Psyllid ID: psy9117

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-
MYLLFNLVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLY
cEEHHHHHHcccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccc
ccccHHHHHHccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHH
MYLLFNLVTLSFEVTQQKEIDEFMIkldgtenkskfganAILGVSLAVAKAgaakkgvply
MYLLFNLVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAkagaakkgvply
MYLLFNLVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAIlgvslavakagaakkgvplY
*YLLFNLVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAK***********
MYLLFNLVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLY
MYLLFNLVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLY
MYLLFNLVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLLFNLVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query61
UNIPROTKB|K7EM90195 ENO1 "Enolase" [Homo sapiens ( 0.573 0.179 0.657 1.4e-07
UNIPROTKB|E5RG95154 ENO3 "Beta-enolase" [Homo sapi 0.573 0.227 0.628 4.8e-07
UNIPROTKB|E5RI09148 ENO3 "Beta-enolase" [Homo sapi 0.573 0.236 0.628 4.8e-07
UNIPROTKB|K7EPM1196 ENO3 "Enolase" [Homo sapiens ( 0.573 0.178 0.628 5.8e-07
UNIPROTKB|J9NVW8143 J9NVW8 "Uncharacterized protei 0.573 0.244 0.628 7.8e-07
UNIPROTKB|K7EKN2212 ENO3 "Enolase" [Homo sapiens ( 0.573 0.165 0.628 8.1e-07
FB|FBgn0000579 500 Eno "Enolase" [Drosophila mela 0.573 0.07 0.685 8.7e-07
UNIPROTKB|P06733 434 ENO1 "Alpha-enolase" [Homo sap 0.573 0.080 0.657 1.2e-06
ZFIN|ZDB-GENE-031006-5 467 eno3 "enolase 3, (beta, muscle 0.573 0.074 0.628 1.3e-06
POMBASE|SPBC1815.01 439 eno101 "enolase (predicted)" [ 0.573 0.079 0.657 1.5e-06
UNIPROTKB|K7EM90 ENO1 "Enolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 120 (47.3 bits), Expect = 1.4e-07, P = 1.4e-07
 Identities = 23/35 (65%), Positives = 30/35 (85%)

Query:     7 LVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAI 41
             LV+    VT+Q++ID+ MI++DGTENKSKFGANAI
Sbjct:    77 LVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAI 111
GO:0000015 "phosphopyruvate hydratase complex" evidence=IEA
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0004634 "phosphopyruvate hydratase activity" evidence=IEA
GO:0006096 "glycolysis" evidence=IEA
UNIPROTKB|E5RG95 ENO3 "Beta-enolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E5RI09 ENO3 "Beta-enolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7EPM1 ENO3 "Enolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NVW8 J9NVW8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|K7EKN2 ENO3 "Enolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0000579 Eno "Enolase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P06733 ENO1 "Alpha-enolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031006-5 eno3 "enolase 3, (beta, muscle)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPBC1815.01 eno101 "enolase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query61
cd03313 408 cd03313, enolase, Enolase: Enolases are homodimeri 5e-28
pfam03952132 pfam03952, Enolase_N, Enolase, N-terminal domain 1e-27
PRK00077 425 PRK00077, eno, enolase; Provisional 1e-25
PLN00191 457 PLN00191, PLN00191, enolase 1e-23
COG0148 423 COG0148, Eno, Enolase [Carbohydrate transport and 4e-23
TIGR01060 425 TIGR01060, eno, phosphopyruvate hydratase 1e-20
PTZ00081 439 PTZ00081, PTZ00081, enolase; Provisional 1e-19
PRK08350 341 PRK08350, PRK08350, hypothetical protein; Provisio 2e-11
>gnl|CDD|239429 cd03313, enolase, Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways Back     alignment and domain information 
 Score =  102 bits (256), Expect = 5e-28
 Identities = 35/50 (70%), Positives = 41/50 (82%)

Query: 12  FEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLY 61
            +VT Q+ ID+ +I+LDGT NKSK GANAILGVSLAVAKA AA  G+PLY
Sbjct: 77  MDVTDQRAIDKLLIELDGTPNKSKLGANAILGVSLAVAKAAAAALGLPLY 126

The reaction is facilitated by the presence of metal ions. Length = 408
>gnl|CDD|202827 pfam03952, Enolase_N, Enolase, N-terminal domain Back     alignment and domain information
>gnl|CDD|234617 PRK00077, eno, enolase; Provisional Back     alignment and domain information
>gnl|CDD|215095 PLN00191, PLN00191, enolase Back     alignment and domain information
>gnl|CDD|223226 COG0148, Eno, Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213580 TIGR01060, eno, phosphopyruvate hydratase Back     alignment and domain information
>gnl|CDD|240259 PTZ00081, PTZ00081, enolase; Provisional Back     alignment and domain information
>gnl|CDD|169397 PRK08350, PRK08350, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 61
PF03952132 Enolase_N: Enolase, N-terminal domain; InterPro: I 99.94
PRK08350 341 hypothetical protein; Provisional 99.92
COG0148 423 Eno Enolase [Carbohydrate transport and metabolism 99.91
KOG2670|consensus 433 99.89
PTZ00378 518 hypothetical protein; Provisional 99.87
PLN00191 457 enolase 99.86
PTZ00081 439 enolase; Provisional 99.84
cd03313 408 enolase Enolase: Enolases are homodimeric enzymes 99.74
PRK00077 425 eno enolase; Provisional 99.71
TIGR01060 425 eno phosphopyruvate hydratase. Alternate name: eno 99.66
cd03327 341 MR_like_2 Mandelate racemase (MR)-like subfamily o 97.13
cd03317 354 NAAAR N-acylamino acid racemase (NAAAR), an octame 95.65
PRK15440 394 L-rhamnonate dehydratase; Provisional 95.35
TIGR01502 408 B_methylAsp_ase methylaspartate ammonia-lyase. Thi 95.24
cd03328 352 MR_like_3 Mandelate racemase (MR)-like subfamily o 94.71
PF02746117 MR_MLE_N: Mandelate racemase / muconate lactonizin 94.66
cd03314 369 MAL Methylaspartate ammonia lyase (3-methylasparta 94.48
PRK15072 404 bifunctional D-altronate/D-mannonate dehydratase; 94.32
cd03329 368 MR_like_4 Mandelate racemase (MR)-like subfamily o 94.11
cd03316 357 MR_like Mandelate racemase (MR)-like subfamily of 93.91
cd03322 361 rpsA The starvation sensing protein RpsA from E.co 93.53
cd03321 355 mandelate_racemase Mandelate racemase (MR) catalyz 92.58
cd03325 352 D-galactonate_dehydratase D-galactonate dehydratas 91.62
cd03318 365 MLE Muconate Lactonizing Enzyme (MLE), an homoocta 91.46
COG4948 372 L-alanine-DL-glutamate epimerase and related enzym 91.45
cd03324 415 rTSbeta_L-fuconate_dehydratase Human rTS beta is e 91.0
PRK14017 382 galactonate dehydratase; Provisional 90.6
TIGR03247 441 glucar-dehydr glucarate dehydratase. Glucarate deh 89.87
TIGR01928 324 menC_lowGC/arch o-succinylbenzoic acid (OSB) synth 89.65
cd03326 385 MR_like_1 Mandelate racemase (MR)-like subfamily o 88.92
cd03319 316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 87.7
TIGR02534 368 mucon_cyclo muconate and chloromuconate cycloisome 87.6
PF05034159 MAAL_N: Methylaspartate ammonia-lyase N-terminus; 87.37
>PF03952 Enolase_N: Enolase, N-terminal domain; InterPro: IPR020811 Enolase (2-phospho-D-glycerate hydrolase) is an essential glycolytic enzyme that catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate [, ] Back     alignment and domain information 
Probab=99.94  E-value=3e-27  Score=152.44  Aligned_cols=58  Identities=60%  Similarity=0.879  Sum_probs=53.6

Q ss_pred             hhhhhHHhCCCCcccHHHHHHHHHhhhCCCCCCccchHHHHHHHHHHHHHHHHhhCCCCC
Q psy9117           2 YLLFNLVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLY   61 (61)
Q Consensus         2 ~i~p~L~~~g~~~~dQ~~iD~~L~~lDgT~nks~lGaNailavSlA~a~AaA~~~~~pLy   61 (61)
                      .|+|+|+  |++++||++||++|+++|||+||+++|+|+++|||||+|||+|+.+++|||
T Consensus        72 ~i~~~L~--g~~~~dQ~~iD~~L~~lDgT~nk~~lGaNa~lavS~A~a~AaA~~~~~pL~  129 (132)
T PF03952_consen   72 IIAPALI--GLDPTDQEEIDQILIELDGTPNKSRLGANAILAVSLAVAKAAAAAKGIPLY  129 (132)
T ss_dssp             THHHHHT--TSBTT-HHHHHHHHHHHHTSTTSTTT-HHHHHHHHHHHHHHHHHHHTS-HH
T ss_pred             HHHHHHH--hcchhhHHHhCccceeccCChhhhcccchHHHHHHHHHHHHHHHHcCCChh
Confidence            4789999  899999999999999999999999999999999999999999999999998

In vertebrates, there are 3 different, tissue-specific isoenzymes, designated alpha, beta and gamma. Alpha is present in most tissues, beta is localised in muscle tissue, and gamma is found only in nervous tissue. The functional enzyme exists as a dimer of any 2 isoforms. In immature organs and in adult liver, it is usually an alpha homodimer, in adult skeletal muscle, a beta homodimer, and in adult neurons, a gamma homodimer. In developing muscle, it is usually an alpha/beta heterodimer, and in the developing nervous system, an alpha/gamma heterodimer []. The tissue specific forms display minor kinetic differences. Tau-crystallin, one of the major lens proteins in some fish, reptiles and birds, has been shown [] to be evolutionary related to enolase. Neuron-specific enolase is released in a variety of neurological diseases, such as multiple sclerosis and after seizures or acute stroke. Several tumour cells have also been found positive for neuron-specific enolase. Beta-enolase deficiency is associated with glycogenosis type XIII defect.; GO: 0000287 magnesium ion binding, 0004634 phosphopyruvate hydratase activity, 0006096 glycolysis, 0000015 phosphopyruvate hydratase complex; PDB: 2FYM_D 3H8A_C 1E9I_D 3OTR_F 3QTP_A 1PDY_A 1PDZ_A 3TQP_B 2PTZ_A 2PTW_A ....
>PRK08350 hypothetical protein; Provisional Back     alignment and domain information
>COG0148 Eno Enolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2670|consensus Back     alignment and domain information
>PTZ00378 hypothetical protein; Provisional Back     alignment and domain information
>PLN00191 enolase Back     alignment and domain information
>PTZ00081 enolase; Provisional Back     alignment and domain information
>cd03313 enolase Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways Back     alignment and domain information
>PRK00077 eno enolase; Provisional Back     alignment and domain information
>TIGR01060 eno phosphopyruvate hydratase Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>cd03317 NAAAR N-acylamino acid racemase (NAAAR), an octameric enzyme that catalyzes the racemization of N-acylamino acids Back     alignment and domain information
>PRK15440 L-rhamnonate dehydratase; Provisional Back     alignment and domain information
>TIGR01502 B_methylAsp_ase methylaspartate ammonia-lyase Back     alignment and domain information
>cd03328 MR_like_3 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 3 Back     alignment and domain information
>PF02746 MR_MLE_N: Mandelate racemase / muconate lactonizing enzyme, N-terminal domain; InterPro: IPR013341 Mandelate racemase 5 Back     alignment and domain information
>cd03314 MAL Methylaspartate ammonia lyase (3-methylaspartase, MAL) is a homodimeric enzyme, catalyzing the magnesium-dependent reversible alpha,beta-elimination of ammonia from L-threo-(2S,3S)-3-methylaspartic acid to mesaconic acid Back     alignment and domain information
>PRK15072 bifunctional D-altronate/D-mannonate dehydratase; Provisional Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd03322 rpsA The starvation sensing protein RpsA from E Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>cd03325 D-galactonate_dehydratase D-galactonate dehydratase catalyses the dehydration of galactonate to 2-keto-3-deoxygalactnate (KDGal), as part of the D-galactonate nonphosphorolytic catabolic Entner-Doudoroff pathway Back     alignment and domain information
>cd03318 MLE Muconate Lactonizing Enzyme (MLE), an homooctameric enzyme, catalyses the conversion of cis,cis-muconate (CCM) to muconolactone (ML) in the catechol branch of the beta-ketoadipate pathway Back     alignment and domain information
>COG4948 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily [Cell envelope biogenesis, outer membrane / General function prediction only] Back     alignment and domain information
>cd03324 rTSbeta_L-fuconate_dehydratase Human rTS beta is encoded by the rTS gene which, through alternative RNA splicing, also encodes rTS alpha whose mRNA is complementary to thymidylate synthase mRNA Back     alignment and domain information
>PRK14017 galactonate dehydratase; Provisional Back     alignment and domain information
>TIGR03247 glucar-dehydr glucarate dehydratase Back     alignment and domain information
>TIGR01928 menC_lowGC/arch o-succinylbenzoic acid (OSB) synthetase Back     alignment and domain information
>cd03326 MR_like_1 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 1 Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>TIGR02534 mucon_cyclo muconate and chloromuconate cycloisomerases Back     alignment and domain information
>PF05034 MAAL_N: Methylaspartate ammonia-lyase N-terminus; InterPro: IPR022665 Methylaspartate ammonia-lyase 4 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query61
2al1_A 436 Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: 7e-31
2akz_A 439 Gamma enolase, neural; fluoride inhibition, negati 1e-30
3qtp_A 441 Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Ent 1e-29
2ptz_A 432 Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypano 3e-29
2pa6_A 427 Enolase; glycolysis, lyase, magnesium, metal-bindi 6e-28
1w6t_A 444 Enolase; bacterial infection, surface protein, moo 1e-25
3uj2_A 449 Enolase 1; enzyme function initiative, EFI, lyase; 1e-25
3otr_A 452 Enolase; structural genomics, center for structura 2e-25
2fym_A 431 Enolase; RNA degradosome, enolase, lyase; 1.60A {E 2e-25
3tqp_A 428 Enolase; energy metabolism, lyase; 2.20A {Coxiella 2e-25
3qn3_A 417 Enolase; structural genomics, center for structura 3e-25
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* 2xh7_A* 2xgz_A* 2xh2_A* 2xh4_A* ... Length = 436 Back     alignment and structure
 Score =  109 bits (276), Expect = 7e-31
 Identities = 34/55 (61%), Positives = 42/55 (76%)

Query: 7   LVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLY 61
            V  + +V  QK +D+F+I LDGT NKSK GANAILGVSLA ++A AA+K VPLY
Sbjct: 76  FVKANIDVKDQKAVDDFLISLDGTANKSKLGANAILGVSLAASRAAAAEKNVPLY 130
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 2xsx_A 1pdz_A 1pdy_A Length = 439 Back     alignment and structure
>3qtp_A Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Entamoeba histolytica} Length = 441 Back     alignment and structure
>2ptz_A Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma brucei} SCOP: c.1.11.1 d.54.1.1 PDB: 2ptx_A 2pty_A* 2ptw_A 2pu0_A 2pu1_A* 1oep_A Length = 432 Back     alignment and structure
>2pa6_A Enolase; glycolysis, lyase, magnesium, metal-binding, structural GENO NPPSFA; 1.85A {Methanocaldococcus jannaschii} Length = 427 Back     alignment and structure
>1w6t_A Enolase; bacterial infection, surface protein, moonlighting protein, glycolysis, phosphopyruvate hydratase, lyase; HET: 2PE; 2.10A {Streptococcus pneumoniae} SCOP: c.1.11.1 d.54.1.1 PDB: 1iyx_A Length = 444 Back     alignment and structure
>3uj2_A Enolase 1; enzyme function initiative, EFI, lyase; 2.00A {Anaerostipes caccae} Length = 449 Back     alignment and structure
>3otr_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel, TIM barrel; 2.75A {Toxoplasma gondii} Length = 452 Back     alignment and structure
>2fym_A Enolase; RNA degradosome, enolase, lyase; 1.60A {Escherichia coli} SCOP: c.1.11.1 d.54.1.1 PDB: 1e9i_A 3h8a_A Length = 431 Back     alignment and structure
>3tqp_A Enolase; energy metabolism, lyase; 2.20A {Coxiella burnetii} Length = 428 Back     alignment and structure
>3qn3_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, glycolysis, lyase; 2.13A {Campylobacter jejuni} Length = 417 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query61
3qtp_A 441 Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Ent 99.91
3otr_A 452 Enolase; structural genomics, center for structura 99.89
3tqp_A 428 Enolase; energy metabolism, lyase; 2.20A {Coxiella 99.7
3qn3_A 417 Enolase; structural genomics, center for structura 99.7
3uj2_A 449 Enolase 1; enzyme function initiative, EFI, lyase; 99.67
2akz_A 439 Gamma enolase, neural; fluoride inhibition, negati 99.64
2al1_A 436 Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: 99.63
2ptz_A 432 Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypano 99.55
2fym_A 431 Enolase; RNA degradosome, enolase, lyase; 1.60A {E 99.41
1w6t_A 444 Enolase; bacterial infection, surface protein, moo 99.33
2pa6_A 427 Enolase; glycolysis, lyase, magnesium, metal-bindi 99.2
2qq6_A 410 Mandelate racemase/muconate lactonizing enzyme- li 98.83
2ox4_A 403 Putative mandelate racemase; enolase, dehydratase, 98.69
2poz_A 392 Putative dehydratase; octamer, structural genomics 98.62
2p3z_A 415 L-rhamnonate dehydratase; enolase, structural geno 98.57
2gl5_A 410 Putative dehydratase protein; structural genomics, 98.54
2o56_A 407 Putative mandelate racemase; dehydratase, structur 98.51
3cyj_A 372 Mandelate racemase/muconate lactonizing enzyme-LI 98.43
2pp0_A 398 L-talarate/galactarate dehydratase; enolase superf 98.35
1tzz_A 392 Hypothetical protein L1841; structural genomics, m 98.29
1kko_A 413 3-methylaspartate ammonia-lyase; enolase superfami 98.18
2nql_A 388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 98.17
1kcz_A 413 Beta-methylaspartase; beta zigzag, alpha/beta-barr 98.12
2ovl_A 371 Putative racemase; structural genomics, PSI-2, pro 98.11
4hnl_A 421 Mandelate racemase/muconate lactonizing enzyme; de 98.04
2qgy_A 391 Enolase from the environmental genome shotgun sequ 98.03
1rvk_A 382 Isomerase/lactonizing enzyme; enolase superfamily, 98.03
1wue_A 386 Mandelate racemase/muconate lactonizing enzyme FA 98.02
2og9_A 393 Mandelate racemase/muconate lactonizing enzyme; NY 97.99
2pge_A 377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, 97.99
3bjs_A 428 Mandelate racemase/muconate lactonizing enzyme; en 97.98
2p8b_A 369 Mandelate racemase/muconate lactonizing enzyme fam 97.96
2pgw_A 384 Muconate cycloisomerase; enolase superfamily, octa 97.95
1sjd_A 368 N-acylamino acid racemase; lyase, isomerase; HET: 97.92
1wuf_A 393 Hypothetical protein LIN2664; structural genomics, 97.86
2zc8_A 369 N-acylamino acid racemase; octamer, TIM beta/alpha 97.84
1mdl_A 359 Mandelate racemase; isomerase, mandelate pathway, 97.84
2qdd_A 378 Mandelate racemase/muconate lactonizing enzyme; en 97.8
2qde_A 397 Mandelate racemase/muconate lactonizing enzyme FA 97.8
2ps2_A 371 Putative mandelate racemase/muconate lactonizing e 97.75
1r0m_A 375 N-acylamino acid racemase; isomerase; 1.30A {Deino 97.72
1tkk_A 366 Similar to chloromuconate cycloisomerase; epimeras 97.71
1nu5_A 370 Chloromuconate cycloisomerase; enzyme, dehalogenat 97.68
2oz8_A 389 MLL7089 protein; structural genomics, unknown func 97.67
2zad_A 345 Muconate cycloisomerase; muconate lactonizing enzy 97.64
2rdx_A 379 Mandelate racemase/muconate lactonizing enzyme, P; 97.63
2gdq_A 382 YITF; mandelate racemase/muconate lactonizing enzy 97.61
2hxt_A 441 L-fuconate dehydratase; enolase superfamily, D-ery 97.36
3p3b_A 392 Mandelate racemase/muconate lactonizing protein; e 96.97
2hzg_A 401 Mandelate racemase/muconate lactonizing enzyme/EN 96.95
4hpn_A 378 Putative uncharacterized protein; enolase, enzyme 96.18
4h1z_A 412 Enolase Q92ZS5; dehydratase, magnesium binding sit 95.56
4h83_A 388 Mandelate racemase/muconate lactonizing enzyme; st 95.27
3gd6_A 391 Muconate cycloisomerase; structural genomics, NYSG 94.88
3sjn_A 374 Mandelate racemase/muconate lactonizing protein; e 94.71
3mqt_A 394 Mandelate racemase/muconate lactonizing protein; P 94.63
3dg3_A 367 Muconate cycloisomerase; muconate lactonizing enzy 94.59
4e4u_A 412 Mandalate racemase/muconate lactonizing enzyme; ma 94.32
2chr_A 370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 94.2
3my9_A 377 Muconate cycloisomerase; structural genomics, PSI- 94.19
4e5t_A 404 Mandelate racemase / muconate lactonizing enzyme, 94.19
3sbf_A 401 Mandelate racemase / muconate lactonizing enzyme; 94.17
3fxg_A 455 Rhamnonate dehydratase; structural gemomics, enola 94.06
3vcn_A 425 Mannonate dehydratase; enolase, magnesium binding 93.98
3rcy_A 433 Mandelate racemase/muconate lactonizing enzyme-LI 93.97
3mwc_A 400 Mandelate racemase/muconate lactonizing protein; e 93.95
3t6c_A 440 RSPA, putative MAND family dehydratase; enolase, m 93.9
3v3w_A 424 Starvation sensing protein RSPA; enolase, enzyme f 93.83
4g8t_A 464 Glucarate dehydratase; enolase, enzyme function IN 93.83
3vdg_A 445 Probable glucarate dehydratase; enolase, magnesium 93.78
3tcs_A 388 Racemase, putative; PSI-biology, nysgrc, structura 93.77
3r4e_A 418 Mandelate racemase/muconate lactonizing enzyme; en 93.77
3ekg_A 404 Mandelate racemase/muconate lactonizing enzyme; st 93.74
3tji_A 422 Mandelate racemase/muconate lactonizing enzyme, N 93.71
3tj4_A 372 Mandelate racemase; enolase, dehydratase, enzyme f 93.62
3go2_A 409 Putative L-alanine-DL-glutamate epimerase; structu 93.49
3dip_A 410 Enolase; structural genomics, isomerase, PSI-2, pr 93.41
4e4f_A 426 Mannonate dehydratase; magnesium binding, enzyme f 93.37
3toy_A 383 Mandelate racemase/muconate lactonizing enzyme FA 93.33
3stp_A 412 Galactonate dehydratase, putative; PSI biology, st 93.22
3i6e_A 385 Muconate cycloisomerase I; structural genomics, NY 93.13
4dwd_A 393 Mandelate racemase/muconate lactonizing enzyme, C 93.13
4dxk_A 400 Mandelate racemase / muconate lactonizing enzyme p 93.1
3i4k_A 383 Muconate lactonizing enzyme; structural genomics, 92.99
3fcp_A 381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 92.96
3jva_A 354 Dipeptide epimerase; enolase superfamily, isomeras 92.81
3mkc_A 394 Racemase; metabolic process, PSI2, NYSGXRC, struct 92.71
3dgb_A 382 Muconate cycloisomerase; muconate lactonizing enzy 92.7
3va8_A 445 Probable dehydratase; enolase, magnesium binding s 92.6
1chr_A 370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 92.37
3rr1_A 405 GALD, putative D-galactonate dehydratase; enolase, 92.1
3eez_A 378 Putative mandelate racemase/muconate lactonizing e 91.8
3r0u_A 379 Enzyme of enolase superfamily; structural genomics 91.69
3mzn_A 450 Glucarate dehydratase; lyase, structural genomics, 91.68
3ddm_A 392 Putative mandelate racemase/muconate lactonizing e 91.62
3ik4_A 365 Mandelate racemase/muconate lactonizing protein; s 91.55
3ozy_A 389 Putative mandelate racemase; beta-alpha barrel, en 91.18
3p0w_A 470 Mandelate racemase/muconate lactonizing protein; s 91.08
3ugv_A 390 Enolase; enzyme function initiative, EFI, lyase; 2 91.03
4e8g_A 391 Enolase, mandelate racemase/muconate lactonizing e 90.86
3u9i_A 393 Mandelate racemase/muconate lactonizing enzyme, C 90.68
3vc5_A 441 Mandelate racemase/muconate lactonizing protein; d 90.52
3s5s_A 389 Mandelate racemase/muconate lactonizing enzyme FA 90.4
3fv9_G 386 Mandelate racemase/muconate lactonizing enzyme; st 90.38
3q45_A 368 Mandelate racemase/muconate lactonizing enzyme FA 90.29
4dye_A 398 Isomerase; enolase family protein, EFI, enzym func 89.81
3pfr_A 455 Mandelate racemase/muconate lactonizing protein; e 89.7
3ro6_B 356 Putative chloromuconate cycloisomerase; TIM barrel 89.68
4h2h_A 376 Mandelate racemase/muconate lactonizing enzyme; en 86.89
3qld_A 388 Mandelate racemase/muconate lactonizing protein; s 83.4
4a35_A 441 Mitochondrial enolase superfamily member 1; isomer 83.38
1jpd_X 324 L-Ala-D/L-Glu epimerase; enolase superfamily, muco 83.07
3ijl_A 338 Muconate cycloisomerase; enolase superfamily, dipe 80.15
>3qtp_A Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Entamoeba histolytica} Back     alignment and structure
Probab=99.91  E-value=1.9e-25  Score=164.82  Aligned_cols=58  Identities=55%  Similarity=0.826  Sum_probs=56.8

Q ss_pred             hhhhhHHhCCCCcccHHHHHHHHHhhhCCCCCCccchHHHHHHHHHHHHHHHHhhCCCCC
Q psy9117           2 YLLFNLVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLY   61 (61)
Q Consensus         2 ~i~p~L~~~g~~~~dQ~~iD~~L~~lDgT~nks~lGaNailavSlA~a~AaA~~~~~pLy   61 (61)
                      +|+|+|+  |+|++||++||++|+++|||+|||++|+|+|+|||||+|||+|+.+++|||
T Consensus        77 ~iap~Li--g~~~~dQ~~iD~~m~~lDgT~nks~lGaNail~vSlAvakAaA~~~~~PLy  134 (441)
T 3qtp_A           77 IIGPALL--GKNVLNQAELDEMMIKLDGTNNKGKLGANAILGCSMSICRAAAAEKGLPLY  134 (441)
T ss_dssp             THHHHHT--TCBTTCHHHHHHHHHHHHCSTTCTTTCHHHHHHHHHHHHHHHHHHTTCCHH
T ss_pred             HHHHHHh--cCChhhHHHHHHHHHhccCCCCccCCCccchhhHHHHHHHHHHHhcCCcHH
Confidence            5899999  999999999999999999999999999999999999999999999999998
>3otr_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel, TIM barrel; 2.75A {Toxoplasma gondii} Back     alignment and structure
>3tqp_A Enolase; energy metabolism, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3qn3_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, glycolysis, lyase; 2.13A {Campylobacter jejuni} Back     alignment and structure
>3uj2_A Enolase 1; enzyme function initiative, EFI, lyase; 2.00A {Anaerostipes caccae} Back     alignment and structure
>2akz_A Gamma enolase, neural; fluoride inhibition, negative cooperativity, glycolysis, , isothermal titration calorimetry, lyase; 1.36A {Homo sapiens} SCOP: c.1.11.1 d.54.1.1 PDB: 2akm_A 1te6_A 2psn_A 3b97_A 2xsx_A 1pdz_A 1pdy_A Back     alignment and structure
>2al1_A Enolase 1, 2-phospho-D-; beta barrel, lyase; HET: PEP 2PG; 1.50A {Saccharomyces cerevisiae} SCOP: c.1.11.1 d.54.1.1 PDB: 1ebg_A 1ebh_A* 1one_A* 2one_A* 1p48_A* 1p43_A* 1l8p_A 4enl_A 1nel_A 1els_A 3enl_A 5enl_A* 6enl_A 7enl_A* 2al2_A* 2al2_B* 2xh7_A* 2xgz_A* 2xh2_A* 2xh4_A* ... Back     alignment and structure
>2ptz_A Enolase; lyase, glycolysis,His-TAG; 1.65A {Trypanosoma brucei} SCOP: c.1.11.1 d.54.1.1 PDB: 2ptx_A 2pty_A* 2ptw_A 2pu0_A 2pu1_A* 1oep_A Back     alignment and structure
>2fym_A Enolase; RNA degradosome, enolase, lyase; 1.60A {Escherichia coli} SCOP: c.1.11.1 d.54.1.1 PDB: 1e9i_A 3h8a_A Back     alignment and structure
>1w6t_A Enolase; bacterial infection, surface protein, moonlighting protein, glycolysis, phosphopyruvate hydratase, lyase; HET: 2PE; 2.10A {Streptococcus pneumoniae} SCOP: c.1.11.1 d.54.1.1 PDB: 1iyx_A Back     alignment and structure
>2pa6_A Enolase; glycolysis, lyase, magnesium, metal-binding, structural GENO NPPSFA; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>2p3z_A L-rhamnonate dehydratase; enolase, structural genomics, PSI, protein structure initiat YORK structural genomics research consortium; 1.80A {Salmonella typhimurium LT2} PDB: 3box_A 3cxo_A* 2gsh_A 3d47_A 3d46_A 2i5q_A Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3cyj_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, isomerase, PSI-2; 2.30A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>1kcz_A Beta-methylaspartase; beta zigzag, alpha/beta-barrel, lyase; 1.90A {Clostridium tetanomorphum} SCOP: c.1.11.2 d.54.1.1 PDB: 1kd0_A* 3zvi_A 3zvh_A Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1wue_A Mandelate racemase/muconate lactonizing enzyme FA protein; structural genomics, unknown function, nysgxrc target T2185; 2.10A {Enterococcus faecalis} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>2pge_A MENC; OSBS, NYSGXRC, PSI-II, structural genomics, protein structure initiative; 1.60A {Desulfotalea psychrophila LSV54} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>4h83_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, enzyme function initiative; 2.09A {Marine actinobacterium PHSC20C1} PDB: 3no1_A 3msy_A Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3fxg_A Rhamnonate dehydratase; structural gemomics, enolase superfamily, NYSGXRC, target 9265J, lyase, structural genomics, PSI-2; 1.90A {Gibberella zeae ph-1} PDB: 2p0i_A Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>4g8t_A Glucarate dehydratase; enolase, enzyme function INI EFI, structural genomics, lyase; 1.70A {Actinobacillus succinogenes} PDB: 1ec7_A 1ec8_A* 1ec9_A* 1ecq_A* 1jdf_A* 3pwi_A* 1jct_A* 3pwg_A* 1bqg_A Back     alignment and structure
>3vdg_A Probable glucarate dehydratase; enolase, magnesium binding site, lyase; 1.90A {Mycobacterium smegmatis str} PDB: 3vfc_A* Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>3ekg_A Mandelate racemase/muconate lactonizing enzyme; structural genomics, nysgrc, L-rhamnonate dehydratase,target PSI-2; HET: TLA; 1.60A {Azotobacter vinelandii avop} PDB: 2oz3_A* Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>3va8_A Probable dehydratase; enolase, magnesium binding site, lyase; 2.00A {Gibberella zeae} Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>3mzn_A Glucarate dehydratase; lyase, structural genomics, protein structure initiative, PS nysgrc; 1.85A {Chromohalobacter salexigens} PDB: 3nfu_A Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>3p0w_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, protein structure initiative; HET: GKR; 1.71A {Ralstonia pickettii} PDB: 4hn8_A 3nxl_A Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>3u9i_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, PSI-biology; 2.90A {Roseiflexus SP} Back     alignment and structure
>3vc5_A Mandelate racemase/muconate lactonizing protein; dehydratase, magnesium binding, enzyme function initiative, enolase, isomerase; 1.50A {Thermobispora bispora} PDB: 3vc6_A 4dhg_A Back     alignment and structure
>3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>3pfr_A Mandelate racemase/muconate lactonizing protein; emolase superfamily fold, D-glucarate dehydratase, D-glucara isomerase; HET: GKR; 1.90A {Actinobacillus succinogenes} PDB: 3n6j_A 3n6h_A* 4gyp_C* Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>4h2h_A Mandelate racemase/muconate lactonizing enzyme; enolase, mandelate racemase subgroup, enzyme function initia EFI, structural genomics; HET: 0XW; 1.70A {Pelagibaca bermudensis} PDB: 2pmq_A* Back     alignment and structure
>3qld_A Mandelate racemase/muconate lactonizing protein; structural genomics, PSI-2, isomerase; HET: MSE; 1.85A {Alicyclobacillus acidocaldarius LAA1} Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>1jpd_X L-Ala-D/L-Glu epimerase; enolase superfamily, muconate lactonizing enzyme subgroup, alpha/beta barrel, structural genomics, isomerase; 2.60A {Escherichia coli} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3ijl_A Muconate cycloisomerase; enolase superfamily, dipeptide epimerase, L-Pro-D-Glu, nonpr binding; HET: DGL; 1.50A {Bacteroides thetaiotaomicron} PDB: 3iji_A* 3ijq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 61
d2akza2139 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), 7e-24
d2al1a2141 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Sacchar 3e-22
d2ptza2139 d.54.1.1 (A:0-138) Enolase {Trypanosoma brucei [Ta 2e-20
d1pdza2139 d.54.1.1 (A:1-139) Enolase {European lobster (Homa 1e-19
d2fyma2139 d.54.1.1 (A:1-139) Enolase {Escherichia coli [TaxI 1e-18
d1w6ta2137 d.54.1.1 (A:1-137) Enolase {Streptococcus pneumoni 5e-17
>d2akza2 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 139 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Enolase N-terminal domain-like
superfamily: Enolase N-terminal domain-like
family: Enolase N-terminal domain-like
domain: Enolase
species: Human (Homo sapiens), gamma isoform [TaxId: 9606]

 Score = 84.6 bits (209), Expect = 7e-24
 Identities = 35/55 (63%), Positives = 46/55 (83%)

Query: 7   LVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLY 61
           L++    V +Q+++D  M++LDGTENKSKFGANAILGVSLAV KAGAA++ +PLY
Sbjct: 76  LISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLY 130
>d2al1a2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 141 Back     information, alignment and structure
>d2ptza2 d.54.1.1 (A:0-138) Enolase {Trypanosoma brucei [TaxId: 5691]} Length = 139 Back     information, alignment and structure
>d1pdza2 d.54.1.1 (A:1-139) Enolase {European lobster (Homarus vulgaris) [TaxId: 6707]} Length = 139 Back     information, alignment and structure
>d2fyma2 d.54.1.1 (A:1-139) Enolase {Escherichia coli [TaxId: 562]} Length = 139 Back     information, alignment and structure
>d1w6ta2 d.54.1.1 (A:1-137) Enolase {Streptococcus pneumoniae [TaxId: 1313]} Length = 137 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query61
d1w6ta2137 Enolase {Streptococcus pneumoniae [TaxId: 1313]} 99.93
d2akza2139 Enolase {Human (Homo sapiens), gamma isoform [TaxI 99.92
d2fyma2139 Enolase {Escherichia coli [TaxId: 562]} 99.92
d2al1a2141 Enolase {Baker's yeast (Saccharomyces cerevisiae) 99.92
d1pdza2139 Enolase {European lobster (Homarus vulgaris) [TaxI 99.92
d2ptza2139 Enolase {Trypanosoma brucei [TaxId: 5691]} 99.91
d1rvka2126 Hypothetical protein Atu3453 {Agrobacterium tumefa 96.26
d1wufa2126 N-acylamino acid racemase {Listeria innocua [TaxId 95.92
d1jpma2125 L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 95.73
d2gl5a2122 Putative dehydratase protein STM2273 {Salmonella t 94.57
d1yeya2139 RTS beta protein {Xanthomonas campestris pv. campe 94.54
d2chra2126 Chlormuconate cycloisomerase {Alcaligenes eutrophu 94.37
d1wuea2126 N-acylamino acid racemase {Enterococcus faecalis [ 94.35
d1jdfa2133 D-glucarate dehydratase {Escherichia coli [TaxId: 93.78
d2gdqa2115 Hypothetical protein YitF {Bacillus subtilis [TaxI 93.47
d1nu5a2126 Chlormuconate cycloisomerase {Pseudomonas sp. p51 93.41
d1sjda2125 N-acylamino acid racemase {Amycolatopsis sp. [TaxI 93.08
d1r0ma2127 N-acylamino acid racemase {Deinococcus radiodurans 92.67
d1bqga2132 D-glucarate dehydratase {Pseudomonas putida [TaxId 91.9
d1tzza2140 Hypothetical protein Bll6730 {Bradyrhizobium japon 87.64
d1muca2127 Muconate-lactonizing enzyme (cis muconate cycloiso 84.23
d2mnra2130 Mandelate racemase {Pseudomonas putida [TaxId: 303 82.09
>d1w6ta2 d.54.1.1 (A:1-137) Enolase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Enolase N-terminal domain-like
superfamily: Enolase N-terminal domain-like
family: Enolase N-terminal domain-like
domain: Enolase
species: Streptococcus pneumoniae [TaxId: 1313]

Probab=99.93  E-value=8.1e-27  Score=149.27  Aligned_cols=58  Identities=52%  Similarity=0.777  Sum_probs=56.4

Q ss_pred             hhhhhHHhCCCCcccHHHHHHHHHhhhCCCCCCccchHHHHHHHHHHHHHHHHhhCCCCC
Q psy9117           2 YLLFNLVTLSFEVTQQKEIDEFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLY   61 (61)
Q Consensus         2 ~i~p~L~~~g~~~~dQ~~iD~~L~~lDgT~nks~lGaNailavSlA~a~AaA~~~~~pLy   61 (61)
                      .|+|+|+  |+++.||++||++|+++|||+||+++|+|+|+|||||+|||+|..+++|||
T Consensus        74 ~i~~~L~--G~d~~dq~~iD~~lielDgT~nks~lGaNailAvSlA~akAaA~~~~~pLy  131 (137)
T d1w6ta2          74 IIAEAII--GYDVRDQQAIDRAMIALDGTPNKGKLGANAILGVSIAVARAAADYLEIPLY  131 (137)
T ss_dssp             THHHHHT--TSBTTCHHHHHHHHHHHHCSTTCTTTCHHHHHHHHHHHHHHHHHHHTSCHH
T ss_pred             HhHHHHc--CCccccHHHHHHHHHHhcCcccccccchhHHHHHHHHHHHHHHHHcCCcHH
Confidence            3789999  999999999999999999999999999999999999999999999999998
>d2akza2 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d2fyma2 d.54.1.1 (A:1-139) Enolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2al1a2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pdza2 d.54.1.1 (A:1-139) Enolase {European lobster (Homarus vulgaris) [TaxId: 6707]} Back     information, alignment and structure
>d2ptza2 d.54.1.1 (A:0-138) Enolase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1rvka2 d.54.1.1 (A:1-126) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wufa2 d.54.1.1 (A:1001-1126) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1jpma2 d.54.1.1 (A:1-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gl5a2 d.54.1.1 (A:1-122) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yeya2 d.54.1.1 (A:2-140) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d2chra2 d.54.1.1 (A:1-126) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1wuea2 d.54.1.1 (A:1001-1126) N-acylamino acid racemase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jdfa2 d.54.1.1 (A:5-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gdqa2 d.54.1.1 (A:4-118) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nu5a2 d.54.1.1 (A:1-126) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1sjda2 d.54.1.1 (A:1-125) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} Back     information, alignment and structure
>d1r0ma2 d.54.1.1 (A:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1bqga2 d.54.1.1 (A:12-143) D-glucarate dehydratase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tzza2 d.54.1.1 (A:1006-1145) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1muca2 d.54.1.1 (A:4-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2mnra2 d.54.1.1 (A:3-132) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure