a_P5, PDIa family, P5 subfamily; comp 2e-12
pfam00085104 pfam00085, Thioredoxin, Thioredoxin 2e-11
pfam13848183 pfam13848, Thioredoxin_6, Thioredoxin-like domain 3e-11
cd02982103 cd02982, PDI_b'_family, Protein Disulfide Isomeras 6e-11
TIGR01126102 TIGR01126, pdi_dom, protein disulfide-isomerase do 1e-10
cd02982103 cd02982, PDI_b'_family, Protein Disulfide Isomeras 1e-10
cd02998105 cd02998, PDI_a_ERp38, PDIa family, endoplasmic ret 2e-10
cd02961101 cd02961, PDI_a_family, Protein Disulfide Isomerase 2e-10
TIGR01068101 TIGR01068, thioredoxin, thioredoxin 2e-10
TIGR01130 462 TIGR01130, ER_PDI_fam, protein disulfide isomerase 9e-10
cd03005102 cd03005, PDI_a_ERp46, PDIa family, endoplasmic ret 2e-09
cd03000104 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; 3e-09
cd03001103 cd03001, PDI_a_P5, PDIa family, P5 subfamily; comp 6e-09
cd0294793 cd02947, TRX_family, TRX family; composed of two g 9e-09
cd03002109 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like su 1e-08
PTZ00102 477 PTZ00102, PTZ00102, disulphide isomerase; Provisio 3e-08
cd03004104 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ER 7e-08
cd02997104 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; 1e-07
cd02992114 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhyd 9e-07
TIGR01130 462 TIGR01130, ER_PDI_fam, protein disulfide isomerase 1e-06
cd02992114 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhyd 2e-06
COG3118 304 COG3118, COG3118, Thioredoxin domain-containing pr 2e-06
PRK10996139 PRK10996, PRK10996, thioredoxin 2; Provisional 2e-06
TIGR01068101 TIGR01068, thioredoxin, thioredoxin 5e-06
PTZ00102 477 PTZ00102, PTZ00102, disulphide isomerase; Provisio 7e-06
cd03004104 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ER 1e-05
cd02994101 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; co 2e-05
PTZ0005198 PTZ00051, PTZ00051, thioredoxin; Provisional 3e-05
cd03005102 cd03005, PDI_a_ERp46, PDIa family, endoplasmic ret 1e-04
cd02993109 cd02993, PDI_a_APS_reductase, PDIa family, 5'-Aden 2e-04
cd0294793 cd02947, TRX_family, TRX family; composed of two g 3e-04
cd02997104 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; 3e-04
PRK09381109 PRK09381, trxA, thioredoxin; Provisional 3e-04
PTZ00443 224 PTZ00443, PTZ00443, Thioredoxin domain-containing 4e-04
cd0295696 cd02956, ybbN, ybbN protein family; ybbN is a hypo 4e-04
cd02950142 cd02950, TxlA, TRX-like protein A (TxlA) family; T 7e-04
PRK10996139 PRK10996, PRK10996, thioredoxin 2; Provisional 0.001
cd02996108 cd02996, PDI_a_ERp44, PDIa family, endoplasmic ret 0.001
cd03000104 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; 0.002
COG3118 304 COG3118, COG3118, Thioredoxin domain-containing pr 0.002
COG0526127 COG0526, TrxA, Thiol-disulfide isomerase and thior 0.002
cd02999100 cd02999, PDI_a_ERp44_like, PDIa family, endoplasmi 0.002
PLN02309457 PLN02309, PLN02309, 5'-adenylylsulfate reductase 0.003
>gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic Back     alignment and domain information
 Score =  175 bits (445), Expect = 8e-52
 Identities = 97/269 (36%), Positives = 127/269 (47%), Gaps = 32/269 (11%)

Query: 20  FADKFT-FAISAKDDF------QHELNEFGFDYVPSDKPLVFVRAEDGK--KYAMKDEFS 70
             D F   A   +D +                  P    L   + ED K  K   + +  
Sbjct: 144 LNDTFLSVAEKLRDVYFFFAHSSDVAAFAKLGAFPDSVVLFKPKDEDEKFSKVDGEMDTD 203

Query: 71  VENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPW 130
           V +LE F+       V      E   +       V +  N DE +               
Sbjct: 204 VSDLEKFIRAESLPLVG-EFTQETAAKYFESGPLVVLYYNVDESLDP------------- 249

Query: 131 CGHCTNYWRNRILKVAKGFADKF-TFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDG 189
                   RNR L+ AK F  KF  FA++ ++DF  EL  FG        P V ++  +G
Sbjct: 250 ----FEELRNRFLEAAKKFRGKFVNFAVADEEDFGRELEYFGLK--AEKFPAVAIQDLEG 303

Query: 190 -KKYAMKD-EFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNN 247
            KKY M   EFS ENLE+F+   + G++ PY+KSEP+PED+ GPVKV V KNFDE+V + 
Sbjct: 304 NKKYPMDQEEFSSENLEAFVKDFLDGKLKPYLKSEPIPEDDEGPVKVLVGKNFDEIVLDE 363

Query: 248 EKDVLVEFYAPWCGHCKKLTPVYEEVGEK 276
            KDVLVEFYAPWCGHCK L P+YEE+ EK
Sbjct: 364 TKDVLVEFYAPWCGHCKNLAPIYEELAEK 392


This model represents eukaryotic protein disulfide isomerases retained in the endoplasmic reticulum (ER) and closely related forms. Some members have been assigned alternative or additional functions such as prolyl 4-hydroxylase and dolichyl-diphosphooligosaccharide-protein glycotransferase. Members of this family have at least two protein-disulfide domains, each similar to thioredoxin but with the redox-active disulfide in the motif PWCGHCK, and an ER retention signal at the extreme C-terminus (KDEL, HDEL, and similar motifs). Length = 462

>gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic Back     alignment and domain information
>gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|239371 cd03073, PDI_b'_ERp72_ERp57, PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>gnl|CDD|239371 cd03073, PDI_b'_ERp72_ERp57, PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>gnl|CDD|239293 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|200074 TIGR01126, pdi_dom, protein disulfide-isomerase domain Back     alignment and domain information
>gnl|CDD|215704 pfam00085, Thioredoxin, Thioredoxin Back     alignment and domain information
>gnl|CDD|239293 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>gnl|CDD|239296 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>gnl|CDD|222416 pfam13848, Thioredoxin_6, Thioredoxin-like domain Back     alignment and domain information
>gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>gnl|CDD|239300 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>gnl|CDD|239299 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>gnl|CDD|215704 pfam00085, Thioredoxin, Thioredoxin Back     alignment and domain information
>gnl|CDD|222416 pfam13848, Thioredoxin_6, Thioredoxin-like domain Back     alignment and domain information
>gnl|CDD|239280 cd02982, PDI_b'_family, Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>gnl|CDD|200074 TIGR01126, pdi_dom, protein disulfide-isomerase domain Back     alignment and domain information
>gnl|CDD|239280 cd02982, PDI_b'_family, Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>gnl|CDD|239296 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>gnl|CDD|200072 TIGR01068, thioredoxin, thioredoxin Back     alignment and domain information
>gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic Back     alignment and domain information
>gnl|CDD|239303 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>gnl|CDD|239298 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>gnl|CDD|239299 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>gnl|CDD|239300 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|239302 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>gnl|CDD|239295 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>gnl|CDD|239290 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic Back     alignment and domain information
>gnl|CDD|239290 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>gnl|CDD|225660 COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182889 PRK10996, PRK10996, thioredoxin 2; Provisional Back     alignment and domain information
>gnl|CDD|200072 TIGR01068, thioredoxin, thioredoxin Back     alignment and domain information
>gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|239302 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>gnl|CDD|239292 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>gnl|CDD|173347 PTZ00051, PTZ00051, thioredoxin; Provisional Back     alignment and domain information
>gnl|CDD|239303 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>gnl|CDD|239291 cd02993, PDI_a_APS_reductase, PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>gnl|CDD|239295 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>gnl|CDD|181812 PRK09381, trxA, thioredoxin; Provisional Back     alignment and domain information
>gnl|CDD|185622 PTZ00443, PTZ00443, Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|239254 cd02956, ybbN, ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>gnl|CDD|239248 cd02950, TxlA, TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>gnl|CDD|182889 PRK10996, PRK10996, thioredoxin 2; Provisional Back     alignment and domain information
>gnl|CDD|239294 cd02996, PDI_a_ERp44, PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>gnl|CDD|239298 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>gnl|CDD|225660 COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223600 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|239297 cd02999, PDI_a_ERp44_like, PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>gnl|CDD|215175 PLN02309, PLN02309, 5'-adenylylsulfate reductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 277
KOG0190|consensus493 100.0
KOG0190|consensus493 99.98
PTZ00102477 disulphide isomerase; Provisional 99.97
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.96
PTZ00102477 disulphide isomerase; Provisional 99.95
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.95
KOG0191|consensus383 99.94
KOG0191|consensus 383 99.92
KOG0910|consensus150 99.85
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 99.84
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 99.83
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 99.82
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 99.82
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 99.81
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 99.81
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 99.79
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 99.79
PRK09381109 trxA thioredoxin; Provisional 99.77
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 99.76
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 99.76
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 99.75
PTZ00443224 Thioredoxin domain-containing protein; Provisional 99.75
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 99.75
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 99.75
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 99.74
COG3118 304 Thioredoxin domain-containing protein [Posttransla 99.74
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.74
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 99.73
PTZ00062204 glutaredoxin; Provisional 99.73
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 99.73
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 99.72
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.72
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 99.72
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 99.71
PHA02278103 thioredoxin-like protein 99.7
PRK10996139 thioredoxin 2; Provisional 99.68
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.68
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 99.68
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 99.68
KOG0907|consensus106 99.67
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.66
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 99.66
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 99.65
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 99.65
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 99.64
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 99.64
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.63
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 99.62
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 99.61
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 99.61
cd02962152 TMX2 TMX2 family; composed of proteins similar to 99.59
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 99.59
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 99.59
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 99.59
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 99.58
PLN02309457 5'-adenylylsulfate reductase 99.58
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.57
KOG4277|consensus 468 99.57
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 99.56
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 99.56
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 99.56
PTZ0005198 thioredoxin; Provisional 99.51
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 99.5
cd0294793 TRX_family TRX family; composed of two groups: Gro 99.47
KOG0912|consensus 375 99.47
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 99.46
KOG0908|consensus 288 99.45
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 99.42
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 99.41
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 99.37
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 99.32
KOG0910|consensus150 99.25
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 99.23
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 99.23
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 99.22
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 99.21
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 99.21
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 99.17
PF01216383 Calsequestrin: Calsequestrin; InterPro: IPR001393 99.16
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 99.16
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 99.15
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 99.15
PRK00293571 dipZ thiol:disulfide interchange protein precursor 99.15
KOG1731|consensus 606 99.14
cd02955124 SSP411 TRX domain, SSP411 protein family; members 99.14
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 99.14
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 99.12
TIGR02740271 TraF-like TraF-like protein. This protein is relat 99.11
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 99.11
PF01216383 Calsequestrin: Calsequestrin; InterPro: IPR001393 99.11
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 99.09
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 99.09
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.09
PHA02278103 thioredoxin-like protein 99.08
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 99.07
PHA0212575 thioredoxin-like protein 99.07
cd02962152 TMX2 TMX2 family; composed of proteins similar to 99.06
KOG0912|consensus 375 99.06
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.05
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 99.04
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.04
PRK03147173 thiol-disulfide oxidoreductase; Provisional 99.04
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 99.03
PRK09381109 trxA thioredoxin; Provisional 99.03
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 99.02
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 99.01
PTZ00443 224 Thioredoxin domain-containing protein; Provisional 99.01
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 99.01
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 99.0
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.0
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.0
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 99.0
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 99.0
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 99.0
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 98.99
KOG0907|consensus106 98.99
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 98.99
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 98.98
cd02958114 UAS UAS family; UAS is a domain of unknown functio 98.98
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 98.97
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 98.96
COG3118 304 Thioredoxin domain-containing protein [Posttransla 98.96
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 98.94
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.93
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 98.92
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 98.92
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 98.91
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 98.89
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 98.88
PRK13728181 conjugal transfer protein TrbB; Provisional 98.88
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 98.87
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 98.87
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 98.84
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.84
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 98.83
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 98.83
cd02967114 mauD Methylamine utilization (mau) D family; mauD 98.83
PLN02309457 5'-adenylylsulfate reductase 98.82
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 98.82
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 98.81
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 98.8
PTZ00056199 glutathione peroxidase; Provisional 98.78
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 98.77
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 98.76
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 98.75
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.75
smart00594122 UAS UAS domain. 98.74
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 98.74
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 98.73
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 98.72
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 98.72
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 98.71
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 98.69
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 98.68
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 98.68
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 98.68
PRK10996139 thioredoxin 2; Provisional 98.67
KOG0911|consensus227 98.67
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 98.64
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 98.62
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 98.62
PTZ0005198 thioredoxin; Provisional 98.61
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 98.61
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 98.61
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 98.6
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 98.58
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 98.58
KOG1731|consensus 606 98.57
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 98.56
PLN02412167 probable glutathione peroxidase 98.52
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 98.5
COG4232569 Thiol:disulfide interchange protein [Posttranslati 98.5
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 98.49
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 98.49
KOG0914|consensus265 98.46
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 98.46
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 98.45
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 98.45
KOG4277|consensus 468 98.44
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 98.39
PTZ00256183 glutathione peroxidase; Provisional 98.33
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 98.32
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.31
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 98.3
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 98.28
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 98.27
KOG0913|consensus248 98.26
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 98.25
cd02967114 mauD Methylamine utilization (mau) D family; mauD 98.22
PHA0212575 thioredoxin-like protein 98.22
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 98.2
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 98.2
KOG2501|consensus157 98.19
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 98.19
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 98.18
cd0294793 TRX_family TRX family; composed of two groups: Gro 98.16
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 98.15
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 98.15
PF13728215 TraF: F plasmid transfer operon protein 98.14
COG2143182 Thioredoxin-related protein [Posttranslational mod 98.14
PTZ00062204 glutaredoxin; Provisional 98.11
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 98.1
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 98.07
cd03068107 PDI_b_ERp72 PDIb family, ERp72 subfamily, first re 98.04
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 98.04
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 98.03
TIGR02739256 TraF type-F conjugative transfer system pilin asse 98.03
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 98.02
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 98.01
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 97.99
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 97.99
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 97.97
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 97.97
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 97.96
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.96
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 97.95
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 97.94
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 97.93
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 97.93
PRK13703248 conjugal pilus assembly protein TraF; Provisional 97.9
KOG2603|consensus331 97.88
TIGR02740271 TraF-like TraF-like protein. This protein is relat 97.87
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 97.87
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 97.86
PRK10606183 btuE putative glutathione peroxidase; Provisional 97.86
PRK13728181 conjugal transfer protein TrbB; Provisional 97.86
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 97.83
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 97.82
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 97.8
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 97.8
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 97.79
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 97.79
KOG1672|consensus211 97.78
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 97.77
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 97.77
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 97.76
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 97.76
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 97.74
PRK13190202 putative peroxiredoxin; Provisional 97.71
KOG3414|consensus142 97.69
PRK1120085 grxA glutaredoxin 1; Provisional 97.68
PRK15000200 peroxidase; Provisional 97.67
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 97.66
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 97.66
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 97.65
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 97.64
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 97.63
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 97.62
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 97.62
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 97.56
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 97.55
PRK03147173 thiol-disulfide oxidoreductase; Provisional 97.55
PTZ00056 199 glutathione peroxidase; Provisional 97.53
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 97.51
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 97.5
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 97.5
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.45
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 97.43
cd02955124 SSP411 TRX domain, SSP411 protein family; members 97.43
PTZ00137261 2-Cys peroxiredoxin; Provisional 97.43
PLN02399 236 phospholipid hydroperoxide glutathione peroxidase 97.43
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 97.43
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 97.41
TIGR02540 153 gpx7 putative glutathione peroxidase Gpx7. This mo 97.4
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 97.39
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 97.38
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.37
PLN02412 167 probable glutathione peroxidase 97.35
PRK00293571 dipZ thiol:disulfide interchange protein precursor 97.35
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 97.33
PRK13599215 putative peroxiredoxin; Provisional 97.26
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 97.25
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 97.22
cd03074120 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase 97.18
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 97.18
PRK13189222 peroxiredoxin; Provisional 97.15
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 97.14
KOG3425|consensus128 97.12
PRK1032981 glutaredoxin-like protein; Provisional 97.1
PRK13191215 putative peroxiredoxin; Provisional 97.09
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 97.05
PTZ00256 183 glutathione peroxidase; Provisional 97.0
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 96.98
KOG2501|consensus157 96.93
PTZ00253199 tryparedoxin peroxidase; Provisional 96.9
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 96.86
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 96.82
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 96.82
PRK10877232 protein disulfide isomerase II DsbC; Provisional 96.8
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 96.78
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 96.78
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 96.76
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 96.75
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 96.7
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 96.69
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 96.68
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 96.67
KOG3170|consensus240 96.59
KOG0914|consensus265 96.5
PHA03050108 glutaredoxin; Provisional 96.5
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 96.45
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 96.38
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 96.38
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 96.35
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 96.35
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 96.32
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 96.29
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 96.28
KOG0913|consensus 248 96.19
cd03015 173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 96.09
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 96.0
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 96.0
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 95.92
TIGR03137 187 AhpC peroxiredoxin. This gene contains two invaria 95.9
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 95.89
PF07449107 HyaE: Hydrogenase-1 expression protein HyaE; Inter 95.89
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 95.81
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 95.78
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 95.75
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 95.74
KOG2640|consensus319 95.73
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 95.63
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 95.62
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 95.6
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 95.6
PRK1063883 glutaredoxin 3; Provisional 95.32
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 95.31
smart00594122 UAS UAS domain. 95.29
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 95.25
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 95.24
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 95.09
cd03068107 PDI_b_ERp72 PDIb family, ERp72 subfamily, first re 95.02
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 94.98
PHA03050108 glutaredoxin; Provisional 94.95
PF13728215 TraF: F plasmid transfer operon protein 94.81
COG4232569 Thiol:disulfide interchange protein [Posttranslati 94.75
PF13462162 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV 94.6
PRK10824115 glutaredoxin-4; Provisional 94.57
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 94.56
cd03074120 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase 94.5
PRK10382 187 alkyl hydroperoxide reductase subunit C; Provision 94.28
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 94.23
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 94.12
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 94.03
KOG3425|consensus128 94.01
PRK1032981 glutaredoxin-like protein; Provisional 93.94
KOG1752|consensus104 93.85
KOG3171|consensus273 93.81
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 93.67
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 93.4
PRK13703248 conjugal pilus assembly protein TraF; Provisional 93.04
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 92.84
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 92.68
PRK15000 200 peroxidase; Provisional 92.61
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 92.46
TIGR02739256 TraF type-F conjugative transfer system pilin asse 92.42
COG1331 667 Highly conserved protein containing a thioredoxin 92.32
PRK1063883 glutaredoxin 3; Provisional 92.32
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 92.19
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 91.94
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 91.69
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 91.61
cd03071116 PDI_b'_NRX PDIb' family, NRX subgroup, redox inact 91.48
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 91.35
PRK10877232 protein disulfide isomerase II DsbC; Provisional 91.25
PRK10824115 glutaredoxin-4; Provisional 91.01
PRK10954207 periplasmic protein disulfide isomerase I; Provisi 90.89
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 90.72
PTZ00137 261 2-Cys peroxiredoxin; Provisional 90.61
cd02958114 UAS UAS family; UAS is a domain of unknown functio 89.96
PRK13191 215 putative peroxiredoxin; Provisional 89.05
PTZ00253 199 tryparedoxin peroxidase; Provisional 89.0
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 88.41
PRK11657 251 dsbG disulfide isomerase/thiol-disulfide oxidase; 88.33
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 87.48
KOG0908|consensus288 87.31
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 87.19
cd00340 152 GSH_Peroxidase Glutathione (GSH) peroxidase family 86.55
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 86.47
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 85.76
cd0297872 KaiB_like KaiB-like family; composed of the circad 85.48
PRK13189 222 peroxiredoxin; Provisional 84.95
KOG2603|consensus331 84.81
PRK10954 207 periplasmic protein disulfide isomerase I; Provisi 84.32
KOG2792|consensus280 82.6
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 82.31
PF00837 237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 82.28
TIGR0265487 circ_KaiB circadian clock protein KaiB. Members of 81.98
PF13743176 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C. 81.83
KOG0911|consensus227 81.7
PHA03075123 glutaredoxin-like protein; Provisional 81.69
KOG1752|consensus104 80.35
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 80.16
>KOG0190|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-35  Score=259.71  Aligned_cols=241  Identities=36%  Similarity=0.632  Sum_probs=197.2

Q ss_pred             HHHHHHHHhcCCceEEEEEcccchHHHhhhcCCCCCCCCCcEEEEEcCC-C-CcccCCCCCCHHHHHHHHHHHhcCCCCc
Q psy9102          11 NRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAED-G-KKYAMKDEFSVENLESFLTKVVAGEVDP   88 (277)
Q Consensus        11 ~~f~~~A~~~~~~~~f~~~~~~~~~~~~~~~~v~~~~~~~P~~~~~~~~-~-~~y~~~g~~~~~~i~~fi~~~~~~~~~~   88 (277)
                      ..|..+|..+++++.|++++..+.   .+.+++.... ..|++++.+.+ + ..|  +|+++.+.|.+||..+..|.+..
T Consensus       168 ~~~~~~a~~l~~d~~F~~ts~~~~---~~~~~~~~~~-~~~i~l~kk~d~~~~~~--~~~~~~~~l~~Fi~~~~~plv~~  241 (493)
T KOG0190|consen  168 ESFFDAASKLRDDYKFAHTSDSDV---AKKLELNTEG-TFPIVLFKKFDELLVKY--DGSFTPELLKKFIQENSLPLVTE  241 (493)
T ss_pred             HHHHHHHHhccccceeeccCcHhH---HhhccCCCCC-cceEEeccccccchhhc--ccccCHHHHHHHHHHhcccccce
Confidence            678889999999999999999998   8888887521 12466777644 4 667  99999999999999999999998


Q ss_pred             cccCCCCCCCCCCCeEEeecccceeeeecCCccEEEEEecCCChhhhhhhHHHHHHHHhhcCCcceEEEecccccchhhh
Q psy9102          89 YIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCTNYWRNRILKVAKGFADKFTFAISAKDDFQHELN  168 (277)
Q Consensus        89 ~~~s~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~v~F~~~~c~~c~~~~~~~~~~la~~~~~~i~~~~vd~~~~~~~~~  168 (277)
                            ++..+...++..       .+    ...+.+|-..-|..-... .+.+.++|++|++++.|+.+|.+..++.+.
T Consensus       242 ------ft~~~~~~~~~~-------~~----~~~~~~~~~~~~~~~e~~-~~~~~~vAk~f~~~l~Fi~~d~e~~~~~~~  303 (493)
T KOG0190|consen  242 ------FTVANNAKIYSS-------FV----KLGLDFFVFFKCNRFEEL-RKKFEEVAKKFKGKLRFILIDPESFARVLE  303 (493)
T ss_pred             ------ecccccceeecc-------cc----ccceeEEeccccccHHHH-HHHHHHHHHhcccceEEEEEChHHhhHHHH
Confidence                  776655555222       11    223333333334443444 689999999999999999999999999999


Q ss_pred             ccCcccCCCCCC-eEEEEcCCCceeeecC-CCCHHHHHHHHHHHhcCCCCCCCCCCCCCCCCC-CCeEecchhcHHHHhh
Q psy9102         169 EFGFDYVPSDKP-LVFVRAEDGKKYAMKD-EFSVENLESFLTKVVAGEVDPYIKSEPVPEDNS-GPVKVAVAKNFDEVVT  245 (277)
Q Consensus       169 ~~~i~~~~~~~P-~i~~~~~~~~~~~~~g-~~~~~~l~~fi~~~~~~~~~~~~ks~~~p~~~~-~~v~~l~~~~f~~~v~  245 (277)
                      .||+..  .+.| .+++.+..+.+|...+ ..+.+.|..|+.++++|+++|+++|+|+|++++ .+|+.++++||++.+.
T Consensus       304 ~~Gl~~--~~~~~~~v~~~~~~~Ky~~~~e~~~~~~ie~f~~~~l~Gk~~p~~kSqpiPe~~~~~pVkvvVgknfd~iv~  381 (493)
T KOG0190|consen  304 FFGLEE--EQLPIRAVILNEDGSKYPLEEEELDQENIESFVKDFLDGKVKPHLKSQPIPEDNDRSPVKVVVGKNFDDIVL  381 (493)
T ss_pred             hcCccc--ccCCeeEEeeccccccccCccccccHHHHHHHHHHHhcCccccccccCCCCcccccCCeEEEeecCHHHHhh
Confidence            999996  5566 4466666667887765 488889999999999999999999999999877 7899999999999999


Q ss_pred             cCCCcEEEEEECCCCHHHhhhhHHHHHHHhhC
Q psy9102         246 NNEKDVLVEFYAPWCGHCKKLTPVYEEVGEKA  277 (277)
Q Consensus       246 ~~~~~~lV~f~apwC~~c~~~~p~~~~la~~~  277 (277)
                      +.++++||.|||||||||+++.|+|++||+.|
T Consensus       382 de~KdVLvEfyAPWCgHCk~laP~~eeLAe~~  413 (493)
T KOG0190|consen  382 DEGKDVLVEFYAPWCGHCKALAPIYEELAEKY  413 (493)
T ss_pred             ccccceEEEEcCcccchhhhhhhHHHHHHHHh
Confidence            99999999999999999999999999999875



>KOG0190|consensus Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>KOG0191|consensus Back     alignment and domain information
>KOG0191|consensus Back     alignment and domain information
>KOG0910|consensus Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>KOG0907|consensus Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>KOG4277|consensus Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>KOG0912|consensus Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>KOG0908|consensus Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>KOG0910|consensus Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>KOG1731|consensus Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>KOG0912|consensus Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>KOG0907|consensus Back     alignment and domain information
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>KOG0911|consensus Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>KOG1731|consensus Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>KOG0914|consensus Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>KOG4277|consensus Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>KOG0913|consensus Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>KOG2501|consensus Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>KOG2603|consensus Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>KOG1672|consensus Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>KOG3414|consensus Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>KOG3425|consensus Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>KOG2501|consensus Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>KOG3170|consensus Back     alignment and domain information
>KOG0914|consensus Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>KOG0913|consensus Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2640|consensus Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>KOG3425|consensus Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>KOG3171|consensus Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03071 PDI_b'_NRX PDIb' family, NRX subgroup, redox inactive TRX-like domain b'; composed of vertebrate nucleoredoxins (NRX) Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>KOG0908|consensus Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>cd02978 KaiB_like KaiB-like family; composed of the circadian clock proteins, KaiB and the N-terminal KaiB-like sensory domain of SasA Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>KOG2603|consensus Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>KOG2792|consensus Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>TIGR02654 circ_KaiB circadian clock protein KaiB Back     alignment and domain information
>PF13743 Thioredoxin_5: Thioredoxin; PDB: 3KZQ_C Back     alignment and domain information
>KOG0911|consensus Back     alignment and domain information
>PHA03075 glutaredoxin-like protein; Provisional Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
3f8u_A481 TapasinERP57 HETERODIMER Length = 481 5e-42
3f8u_A 481 TapasinERP57 HETERODIMER Length = 481 2e-04
2dmm_A142 The Solution Structure Of The Second Thioredoxin Do 5e-22
3uem_A361 Crystal Structure Of Human Pdi Bb'a' Domains Length 1e-18
2h8l_A252 Crystal Structure Of The Bb' Fragment Of Erp57 Leng 3e-18
2h8l_A252 Crystal Structure Of The Bb' Fragment Of Erp57 Leng 5e-18
2dj3_A133 The Solution Structure Of The Third Thioredoxin Dom 6e-15
2djj_A121 Solution Structure Of The A' Domain Of Thermophilic 7e-15
2b5e_A504 Crystal Structure Of Yeast Protein Disulfide Isomer 1e-14
3idv_A241 Crystal Structure Of The A0a Fragment Of Erp72 Leng 3e-14
1x5c_A121 The Solution Structure Of The Second Thioredoxin-Li 2e-13
3ec3_A250 Crystal Structure Of The Bb Fragment Of Erp72 Lengt 1e-11
3ec3_A250 Crystal Structure Of The Bb Fragment Of Erp72 Lengt 6e-11
2dj2_A120 The Solution Structure Of The Second Thioredoxin Do 6e-09
3ed3_A 298 Crystal Structure Of The Yeast DithiolDISULFIDE Oxi 2e-07
2diz_A117 The Solution Structure Of The Third Thioredoxin Dom 2e-07
2dj1_A140 The Solution Structure Of The First Thioredoxin Dom 2e-06
3uvt_A111 Crystal Structure Of The Third Catalytic Domain Of 3e-06
2dml_A130 The Solution Structure Of The First Thioredoxin Dom 3e-06
3uj1_A110 Crystal Structure Of The Third Thioredoxin Domain O 4e-06
1mek_A120 Human Protein Disulfide Isomerase, Nmr, 40 Structur 5e-06
2yj7_A106 Crystal Structure Of A Hyperstable Protein From The 7e-06
1x5d_A133 The Solution Structure Of The Second Thioredoxin-Li 1e-05
2alb_A113 Nmr Structure Of The N-Terminal Domain A Of The Gly 1e-05
3hhv_A110 The Crystal Structure Of The Thioredoxin A2 From Su 2e-05
1syr_A112 Initial Structural Analysis Of Plasmodium Falciparu 4e-05
1x5e_A126 The Solution Structure Of The Thioredoxin-Like Doma 6e-05
2fd3_A108 Crystal Structure Of Thioredoxin Mutant P34h Length 6e-05
2i1u_A121 Mycobacterium Tuberculosis Thioredoxin C Length = 1 8e-05
2l4q_A116 Solution Structures Of Oxidized And Reduced Thiored 8e-05
1t00_A112 The Structure Of Thioredoxin From S. Coelicolor Len 1e-04
3tco_A109 Crystallographic And Spectroscopic Characterization 2e-04
2j23_A121 Cross-Reactivity And Crystal Structure Of Malassezi 2e-04
1quw_A105 Solution Structure Of The Thioredoxin From Bacillus 3e-04
2fa4_A111 Crystal Structure Of Oxidized Form From Saccharomyc 3e-04
2hsy_A104 Solution Structure Of Thioredoxin 2 From Saccharomy 3e-04
1nw2_A105 The Crystal Structure Of The Mutant R82e Of Thiored 3e-04
1gl8_A104 Solution Structure Of Thioredoxin M From Spinach, O 3e-04
1fb0_A105 Crystal Structure Of Thioredoxin M From Spinach Chl 4e-04
1dby_A107 Nmr Structures Of Chloroplast Thioredoxin M Ch2 Fro 4e-04
2h71_A108 Crystal Structure Of Thioredoxin Mutant D47e In Hex 5e-04
2h73_A108 Crystal Structure Of Thioredoxin Mutant D43e In Hex 5e-04
2gzy_A104 Solution Structures Of The Reduced Form Of Thioredo 8e-04
>pdb|3F8U|A Chain A, TapasinERP57 HETERODIMER Length = 481 Back     alignment and structure

Iteration: 1

Score = 167 bits (423), Expect = 5e-42, Method: Compositional matrix adjust. Identities = 81/165 (49%), Positives = 110/165 (66%), Gaps = 8/165 (4%) Query: 120 KDVLVEFY---APWCGHCTNYWRNRILKVAKGFAD---KFTFAISAKDDFQHELNEFGFD 173 KD+L+ +Y +NYWRNR++ VAK F D K FA++++ F HEL++FG + Sbjct: 234 KDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLE 293 Query: 174 YVPSDKPLVFVRAEDGKKYAMKDEFSVEN--LESFLTKVVAGEVDPYIKSEPVPEDNSGP 231 + P+V +R G+K+ M++EFS + LE FL G + Y+KSEP+PE N GP Sbjct: 294 STAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPESNDGP 353 Query: 232 VKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCKKLTPVYEEVGEK 276 VKV VA+NFDE+V N KDVL+EFYAPWCGHCK L P Y+E+GEK Sbjct: 354 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEK 398
>pdb|3F8U|A Chain A, TapasinERP57 HETERODIMER Length = 481 Back     alignment and structure
>pdb|2DMM|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Human Protein Disulfide-Isomerase A3 Length = 142 Back     alignment and structure
>pdb|3UEM|A Chain A, Crystal Structure Of Human Pdi Bb'a' Domains Length = 361 Back     alignment and structure
>pdb|2H8L|A Chain A, Crystal Structure Of The Bb' Fragment Of Erp57 Length = 252 Back     alignment and structure
>pdb|2H8L|A Chain A, Crystal Structure Of The Bb' Fragment Of Erp57 Length = 252 Back     alignment and structure
>pdb|2DJ3|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 133 Back     alignment and structure
>pdb|2DJJ|A Chain A, Solution Structure Of The A' Domain Of Thermophilic Fungal Protein Disulfide Isomerase Length = 121 Back     alignment and structure
>pdb|2B5E|A Chain A, Crystal Structure Of Yeast Protein Disulfide Isomerase Length = 504 Back     alignment and structure
>pdb|3IDV|A Chain A, Crystal Structure Of The A0a Fragment Of Erp72 Length = 241 Back     alignment and structure
>pdb|1X5C|A Chain A, The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase Length = 121 Back     alignment and structure
>pdb|3EC3|A Chain A, Crystal Structure Of The Bb Fragment Of Erp72 Length = 250 Back     alignment and structure
>pdb|3EC3|A Chain A, Crystal Structure Of The Bb Fragment Of Erp72 Length = 250 Back     alignment and structure
>pdb|2DJ2|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 120 Back     alignment and structure
>pdb|3ED3|A Chain A, Crystal Structure Of The Yeast DithiolDISULFIDE Oxidoreductase Mpd1p Length = 298 Back     alignment and structure
>pdb|2DIZ|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Human Thioredoxin Domain-Containing Protein 5 Length = 117 Back     alignment and structure
>pdb|2DJ1|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 140 Back     alignment and structure
>pdb|3UVT|A Chain A, Crystal Structure Of The Third Catalytic Domain Of Erp46 Length = 111 Back     alignment and structure
>pdb|2DML|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A6 Length = 130 Back     alignment and structure
>pdb|3UJ1|A Chain A, Crystal Structure Of The Third Thioredoxin Domain Of Human Erp46 Length = 110 Back     alignment and structure
>pdb|1MEK|A Chain A, Human Protein Disulfide Isomerase, Nmr, 40 Structures Length = 120 Back     alignment and structure
>pdb|2YJ7|A Chain A, Crystal Structure Of A Hyperstable Protein From The Precambrian Period Length = 106 Back     alignment and structure
>pdb|1X5D|A Chain A, The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase A6 Length = 133 Back     alignment and structure
>pdb|2ALB|A Chain A, Nmr Structure Of The N-Terminal Domain A Of The Glycoprotein Chaperone Erp57 Length = 113 Back     alignment and structure
>pdb|3HHV|A Chain A, The Crystal Structure Of The Thioredoxin A2 From Sulfolobus Solfataricus Length = 110 Back     alignment and structure
>pdb|1SYR|A Chain A, Initial Structural Analysis Of Plasmodium Falciparum Thioredoxin Length = 112 Back     alignment and structure
>pdb|1X5E|A Chain A, The Solution Structure Of The Thioredoxin-Like Domain Of Human Thioredoxin-Related Transmembrane Protein Length = 126 Back     alignment and structure
>pdb|2FD3|A Chain A, Crystal Structure Of Thioredoxin Mutant P34h Length = 108 Back     alignment and structure
>pdb|2I1U|A Chain A, Mycobacterium Tuberculosis Thioredoxin C Length = 121 Back     alignment and structure
>pdb|2L4Q|A Chain A, Solution Structures Of Oxidized And Reduced Thioredoxin C From M. Tb Length = 116 Back     alignment and structure
>pdb|1T00|A Chain A, The Structure Of Thioredoxin From S. Coelicolor Length = 112 Back     alignment and structure
>pdb|3TCO|A Chain A, Crystallographic And Spectroscopic Characterization Of Sulfolobus Solfataricus Trxa1 Provide Insights Into The Determinants Of Thioredoxin Fold Stability Length = 109 Back     alignment and structure
>pdb|2J23|A Chain A, Cross-Reactivity And Crystal Structure Of Malassezia Sympodialis Thioredoxin (Mala S 13), A Member Of A New Pan- Allergen Family Length = 121 Back     alignment and structure
>pdb|1QUW|A Chain A, Solution Structure Of The Thioredoxin From Bacillus Acidocaldarius Length = 105 Back     alignment and structure
>pdb|2FA4|A Chain A, Crystal Structure Of Oxidized Form From Saccharomyces Cerevisiae Length = 111 Back     alignment and structure
>pdb|2HSY|A Chain A, Solution Structure Of Thioredoxin 2 From Saccharomyces Cerevisiae Length = 104 Back     alignment and structure
>pdb|1NW2|A Chain A, The Crystal Structure Of The Mutant R82e Of Thioredoxin From Alicyclobacillus Acidocaldarius Length = 105 Back     alignment and structure
>pdb|1GL8|A Chain A, Solution Structure Of Thioredoxin M From Spinach, Oxidized Form Length = 104 Back     alignment and structure
>pdb|1FB0|A Chain A, Crystal Structure Of Thioredoxin M From Spinach Chloroplast (Reduced Form) Length = 105 Back     alignment and structure
>pdb|1DBY|A Chain A, Nmr Structures Of Chloroplast Thioredoxin M Ch2 From The Green Alga Chlamydomonas Reinhardtii Length = 107 Back     alignment and structure
>pdb|2H71|A Chain A, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2H73|A Chain A, Crystal Structure Of Thioredoxin Mutant D43e In Hexagonal (P61) Space Group Length = 108 Back     alignment and structure
>pdb|2GZY|A Chain A, Solution Structures Of The Reduced Form Of Thioredoxin From Bacillus Subtilis Length = 104 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 8e-44
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 1e-32
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 6e-20
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 2e-10
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 4e-08
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 2e-06
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 1e-30
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-18
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-09
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-05
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-05
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 1e-29
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 6e-09
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 1e-28
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 4e-22
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 1e-15
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 8e-14
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 2e-26
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 6e-21
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 7e-26
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 6e-19
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 8e-25
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 4e-18
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 3e-24
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 1e-17
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 1e-22
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 8e-19
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 8e-11
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 4e-06
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 3e-22
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 4e-18
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 4e-22
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 4e-22
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 3e-20
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 2e-15
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 4e-20
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 4e-14
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 4e-19
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 3e-13
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 1e-18
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 2e-12
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 2e-18
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 1e-12
1mek_A120 Protein disulfide isomerase; electron transport, r 2e-17
1mek_A120 Protein disulfide isomerase; electron transport, r 2e-11
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 1e-16
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 2e-10
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 1e-16
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 4e-16
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 7e-04
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-15
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 4e-10
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 3e-15
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 3e-15
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 5e-15
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 7e-15
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 2e-10
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 1e-06
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 4e-06
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 3e-13
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 2e-09
2qc7_A 240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 2e-11
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 3e-08
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 2e-11
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 3e-07
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 5e-11
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 2e-06
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 8e-11
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 7e-07
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 2e-10
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 4e-10
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 7e-08
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 2e-05
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 3e-10
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 2e-06
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 3e-10
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 6e-05
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 4e-10
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 1e-05
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 8e-10
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 2e-05
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 1e-09
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 6e-06
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 1e-09
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 2e-06
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 1e-09
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 9e-06
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 2e-09
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 1e-05
2l57_A126 Uncharacterized protein; structural genomics, unkn 3e-09
2l57_A126 Uncharacterized protein; structural genomics, unkn 3e-05
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 3e-09
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 3e-05
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 3e-09
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 1e-05
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 4e-09
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 2e-05
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 4e-09
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 2e-05
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 4e-09
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 2e-05
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 4e-09
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 3e-05
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 4e-09
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 4e-05
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 5e-09
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 3e-05
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 6e-09
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 3e-05
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 7e-09
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 7e-05
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 8e-09
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 6e-05
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 8e-09
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 2e-04
3dxb_A 222 Thioredoxin N-terminally fused to PUF60(UHM); spli 2e-08
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 6e-05
2l5l_A136 Thioredoxin; structural genomics, electron transpo 2e-08
2l5l_A136 Thioredoxin; structural genomics, electron transpo 9e-05
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 2e-08
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 1e-04
2yzu_A109 Thioredoxin; redox protein, electron transport, st 3e-08
2yzu_A109 Thioredoxin; redox protein, electron transport, st 1e-04
4euy_A105 Uncharacterized protein; structural genomics, PSI- 4e-08
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 5e-08
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 6e-04
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 5e-08
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 6e-04
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 7e-08
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 9e-08
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 2e-05
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 1e-07
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 3e-04
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 1e-07
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 2e-07
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 2e-07
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 2e-07
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 3e-07
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 4e-07
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 4e-07
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 4e-07
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 6e-07
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 6e-07
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 8e-07
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 9e-07
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 9e-07
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 9e-07
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 1e-06
1wmj_A130 Thioredoxin H-type; structural genomics, program f 1e-06
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 1e-06
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 2e-06
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 2e-06
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 2e-06
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 3e-06
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 2e-04
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 3e-06
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 4e-06
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 5e-06
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 7e-06
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 1e-05
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 9e-06
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 7e-05
2kuc_A130 Putative disulphide-isomerase; structural genomics 1e-05
1zma_A118 Bacterocin transport accessory protein; alpha-beta 1e-05
1zma_A118 Bacterocin transport accessory protein; alpha-beta 3e-04
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 2e-05
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 6e-05
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 7e-05
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 1e-04
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 2e-04
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 Back     alignment and structure
 Score =  151 bits (382), Expect = 8e-44
 Identities = 68/267 (25%), Positives = 112/267 (41%), Gaps = 30/267 (11%)

Query: 14  LKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYAMKDEFSVEN 73
           L+ A+   D   F I++  D   +              +V  +  D  +   + E + EN
Sbjct: 55  LQAAEAI-DDIPFGITSNSDVFSKYQ-------LDKDGVVLFKKFDEGRNNFEGEVTKEN 106

Query: 74  LESFLTKVVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGH 133
           L  F            IK   +P      V     +   ++     K  ++ F       
Sbjct: 107 LLDF------------IKHNQLP-----LVIEFTEQTAPKIFGGEIKTHILLFLPKSVSD 149

Query: 134 CTNYWRNRILKVAKGFADKFTFAISAKD--DFQHELNEFGFDYVPSDKPLVFVRAEDGKK 191
             +   +     A+ F  K  F     D  D Q  L  FG          +    E+  K
Sbjct: 150 Y-DGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTK 208

Query: 192 YAMK-DEFSVENLESFLTKVVAGEVDPYIKSEPVPEDNS-GPVKVAVAKNFDEVVTNNEK 249
           Y  + +E + E +  F  + + G++ P++ S+ +PED    PVKV V KNF++V  + +K
Sbjct: 209 YKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKK 268

Query: 250 DVLVEFYAPWCGHCKKLTPVYEEVGEK 276
           +V VEFYAPWCGHCK+L P+++++GE 
Sbjct: 269 NVFVEFYAPWCGHCKQLAPIWDKLGET 295


>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Length = 252 Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Length = 252 Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} Length = 127 Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} Length = 127 Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Length = 121 Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Length = 121 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 133 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 133 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Length = 250 Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Length = 250 Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Length = 133 Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Length = 133 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 140 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 140 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Length = 120 Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Length = 120 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A Length = 111 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A Length = 111 Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Length = 122 Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Length = 122 Back     alignment and structure
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Length = 147 Back     alignment and structure
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Length = 147 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Length = 470 Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Length = 470 Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Length = 240 Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Length = 240 Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Length = 119 Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Length = 119 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Length = 135 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Length = 135 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Length = 155 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Length = 155 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Length = 148 Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Length = 148 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Length = 110 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Length = 110 Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} Length = 111 Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} Length = 111 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Length = 112 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Length = 112 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Length = 140 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Length = 140 Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Length = 128 Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Length = 128 Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Length = 115 Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Length = 115 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Length = 121 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Length = 121 Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Length = 107 Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Length = 107 Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Length = 105 Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Length = 105 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Length = 106 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Length = 106 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Length = 108 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Length = 108 Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Length = 140 Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Length = 140 Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Length = 128 Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Length = 128 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Length = 107 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Length = 107 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Length = 121 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Length = 121 Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Length = 104 Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Length = 104 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} Length = 109 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} Length = 109 Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Length = 118 Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Length = 118 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Length = 136 Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Length = 136 Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Length = 105 Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Length = 105 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Length = 109 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Length = 109 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Length = 105 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Length = 114 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Length = 153 Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Length = 153 Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Length = 117 Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Length = 109 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Length = 125 Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Length = 112 Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Length = 112 Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Length = 106 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Length = 104 Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Length = 141 Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Length = 116 Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Length = 112 Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Length = 142 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Length = 106 Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Length = 107 Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Length = 118 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Length = 112 Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Length = 130 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Length = 105 Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Length = 133 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Length = 113 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Length = 122 Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Length = 123 Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Length = 123 Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Length = 139 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Length = 85 Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 135 Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 135 Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Length = 118 Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Length = 118 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Length = 118 Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Length = 118 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134 Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Length = 164 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Length = 85 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 100.0
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 100.0
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 100.0
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 100.0
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 99.97
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 99.97
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 99.96
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 99.96
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 99.95
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 99.92
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 99.92
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 99.92
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 99.91
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 99.91
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 99.89
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 99.89
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 99.89
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 99.88
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 99.87
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 99.86
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 99.86
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 99.86
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 99.84
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 99.84
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 99.82
2qsi_A137 Putative hydrogenase expression/formation protein; 99.81
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 99.81
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 99.81
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 99.81
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 99.8
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 99.8
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 99.79
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 99.79
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 99.79
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 99.79
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 99.79
2l5l_A136 Thioredoxin; structural genomics, electron transpo 99.79
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 99.78
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 99.78
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 99.78
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 99.78
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 99.78
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 99.78
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 99.78
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 99.77
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 99.77
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 99.77
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 99.77
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 99.77
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 99.77
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 99.76
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 99.76
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 99.76
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 99.76
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 99.76
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 99.76
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 99.76
4euy_A105 Uncharacterized protein; structural genomics, PSI- 99.76
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 99.76
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.75
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 99.75
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 99.75
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 99.75
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 99.74
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 99.74
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 99.74
2yzu_A109 Thioredoxin; redox protein, electron transport, st 99.74
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 99.73
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 99.73
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 99.73
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 99.73
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 99.72
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 99.72
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 99.72
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 99.71
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 99.71
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 99.71
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 99.71
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.71
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.71
1mek_A120 Protein disulfide isomerase; electron transport, r 99.71
2c0g_A248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 99.7
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 99.7
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 99.7
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 99.7
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 99.7
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 99.7
2l57_A126 Uncharacterized protein; structural genomics, unkn 99.69
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 99.69
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 99.69
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 99.69
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 99.68
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 99.68
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 99.68
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 99.67
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 99.67
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 99.66
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 99.66
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 99.66
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 99.66
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 99.47
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.66
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 99.65
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 99.65
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 99.65
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 99.65
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 99.64
1zma_A118 Bacterocin transport accessory protein; alpha-beta 99.64
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 99.64
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.63
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 99.61
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 99.61
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 99.6
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 99.58
2kuc_A130 Putative disulphide-isomerase; structural genomics 99.58
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 99.57
1wmj_A130 Thioredoxin H-type; structural genomics, program f 99.56
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 99.54
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 99.54
3f9u_A172 Putative exported cytochrome C biogenesis-related; 99.51
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 99.48
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 99.48
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 99.47
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 99.47
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 99.2
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 99.46
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 99.46
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 99.46
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 99.46
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 99.45
3raz_A151 Thioredoxin-related protein; structural genomics, 99.45
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 99.43
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 99.41
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 99.4
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 99.39
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 99.39
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 99.39
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 99.38
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 99.38
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 99.37
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 99.37
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 99.37
2l5o_A153 Putative thioredoxin; structural genomics, unknown 99.36
2lrn_A152 Thiol:disulfide interchange protein; structural ge 99.35
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfi 99.34
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 99.34
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 99.34
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 99.34
4evm_A138 Thioredoxin family protein; structural genomics, n 99.33
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 99.33
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 99.32
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 99.31
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 99.31
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 99.28
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 99.28
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 99.27
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 99.27
1ttz_A87 Conserved hypothetical protein; structural genomic 99.27
3ira_A173 Conserved protein; methanosarcina mazei,structural 99.27
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 99.26
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 99.25
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 99.25
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 99.25
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 99.25
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 99.23
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfi 99.23
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 99.22
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 99.21
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 99.21
2ywi_A196 Hypothetical conserved protein; uncharacterized co 99.21
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 99.21
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 99.2
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 99.19
2lrt_A152 Uncharacterized protein; structural genomics, thio 99.19
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 99.17
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 99.17
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 99.17
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 99.16
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 99.15
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.14
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 99.14
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 99.14
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.14
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 99.13
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.13
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 99.12
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 99.12
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 99.12
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 99.11
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 99.11
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 99.1
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.09
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 99.09
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 99.09
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 99.06
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 99.05
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 99.04
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 99.04
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 99.03
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 99.03
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 99.03
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 99.03
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 99.03
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 99.02
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 99.02
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 99.02
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 99.02
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 99.02
2qsi_A137 Putative hydrogenase expression/formation protein; 99.02
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 99.02
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 99.01
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 99.01
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 99.01
2l5l_A136 Thioredoxin; structural genomics, electron transpo 99.01
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 99.01
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 99.0
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 99.0
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 98.99
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 98.99
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 98.99
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 98.99
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 98.99
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 98.99
2ls5_A159 Uncharacterized protein; structural genomics, unkn 98.54
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 98.99
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 98.99
3ga4_A 178 Dolichyl-diphosphooligosaccharide-protein glycosyl 98.98
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 98.52
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 98.96
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 98.96
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 98.96
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 98.96
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 98.95
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 98.95
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 98.94
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 98.94
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 98.94
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 98.94
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 98.94
1zma_A118 Bacterocin transport accessory protein; alpha-beta 98.93
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 98.92
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 98.92
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 98.91
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 98.91
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.91
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 98.91
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 98.91
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 98.9
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 98.9
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 98.9
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 98.9
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 98.9
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 98.89
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 98.89
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 98.89
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 98.89
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 98.89
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 98.89
2yzu_A109 Thioredoxin; redox protein, electron transport, st 98.87
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 98.86
1mek_A120 Protein disulfide isomerase; electron transport, r 98.86
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 98.86
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 98.86
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 98.86
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 98.85
4euy_A105 Uncharacterized protein; structural genomics, PSI- 98.85
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.85
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 98.84
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 98.83
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 98.82
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 98.82
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 98.8
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 98.8
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.8
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 98.79
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 98.79
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 98.78
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 98.77
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 98.77
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 98.76
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 98.75
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 98.75
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 98.74
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 98.74
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 98.72
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 98.72
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 98.71
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 98.71
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 98.71
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 98.71
2jsy_A167 Probable thiol peroxidase; solution structure, ant 98.7
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 98.7
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 98.16
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 98.69
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 98.68
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 98.65
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 98.64
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 98.64
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 98.63
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 98.61
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 98.6
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 98.59
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 98.58
1wmj_A130 Thioredoxin H-type; structural genomics, program f 98.53
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 98.51
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 98.48
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 98.46
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 98.43
2kuc_A130 Putative disulphide-isomerase; structural genomics 98.43
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 98.41
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 98.4
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 98.39
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.38
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 98.37
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 98.37
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 98.35
3f9u_A172 Putative exported cytochrome C biogenesis-related; 98.35
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 98.35
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 98.34
2c0g_A 248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 98.33
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 98.32
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 98.3
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 98.29
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 98.28
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 98.28
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 98.27
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 98.26
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 98.25
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 98.25
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 98.25
3me7_A170 Putative uncharacterized protein; electron transfe 98.23
3raz_A151 Thioredoxin-related protein; structural genomics, 98.22
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 98.2
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 98.2
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 98.2
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 98.17
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 97.47
1psq_A163 Probable thiol peroxidase; structural genomics, NY 98.17
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 98.16
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 98.16
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 98.14
1kte_A105 Thioltransferase; redox-active center, electron tr 98.14
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 98.14
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 98.13
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 98.13
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 98.13
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 98.12
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 98.12
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 98.11
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 98.11
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 98.11
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 98.1
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 98.08
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 98.06
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 98.03
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 98.03
3ira_A 173 Conserved protein; methanosarcina mazei,structural 98.03
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 98.03
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 98.01
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 98.01
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 98.01
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 98.0
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 97.99
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 97.99
2lrn_A152 Thiol:disulfide interchange protein; structural ge 97.98
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 97.98
4evm_A138 Thioredoxin family protein; structural genomics, n 97.98
2l57_A126 Uncharacterized protein; structural genomics, unkn 97.97
3or5_A 165 Thiol:disulfide interchange protein, thioredoxin p 97.97
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 97.97
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 97.96
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 97.96
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 97.96
2lrt_A152 Uncharacterized protein; structural genomics, thio 97.95
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 97.95
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 97.95
2f8a_A 208 Glutathione peroxidase 1; thioredoxin fold, struct 97.94
3kij_A 180 Probable glutathione peroxidase 8; human PDI-perox 97.94
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 97.93
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 97.17
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 97.93
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 97.93
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 97.92
2l5o_A153 Putative thioredoxin; structural genomics, unknown 97.91
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 97.89
2p31_A 181 CL683, glutathione peroxidase 7; thioredoxin fold, 97.89
2v1m_A 169 Glutathione peroxidase; selenium, selenocysteine, 97.88
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 97.88
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 97.88
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 97.87
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 97.87
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 97.86
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 97.86
2p5q_A 170 Glutathione peroxidase 5; thioredoxin fold, oxidor 97.86
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 97.83
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 97.83
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 97.83
3dwv_A 187 Glutathione peroxidase-like protein; alpha beta, 3 97.83
2cvb_A 188 Probable thiol-disulfide isomerase/thioredoxin; re 97.81
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 97.81
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 97.8
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 97.79
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 97.78
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 97.77
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 97.76
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 97.76
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 97.76
2vup_A 190 Glutathione peroxidase-like protein; oxidoreductas 97.76
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 97.76
2obi_A 183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 97.76
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 97.76
3cmi_A 171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 97.74
2gs3_A 185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 97.74
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 97.7
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 97.69
2ywi_A 196 Hypothetical conserved protein; uncharacterized co 97.69
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 97.69
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 97.69
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 97.68
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 97.67
2ls5_A159 Uncharacterized protein; structural genomics, unkn 96.84
2k6v_A 172 Putative cytochrome C oxidase assembly protein; th 97.67
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 97.66
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 97.64
1z6m_A175 Conserved hypothetical protein; structural genomic 97.64
3u5r_E 218 Uncharacterized protein; structural genomics, PSI- 97.64
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 97.61
4dvc_A184 Thiol:disulfide interchange protein DSBA; pilus as 97.58
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 97.58
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 97.57
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 97.57
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.56
1kte_A105 Thioltransferase; redox-active center, electron tr 97.56
1eej_A 216 Thiol:disulfide interchange protein; oxidoreductas 97.54
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 97.5
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 97.49
3drn_A 161 Peroxiredoxin, bacterioferritin comigratory prote 97.48
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 97.47
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 97.44
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 97.42
2i3y_A 215 Epididymal secretory glutathione peroxidase; thior 97.39
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 97.38
2jsy_A167 Probable thiol peroxidase; solution structure, ant 97.35
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 97.34
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; 97.31
3keb_A224 Probable thiol peroxidase; structural genomics, AP 97.31
1we0_A 187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 97.31
1qmv_A 197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 97.29
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 97.29
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.27
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 97.27
2b7k_A 200 SCO1 protein; metallochaperone, cytochrome C oxida 97.26
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 97.26
1xzo_A 174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 97.26
2bmx_A 195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 97.26
1zof_A 198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 97.24
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 97.24
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 97.23
2r37_A 207 Glutathione peroxidase 3; plasma, structural genom 97.21
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 97.21
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 97.08
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 97.08
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 97.08
1uul_A 202 Tryparedoxin peroxidase homologue; peroxiredoxin, 97.07
2i81_A 213 2-Cys peroxiredoxin; structural genomics consortiu 97.05
3ztl_A 222 Thioredoxin peroxidase; oxidoreductase, reductase, 97.05
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 97.02
2h01_A 192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 97.02
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 96.99
1psq_A163 Probable thiol peroxidase; structural genomics, NY 96.98
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 96.98
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 96.96
2pn8_A 211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 96.95
2c0d_A 221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 96.92
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 96.92
1zye_A 220 Thioredoxin-dependent peroxide reductase; catenane 96.91
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 96.88
1xvq_A 175 Thiol peroxidase; thioredoxin fold, structural gen 96.88
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 96.88
2wfc_A 167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 96.87
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 96.86
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-lik 96.86
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 96.85
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 96.83
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 96.81
4eo3_A 322 Bacterioferritin comigratory protein/NADH dehydro; 96.81
3feu_A185 Putative lipoprotein; alpha-beta structure, struct 96.79
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 96.75
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 96.75
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 96.74
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 96.74
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 96.71
1nm3_A 241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 96.69
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 96.61
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 96.59
1v58_A 241 Thiol:disulfide interchange protein DSBG; reduced 96.57
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 96.51
3me7_A 170 Putative uncharacterized protein; electron transfe 96.5
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 96.39
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 96.33
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
Probab=100.00  E-value=3.3e-41  Score=294.73  Aligned_cols=245  Identities=28%  Similarity=0.532  Sum_probs=210.6

Q ss_pred             cchhhHHHHHHHHHHHhcCCceEEEEEcccchHHHhhhcCCCCCCCCCcEEEEEcC-CC-CcccCCCCCCHHHHHHHHHH
Q psy9102           3 KTGTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAE-DG-KKYAMKDEFSVENLESFLTK   80 (277)
Q Consensus         3 ~~~~~~~~~~f~~~A~~~~~~~~f~~~~~~~~~~~~~~~~v~~~~~~~P~~~~~~~-~~-~~y~~~g~~~~~~i~~fi~~   80 (277)
                      ++......++|.++|..+ +++.|+++++.++   |+.+|++.   +. +++|++. ++ ..|  +|+++.++|.+||..
T Consensus        44 ~~~~~~~~~~f~~~A~~~-~~~~F~~t~~~~v---~~~~~v~~---~~-i~lfk~f~~~~~~~--~g~~~~~~i~~fi~~  113 (361)
T 3uem_A           44 KDVESDSAKQFLQAAEAI-DDIPFGITSNSDV---FSKYQLDK---DG-VVLFKKFDEGRNNF--EGEVTKENLLDFIKH  113 (361)
T ss_dssp             SCTTSHHHHHHHHHHHHC-SSSCEEEECCHHH---HHHTTCSS---SE-EEEEESSTTSEEEC--CSCCCHHHHHHHHHH
T ss_pred             cCCCchHHHHHHHHHhcC-CCceEEEECcHHH---HHHhCCCC---Ce-EEEEEecCCCcccc--CCcCCHHHHHHHHHH
Confidence            344556678999999999 7899999999888   99999995   43 8888873 44 778  899999999999999


Q ss_pred             HhcCCCCccccCCCCCCCCCCCeEEeecccceeeeecCCccEEEEEecCCChhhhhhhHHHHHHHHhhcCCcceEEEecc
Q psy9102          81 VVAGEVDPYIKSEPVPEDNSGPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCTNYWRNRILKVAKGFADKFTFAISAK  160 (277)
Q Consensus        81 ~~~~~~~~~~~s~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~v~F~~~~c~~c~~~~~~~~~~la~~~~~~i~~~~vd~  160 (277)
                      +..|.+.+      +           +.+++...+....++++|+||++||++|+++ .+.|.++|++|++++.|+.+|+
T Consensus       114 ~~~p~v~~------~-----------~~~~~~~~~~~~~~~~~v~F~~~~~~~~~~~-~~~~~~~A~~~~~~i~f~~vd~  175 (361)
T 3uem_A          114 NQLPLVIE------F-----------TEQTAPKIFGGEIKTHILLFLPKSVSDYDGK-LSNFKTAAESFKGKILFIFIDS  175 (361)
T ss_dssp             HSSCSEEE------C-----------STTTHHHHHSCSCCEEEEEECCSSSSSHHHH-HHHHHHHHGGGTTTCEEEEECT
T ss_pred             cCCCccee------c-----------CcccHHHHhcCCCCcEEEEEEeCCchhHHHH-HHHHHHHHHHccCceEEEEecC
Confidence            99886655      3           4445555555555678999999999999999 6999999999999999999999


Q ss_pred             c--ccchhhhccCcccCCCCCCeEEEEcCCCc--eeeec-CCCCHHHHHHHHHHHhcCCCCCCCCCCCCCCC-CCCCeEe
Q psy9102         161 D--DFQHELNEFGFDYVPSDKPLVFVRAEDGK--KYAMK-DEFSVENLESFLTKVVAGEVDPYIKSEPVPED-NSGPVKV  234 (277)
Q Consensus       161 ~--~~~~~~~~~~i~~~~~~~P~i~~~~~~~~--~~~~~-g~~~~~~l~~fi~~~~~~~~~~~~ks~~~p~~-~~~~v~~  234 (277)
                      +  .++.+++.|||+.  .++|++++++.++.  +|.+. |.++.+.|.+|++++++|++++.++|+++|+. ....|..
T Consensus       176 ~~~~~~~~~~~fgi~~--~~~P~~~~~~~~~~~~ky~~~~~~~~~~~l~~fi~~~l~g~~~~~~~s~~~p~~~~~~~v~~  253 (361)
T 3uem_A          176 DHTDNQRILEFFGLKK--EECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKV  253 (361)
T ss_dssp             TSGGGHHHHHHTTCCT--TTCSEEEEEECC--CCEECCSSCCCCHHHHHHHHHHHHTTCSCCCCBCCCCCTTTTTSSSEE
T ss_pred             ChHHHHHHHHHcCCCc--cCCccEEEEEcCCcccccCCCccccCHHHHHHHHHHHhcCCCcccccCCCCCcccccCCcEE
Confidence            9  6889999999985  56999988886443  44443 78999999999999999999999999999987 6778999


Q ss_pred             cchhcHHHHhhcCCCcEEEEEECCCCHHHhhhhHHHHHHHhhC
Q psy9102         235 AVAKNFDEVVTNNEKDVLVEFYAPWCGHCKKLTPVYEEVGEKA  277 (277)
Q Consensus       235 l~~~~f~~~v~~~~~~~lV~f~apwC~~c~~~~p~~~~la~~~  277 (277)
                      +++++|++.+.+.+++++|+||||||+||+++.|.|++||+.|
T Consensus       254 l~~~~f~~~~~~~~k~~lv~f~a~wC~~C~~~~p~~~~la~~~  296 (361)
T 3uem_A          254 LVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETY  296 (361)
T ss_dssp             ECTTTHHHHHTCTTCEEEEEEECTTCHHHHHHHHHHHHHHHHT
T ss_pred             eecCchhhhcccCCCcEEEEEecCcCHhHHHHHHHHHHHHHHh
Confidence            9999999999888899999999999999999999999999865



>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 277
d2djka1133 c.47.1.2 (A:1-133) Protein disulfide isomerase, PD 6e-20
d2djka1133 c.47.1.2 (A:1-133) Protein disulfide isomerase, PD 8e-20
d2b5ea1140 c.47.1.2 (A:365-504) Protein disulfide isomerase, 7e-16
d2b5ea1140 c.47.1.2 (A:365-504) Protein disulfide isomerase, 3e-13
d2djja1116 c.47.1.2 (A:6-121) Protein disulfide isomerase, PD 3e-12
d2djja1116 c.47.1.2 (A:6-121) Protein disulfide isomerase, PD 9e-11
d2b5ea3125 c.47.1.2 (A:240-364) Protein disulfide isomerase, 5e-10
d2b5ea3125 c.47.1.2 (A:240-364) Protein disulfide isomerase, 5e-10
d2c0ga2122 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal doma 9e-10
d2c0ga2122 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal doma 5e-09
d2trxa_108 c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId 3e-09
d2trxa_108 c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId 9e-08
d1meka_120 c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu 3e-09
d1meka_120 c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu 3e-06
d1thxa_108 c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 2e-08
d1thxa_108 c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 6e-06
d2b5ea4119 c.47.1.2 (A:23-141) Protein disulfide isomerase, P 2e-07
d2b5ea4119 c.47.1.2 (A:23-141) Protein disulfide isomerase, P 1e-04
d1g7ea_122 c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, 5e-07
d1g7ea_122 c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, 2e-05
d1nw2a_105 c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidoc 1e-06
d2hfda1132 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H 1e-06
d2hfda1132 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H 0.001
d1a8ya1124 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctola 3e-06
d1a8ya1124 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctola 1e-05
d2es7a1119 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein H 4e-06
d1dbya_107 c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt 4e-06
d1dbya_107 c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt 2e-05
d1qgva_137 c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human 5e-06
d1qgva_137 c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human 1e-04
d1fb6a_104 c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera 5e-06
d1fb6a_104 c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera 3e-05
d1zmaa1115 c.47.1.1 (A:1-115) Bacterocin transport accessory 6e-06
d1zmaa1115 c.47.1.1 (A:1-115) Bacterocin transport accessory 2e-05
d1ep7a_112 c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt 8e-06
d1f9ma_112 c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera 2e-05
d1f9ma_112 c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera 3e-05
d1nhoa_85 c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-lik 2e-05
d1xfla_114 c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsi 5e-05
d1xfla_114 c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsi 0.002
d2ifqa1105 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapien 8e-05
d1gh2a_107 c.47.1.1 (A:) Thioredoxin-like protein, N-terminal 1e-04
d1gh2a_107 c.47.1.1 (A:) Thioredoxin-like protein, N-terminal 0.003
d1wjka_100 c.47.1.1 (A:) Thioredoxin-like structure containin 1e-04
d2trcp_217 c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [ 1e-04
d2trcp_217 c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [ 2e-04
d1z5ye1136 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG 1e-04
d1syra_103 c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plas 2e-04
d1a8la2107 c.47.1.2 (A:120-226) Protein disulfide isomerase, 3e-04
d1ti3a_113 c.47.1.1 (A:) Thioredoxin {European aspen (Populus 6e-04
d1r26a_113 c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [Tax 0.001
d1r26a_113 c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [Tax 0.003
d1hyua496 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase 0.002
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 133 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: PDI-like
domain: Protein disulfide isomerase, PDI
species: Fungi (Humicola insolens) [TaxId: 34413]
 Score = 81.5 bits (201), Expect = 6e-20
 Identities = 19/99 (19%), Positives = 35/99 (35%), Gaps = 3/99 (3%)

Query: 5   GTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKPLVFVRAEDGKKYA 64
                 +++  +A+       F       F                          +K+ 
Sbjct: 36  ERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNL-KTDKFPAFAIQEVAKNQKFP 94

Query: 65  MKD--EFSVENLESFLTKVVAGEVDPYIKSEPVPEDNSG 101
                E + E +++F+   VAG+++P IKSEP+PE   G
Sbjct: 95  FDQEKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQEG 133


>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 133 Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 125 Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 125 Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Length = 108 Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Length = 108 Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 119 Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 119 Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Length = 105 Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 124 Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 124 Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Length = 119 Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 107 Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 107 Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Length = 104 Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Length = 104 Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 112 Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Length = 112 Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Length = 112 Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 85 Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 114 Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 114 Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 217 Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 217 Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Length = 136 Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 103 Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 107 Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Length = 113 Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Length = 113 Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Length = 113 Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 96 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.89
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 99.88
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.88
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.88
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.88
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.85
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 99.84
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 99.82
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.8
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 99.8
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.79
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.77
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.77
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 99.77
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 99.77
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.75
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 99.74
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 99.73
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.73
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 99.72
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.72
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 99.71
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 99.71
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 99.7
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 99.69
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 99.67
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 99.64
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 99.62
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 99.61
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 99.59
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 99.55
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 99.51
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 99.5
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 99.42
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.37
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.37
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.37
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.36
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.35
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 99.34
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 99.31
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.3
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.3
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 99.28
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 99.25
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 99.24
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.22
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 99.21
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 99.2
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 99.2
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 99.2
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.18
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 99.12
d1wjka_100 Thioredoxin-like structure containing protein C330 99.1
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 99.09
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 99.06
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 99.05
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.05
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.05
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.04
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.03
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 99.03
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.02
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 98.99
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 98.98
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 98.97
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 98.95
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 98.95
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 98.92
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.89
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 98.88
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 98.85
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 98.83
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 98.78
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 98.76
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 98.74
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 98.72
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 98.66
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.6
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 98.59
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 98.55
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 98.54
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.41
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 98.37
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 98.37
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 98.33
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 98.29
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 98.25
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 98.24
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 98.17
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 98.16
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 98.15
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 98.1
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 98.08
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 98.03
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 98.03
d2cvba1 187 Probable thiol-disulfide isomerase/thioredoxin TTH 97.99
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 97.98
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 97.98
d1wjka_100 Thioredoxin-like structure containing protein C330 97.93
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 97.87
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 97.85
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 97.76
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 97.7
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 97.69
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 97.68
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 97.67
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 97.67
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 97.63
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 97.62
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 97.62
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 97.59
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 97.5
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 97.47
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 97.46
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 97.41
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 97.36
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 97.35
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 97.33
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 97.32
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 97.3
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 97.23
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 97.23
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 97.21
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 97.18
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 97.17
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 97.06
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 96.96
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 96.84
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 96.82
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 96.8
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 96.78
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 96.67
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 96.58
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 96.56
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 96.56
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 96.45
d1a8ya3119 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 96.32
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 96.3
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 96.18
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 96.01
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 95.78
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 95.72
d1e2ya_ 167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 95.48
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 95.31
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 95.23
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 95.15
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 95.13
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 95.0
d1we0a1 166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 94.91
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 94.68
d1eeja1 156 Disulfide bond isomerase, DsbC, C-terminal domain 94.62
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 94.59
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 94.5
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 94.43
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 94.32
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 94.16
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 93.72
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 93.67
d1xzoa1 172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 93.57
d1a8ya3119 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 93.57
d1zyea1 158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 93.56
d2b5ea298 Protein disulfide isomerase, PDI {Baker's yeast (S 92.99
d1v58a1 169 Thiol:disulfide interchange protein DsbG, C-termin 92.8
d1zofa1 170 Thioredoxin reductase TsaA {Helicobacter pylori [T 92.79
d1uula_ 194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 92.49
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 91.69
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 91.58
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 90.52
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 90.51
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 88.79
d1hyua3102 Alkyl hydroperoxide reductase subunit F (AhpF), N- 87.87
d1qmva_ 197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 83.3
d1xg8a_111 Hypothetical protein SA0798 {Staphylococcus aureus 82.38
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 82.17
d1t4za_105 Adaptive-response sensory-kinase SasA, N-terminal 80.83
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Thioredoxin
species: Anabaena sp., pcc 7120 [TaxId: 1167]
Probab=99.89  E-value=3e-23  Score=147.97  Aligned_cols=107  Identities=21%  Similarity=0.326  Sum_probs=98.4

Q ss_pred             CCeEEeecccceeeeecCCccEEEEEecCCChhhhhhhHHHHHHHHhhcCCcceEEEecccccchhhhccCcccCCCCCC
Q psy9102         101 GPVKVAVAKNFDEVVTNNEKDVLVEFYAPWCGHCTNYWRNRILKVAKGFADKFTFAISAKDDFQHELNEFGFDYVPSDKP  180 (277)
Q Consensus       101 ~~i~~~~~~~~~~~~~~~~~~~~v~F~~~~c~~c~~~~~~~~~~la~~~~~~i~~~~vd~~~~~~~~~~~~i~~~~~~~P  180 (277)
                      ..|.+++..+|+..+.+++++++|.||++||++|+.+ .+.+.+++.++.+.+.|+.||+++++.+++.|+|++    +|
T Consensus         2 ~~V~~lt~~~f~~~v~~~~~~vlv~f~a~wC~~C~~~-~~~~~~~~~~~~~~~~~~~vd~d~~~~l~~~~~I~~----~P   76 (108)
T d1thxa_           2 KGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLM-SPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEG----VP   76 (108)
T ss_dssp             CSEEECCGGGHHHHTTTCSSCEEEEEECTTCTTHHHH-HHHHHHHHHHTTTTCEEEEEESTTCHHHHHHTTCCS----SS
T ss_pred             CCceECCHHHHHHHHHhCCCcEEEEEECCCCCCcccc-chHHHHHHHhcCCcceeceecccccHHHHHHhcccC----CC
Confidence            4588999999999888888999999999999999999 699999999999999999999999999999999998    99


Q ss_pred             eEEEEcCCCceeeecCCCCHHHHHHHHHHHhc
Q psy9102         181 LVFVRAEDGKKYAMKDEFSVENLESFLTKVVA  212 (277)
Q Consensus       181 ~i~~~~~~~~~~~~~g~~~~~~l~~fi~~~~~  212 (277)
                      |+++++++....++.|..+.++|.+||+++++
T Consensus        77 t~~~~~~g~~v~~~~G~~~~~~l~~~i~~~Ln  108 (108)
T d1thxa_          77 ALRLVKGEQILDSTEGVISKDKLLSFLDTHLN  108 (108)
T ss_dssp             EEEEEETTEEEEEEESCCCHHHHHHHHHHHHC
T ss_pred             EEEEEECCEEEEEEeCCCCHHHHHHHHHHhcC
Confidence            99999865556788999999999999999874



>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1a8ya3 c.47.1.3 (A:229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a8ya3 c.47.1.3 (A:229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2b5ea2 c.47.1.2 (A:142-239) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hyua3 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t4za_ c.47.1.15 (A:) Adaptive-response sensory-kinase SasA, N-terminal domain {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure