Psyllid ID: psy9145
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 111 | ||||||
| 195128693 | 164 | GI13691 [Drosophila mojavensis] gi|19392 | 0.864 | 0.585 | 0.701 | 1e-36 | |
| 110759011 | 161 | PREDICTED: hemicentin-1-like [Apis melli | 0.792 | 0.546 | 0.727 | 2e-36 | |
| 380020407 | 161 | PREDICTED: hemicentin-1-like [Apis flore | 0.792 | 0.546 | 0.727 | 2e-36 | |
| 195018429 | 164 | GH14839 [Drosophila grimshawi] gi|193898 | 0.864 | 0.585 | 0.701 | 2e-36 | |
| 195379570 | 164 | GJ14034 [Drosophila virilis] gi|19415570 | 0.864 | 0.585 | 0.701 | 3e-36 | |
| 195166463 | 163 | GL22772 [Drosophila persimilis] gi|19846 | 0.864 | 0.588 | 0.701 | 4e-36 | |
| 28574493 | 162 | CG14141 [Drosophila melanogaster] gi|201 | 0.864 | 0.592 | 0.690 | 5e-36 | |
| 195441572 | 162 | GK20344 [Drosophila willistoni] gi|19416 | 0.864 | 0.592 | 0.690 | 5e-36 | |
| 194868963 | 162 | GG15489 [Drosophila erecta] gi|195326744 | 0.864 | 0.592 | 0.690 | 5e-36 | |
| 194748148 | 162 | GF25252 [Drosophila ananassae] gi|190623 | 0.864 | 0.592 | 0.690 | 6e-36 |
| >gi|195128693|ref|XP_002008796.1| GI13691 [Drosophila mojavensis] gi|193920405|gb|EDW19272.1| GI13691 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
Score = 156 bits (395), Expect = 1e-36, Method: Compositional matrix adjust.
Identities = 68/97 (70%), Positives = 82/97 (84%), Gaps = 1/97 (1%)
Query: 16 QVKYFPLS-VLGHKIVFICMAKGKPRPHITWFKDGVELYAHMYVNLHEWHYGTDRIKSKI 74
Q +F L VLGHKI F+C+AKG PRPHITW+KDG E+Y H+Y+++HEW G DR+KSKI
Sbjct: 68 QASHFDLEYVLGHKIAFLCVAKGNPRPHITWYKDGAEIYQHLYMHVHEWTIGEDRVKSKI 127
Query: 75 EIDPATQMDAGIYECYADNMYNVDTRTFKTDFSITFD 111
EIDPATQMDAG+YEC ADNMY++D R+FKTDFSI FD
Sbjct: 128 EIDPATQMDAGLYECTADNMYSIDRRSFKTDFSIAFD 164
|
Source: Drosophila mojavensis Species: Drosophila mojavensis Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|110759011|ref|XP_001120611.1| PREDICTED: hemicentin-1-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380020407|ref|XP_003694078.1| PREDICTED: hemicentin-1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|195018429|ref|XP_001984780.1| GH14839 [Drosophila grimshawi] gi|193898262|gb|EDV97128.1| GH14839 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|195379570|ref|XP_002048551.1| GJ14034 [Drosophila virilis] gi|194155709|gb|EDW70893.1| GJ14034 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195166463|ref|XP_002024054.1| GL22772 [Drosophila persimilis] gi|198466222|ref|XP_001353931.2| GA12785 [Drosophila pseudoobscura pseudoobscura] gi|194107409|gb|EDW29452.1| GL22772 [Drosophila persimilis] gi|198150501|gb|EAL29667.2| GA12785 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|28574493|ref|NP_648450.3| CG14141 [Drosophila melanogaster] gi|20151827|gb|AAM11273.1| RH33338p [Drosophila melanogaster] gi|28380542|gb|AAF50080.2| CG14141 [Drosophila melanogaster] gi|220949382|gb|ACL87234.1| CG14141-PA [synthetic construct] gi|220958538|gb|ACL91812.1| CG14141-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|195441572|ref|XP_002068580.1| GK20344 [Drosophila willistoni] gi|194164665|gb|EDW79566.1| GK20344 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|194868963|ref|XP_001972364.1| GG15489 [Drosophila erecta] gi|195326744|ref|XP_002030085.1| GM25261 [Drosophila sechellia] gi|195493379|ref|XP_002094391.1| GE21800 [Drosophila yakuba] gi|195589467|ref|XP_002084473.1| GD14295 [Drosophila simulans] gi|190654147|gb|EDV51390.1| GG15489 [Drosophila erecta] gi|194119028|gb|EDW41071.1| GM25261 [Drosophila sechellia] gi|194180492|gb|EDW94103.1| GE21800 [Drosophila yakuba] gi|194196482|gb|EDX10058.1| GD14295 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|194748148|ref|XP_001956511.1| GF25252 [Drosophila ananassae] gi|190623793|gb|EDV39317.1| GF25252 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 111 | ||||||
| WB|WBGene00043050 | 155 | oig-4 [Caenorhabditis elegans | 0.900 | 0.645 | 0.388 | 6e-16 | |
| ZFIN|ZDB-GENE-030131-6560 | 1032 | boc "brother of CDO" [Danio re | 0.738 | 0.079 | 0.343 | 3.7e-06 | |
| UNIPROTKB|F1NTU3 | 575 | NRG2 "Uncharacterized protein" | 0.648 | 0.125 | 0.355 | 6e-06 | |
| UNIPROTKB|F1NTU2 | 580 | NRG2 "Uncharacterized protein" | 0.648 | 0.124 | 0.355 | 6.1e-06 | |
| UNIPROTKB|F1NTU1 | 586 | NRG2 "Uncharacterized protein" | 0.648 | 0.122 | 0.355 | 6.2e-06 | |
| MGI|MGI:1858223 | 1028 | Cntn6 "contactin 6" [Mus muscu | 0.774 | 0.083 | 0.322 | 9.8e-06 | |
| RGD|62008 | 1028 | Cntn6 "contactin 6" [Rattus no | 0.774 | 0.083 | 0.322 | 9.8e-06 | |
| UNIPROTKB|G3N0G5 | 642 | LOC783452 "Uncharacterized pro | 0.738 | 0.127 | 0.348 | 1.5e-05 | |
| UNIPROTKB|E1BBP3 | 644 | LOC783452 "Uncharacterized pro | 0.738 | 0.127 | 0.348 | 1.5e-05 | |
| UNIPROTKB|F5GZS7 | 784 | NRG2 "Neuregulin-2" [Homo sapi | 0.648 | 0.091 | 0.355 | 1.5e-05 |
| WB|WBGene00043050 oig-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 199 (75.1 bits), Expect = 6.0e-16, P = 6.0e-16
Identities = 40/103 (38%), Positives = 62/103 (60%)
Query: 8 LSLKRSCQQV--KYFPLSV-LGHKIVFICMAKGKPRPHITWFKDGVELYAHMYVNLHEWH 64
LS RS Q + +F + LG+K++ IC A+G PRP I W+K+G E+ ++ +E
Sbjct: 52 LSDNRSAQIITGSHFSQTYRLGYKLLIICKARGDPRPTIKWYKEGAEIQPKASIHYYEKP 111
Query: 65 YGTDRIKSKIEIDPATQMDAGIYECYADNMYNVDTRTFKTDFS 107
D I SK+E+DPAT D G+Y C A+N + V + FK +++
Sbjct: 112 IENDTIWSKLEVDPATMGDQGVYACVANNPHGVMAKNFKAEYT 154
|
|
| ZFIN|ZDB-GENE-030131-6560 boc "brother of CDO" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NTU3 NRG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NTU2 NRG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NTU1 NRG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1858223 Cntn6 "contactin 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|62008 Cntn6 "contactin 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N0G5 LOC783452 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BBP3 LOC783452 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GZS7 NRG2 "Neuregulin-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 111 | |||
| cd00096 | 74 | cd00096, Ig, Immunoglobulin domain | 3e-12 | |
| smart00408 | 63 | smart00408, IGc2, Immunoglobulin C-2 Type | 5e-11 | |
| pfam07679 | 90 | pfam07679, I-set, Immunoglobulin I-set domain | 4e-10 | |
| smart00410 | 85 | smart00410, IG_like, Immunoglobulin like | 3e-09 | |
| smart00409 | 85 | smart00409, IG, Immunoglobulin | 3e-09 | |
| cd05852 | 73 | cd05852, Ig5_Contactin-1, Fifth Ig domain of conta | 8e-07 | |
| cd05728 | 85 | cd05728, Ig4_Contactin-2-like, Fourth Ig domain of | 9e-07 | |
| cd05724 | 86 | cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like | 2e-06 | |
| cd05729 | 85 | cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig) | 4e-06 | |
| cd05738 | 74 | cd05738, Ig2_RPTP_IIa_LAR_like, Second immunoglobu | 9e-06 | |
| cd05750 | 75 | cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-li | 1e-05 | |
| cd05746 | 69 | cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (I | 2e-05 | |
| cd05745 | 74 | cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig | 3e-05 | |
| cd05733 | 77 | cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig | 3e-05 | |
| pfam00047 | 62 | pfam00047, ig, Immunoglobulin domain | 3e-05 | |
| cd04978 | 76 | cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin | 4e-05 | |
| cd04969 | 73 | cd04969, Ig5_Contactin_like, Fifth Ig domain of co | 6e-05 | |
| cd05748 | 74 | cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like d | 7e-05 | |
| cd04971 | 81 | cd04971, Ig_TrKABC_d5, Fifth domain (immunoglobuli | 7e-05 | |
| cd05725 | 69 | cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like | 1e-04 | |
| cd05731 | 71 | cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig | 1e-04 | |
| cd05723 | 71 | cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)- | 2e-04 | |
| cd05848 | 94 | cd05848, Ig1_Contactin-5, First Ig domain of conta | 3e-04 | |
| cd05856 | 82 | cd05856, Ig2_FGFRL1-like, Second immunoglobulin (I | 4e-04 | |
| cd04977 | 92 | cd04977, Ig1_NCAM-1_like, First immunoglobulin (Ig | 5e-04 | |
| cd04967 | 91 | cd04967, Ig1_Contactin, First Ig domain of contact | 6e-04 | |
| cd05736 | 76 | cd05736, Ig2_Follistatin_like, Second immunoglobul | 6e-04 | |
| cd05730 | 95 | cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig | 8e-04 | |
| cd05891 | 92 | cd05891, Ig_M-protein_C, C-terminal immunoglobulin | 0.001 | |
| pfam08205 | 89 | pfam08205, C2-set_2, CD80-like C2-set immunoglobul | 0.001 | |
| cd05765 | 81 | cd05765, Ig_3, Subgroup of the immunoglobulin (Ig) | 0.001 | |
| pfam13895 | 80 | pfam13895, Ig_2, Immunoglobulin domain | 0.002 | |
| cd07693 | 100 | cd07693, Ig1_Robo, First immunoglobulin (Ig)-like | 0.003 | |
| cd04968 | 88 | cd04968, Ig3_Contactin_like, Third Ig domain of co | 0.004 |
| >gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain | Back alignment and domain information |
|---|
Score = 56.7 bits (136), Expect = 3e-12
Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 1/75 (1%)
Query: 29 IVFICMAKGKPRPHITWFKDGVELYAHMYVNLHEWHYGTDRIKSKIEIDPATQMDAGIYE 88
+ C+A G P P ITW K+G L + + + GT S + I T D+G Y
Sbjct: 1 VTLTCLASGPPPPTITWLKNGKPLPSSVLTRVRS-SRGTSSGSSTLTISNVTLEDSGTYT 59
Query: 89 CYADNMYNVDTRTFK 103
C A N + +
Sbjct: 60 CVASNSAGTVSASVT 74
|
Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond. Length = 74 |
| >gnl|CDD|197706 smart00408, IGc2, Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain | Back alignment and domain information |
|---|
| >gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like | Back alignment and domain information |
|---|
| >gnl|CDD|214652 smart00409, IG, Immunoglobulin | Back alignment and domain information |
|---|
| >gnl|CDD|143260 cd05852, Ig5_Contactin-1, Fifth Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|143205 cd05728, Ig4_Contactin-2-like, Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143201 cd05724, Ig2_Robo, Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143206 cd05729, Ig2_FGFR_like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143215 cd05738, Ig2_RPTP_IIa_LAR_like, Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >gnl|CDD|143227 cd05750, Ig_Pro_neuregulin, Immunoglobulin (Ig)-like domain in neuregulins (NRGs) | Back alignment and domain information |
|---|
| >gnl|CDD|143223 cd05746, Ig4_Peroxidasin, Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143222 cd05745, Ig3_Peroxidasin, Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >gnl|CDD|143210 cd05733, Ig6_L1-CAM_like, Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215677 pfam00047, ig, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143179 cd04978, Ig4_L1-NrCAM_like, Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >gnl|CDD|143170 cd04969, Ig5_Contactin_like, Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >gnl|CDD|143225 cd05748, Ig_Titin_like, Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143172 cd04971, Ig_TrKABC_d5, Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143208 cd05731, Ig3_L1-CAM_like, Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >gnl|CDD|212460 cd05723, Ig4_Neogenin, Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143256 cd05848, Ig1_Contactin-5, First Ig domain of contactin-5 | Back alignment and domain information |
|---|
| >gnl|CDD|143264 cd05856, Ig2_FGFRL1-like, Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >gnl|CDD|143178 cd04977, Ig1_NCAM-1_like, First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143168 cd04967, Ig1_Contactin, First Ig domain of contactin | Back alignment and domain information |
|---|
| >gnl|CDD|143213 cd05736, Ig2_Follistatin_like, Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143207 cd05730, Ig3_NCAM-1_like, Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >gnl|CDD|143299 cd05891, Ig_M-protein_C, C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) | Back alignment and domain information |
|---|
| >gnl|CDD|219745 pfam08205, C2-set_2, CD80-like C2-set immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143242 cd05765, Ig_3, Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|206066 pfam13895, Ig_2, Immunoglobulin domain | Back alignment and domain information |
|---|
| >gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|143169 cd04968, Ig3_Contactin_like, Third Ig domain of contactin | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 111 | |||
| cd04975 | 101 | Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma | 99.77 | |
| cd05745 | 74 | Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom | 99.76 | |
| cd05737 | 92 | Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- | 99.76 | |
| cd05762 | 98 | Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of | 99.76 | |
| cd05894 | 86 | Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card | 99.75 | |
| cd05852 | 73 | Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig | 99.74 | |
| cd05851 | 88 | Ig3_Contactin-1 Third Ig domain of contactin-1. Ig | 99.73 | |
| cd05735 | 88 | Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down | 99.73 | |
| cd05859 | 101 | Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do | 99.73 | |
| cd05863 | 67 | Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain | 99.73 | |
| cd05855 | 79 | Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T | 99.73 | |
| cd05867 | 76 | Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do | 99.72 | |
| cd05892 | 75 | Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like | 99.71 | |
| cd05730 | 95 | Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom | 99.71 | |
| cd05891 | 92 | Ig_M-protein_C C-terminal immunoglobulin (Ig)-like | 99.71 | |
| cd05869 | 97 | Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o | 99.71 | |
| cd05748 | 74 | Ig_Titin_like Immunoglobulin (Ig)-like domain of t | 99.71 | |
| cd05857 | 85 | Ig2_FGFR Second immunoglobulin (Ig)-like domain of | 99.71 | |
| cd05728 | 85 | Ig4_Contactin-2-like Fourth Ig domain of the neura | 99.71 | |
| cd05732 | 96 | Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom | 99.71 | |
| cd04969 | 73 | Ig5_Contactin_like Fifth Ig domain of contactin. I | 99.71 | |
| cd05723 | 71 | Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai | 99.71 | |
| cd04972 | 90 | Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o | 99.7 | |
| cd05747 | 92 | Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like | 99.7 | |
| cd04976 | 71 | Ig2_VEGFR Second immunoglobulin (Ig)-like domain o | 99.7 | |
| cd05868 | 76 | Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o | 99.69 | |
| cd04978 | 76 | Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like | 99.68 | |
| cd05744 | 75 | Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain | 99.68 | |
| cd04968 | 88 | Ig3_Contactin_like Third Ig domain of contactin. I | 99.68 | |
| cd05864 | 70 | Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain | 99.68 | |
| cd05893 | 75 | Ig_Palladin_C C-terminal immunoglobulin (Ig)-like | 99.68 | |
| cd05870 | 98 | Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o | 99.68 | |
| cd05743 | 78 | Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai | 99.68 | |
| cd04971 | 81 | Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of | 99.68 | |
| PF07679 | 90 | I-set: Immunoglobulin I-set domain; InterPro: IPR0 | 99.67 | |
| cd05865 | 96 | Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o | 99.67 | |
| cd05746 | 69 | Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do | 99.65 | |
| cd05773 | 109 | Ig8_hNephrin_like Eighth immunoglobulin-like domai | 99.65 | |
| cd05856 | 82 | Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do | 99.65 | |
| cd05876 | 71 | Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o | 99.65 | |
| cd05739 | 69 | Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li | 99.64 | |
| cd05760 | 77 | Ig2_PTK7 Second immunoglobulin (Ig)-like domain of | 99.63 | |
| cd05764 | 74 | Ig_2 Subgroup of the immunoglobulin (Ig) superfami | 99.63 | |
| cd05854 | 85 | Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig | 99.62 | |
| cd05763 | 75 | Ig_1 Subgroup of the immunoglobulin (Ig) superfami | 99.62 | |
| cd04973 | 79 | Ig1_FGFR First immunoglobulin (Ig)-like domain of | 99.62 | |
| cd05725 | 69 | Ig3_Robo Third immunoglobulin (Ig)-like domain in | 99.61 | |
| cd07693 | 100 | Ig1_Robo First immunoglobulin (Ig)-like domain in | 99.61 | |
| cd05726 | 90 | Ig4_Robo Fhird immunoglobulin (Ig)-like domain in | 99.61 | |
| cd05858 | 90 | Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o | 99.61 | |
| cd05731 | 71 | Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom | 99.61 | |
| cd05758 | 98 | Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do | 99.6 | |
| cd05848 | 94 | Ig1_Contactin-5 First Ig domain of contactin-5. Ig | 99.6 | |
| cd05740 | 91 | Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai | 99.59 | |
| cd05736 | 76 | Ig2_Follistatin_like Second immunoglobulin (Ig)-li | 99.59 | |
| cd04974 | 90 | Ig3_FGFR Third immunoglobulin (Ig)-like domain of | 99.58 | |
| cd05742 | 84 | Ig1_VEGFR_like First immunoglobulin (Ig)-like doma | 99.58 | |
| cd05765 | 81 | Ig_3 Subgroup of the immunoglobulin (Ig) superfami | 99.58 | |
| cd05866 | 92 | Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o | 99.57 | |
| cd05750 | 75 | Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain | 99.56 | |
| cd05738 | 74 | Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l | 99.56 | |
| cd05724 | 86 | Ig2_Robo Second immunoglobulin (Ig)-like domain in | 99.56 | |
| cd05850 | 94 | Ig1_Contactin-2 First Ig domain of contactin-2. Ig | 99.55 | |
| cd04970 | 85 | Ig6_Contactin_like Sixth Ig domain of contactin. I | 99.55 | |
| cd07702 | 72 | Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain | 99.55 | |
| cd05729 | 85 | Ig2_FGFR_like Second immunoglobulin (Ig)-like doma | 99.54 | |
| cd05756 | 94 | Ig1_IL1R_like First immunoglobulin (Ig)-like domai | 99.54 | |
| cd05861 | 84 | Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like | 99.52 | |
| cd04977 | 92 | Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom | 99.52 | |
| cd05853 | 85 | Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig | 99.51 | |
| cd05722 | 95 | Ig1_Neogenin First immunoglobulin (Ig)-like domain | 99.49 | |
| cd05733 | 77 | Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom | 99.48 | |
| cd05849 | 93 | Ig1_Contactin-1 First Ig domain of contactin-1. Ig | 99.48 | |
| cd05874 | 77 | Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of | 99.48 | |
| cd05749 | 81 | Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom | 99.47 | |
| cd04967 | 91 | Ig1_Contactin First Ig domain of contactin. Ig1_Co | 99.45 | |
| cd05734 | 79 | Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain | 99.45 | |
| cd05898 | 98 | Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain | 99.45 | |
| cd05875 | 77 | Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li | 99.45 | |
| cd05754 | 85 | Ig3_Perlecan_like Third immunoglobulin (Ig)-like d | 99.42 | |
| cd05895 | 76 | Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai | 99.41 | |
| cd05752 | 78 | Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do | 99.38 | |
| cd05882 | 95 | Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- | 99.37 | |
| cd05860 | 101 | Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of | 99.35 | |
| cd05757 | 92 | Ig2_IL1R_like Second immunoglobulin (Ig)-like doma | 99.34 | |
| cd04979 | 89 | Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of | 99.34 | |
| cd05873 | 87 | Ig_Sema4D_like Immunoglobulin (Ig)-like domain of | 99.33 | |
| cd07690 | 94 | Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I | 99.28 | |
| cd07701 | 95 | Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- | 99.28 | |
| smart00408 | 63 | IGc2 Immunoglobulin C-2 Type. | 99.27 | |
| cd05862 | 86 | Ig1_VEGFR First immunoglobulin (Ig)-like domain of | 99.26 | |
| KOG3513|consensus | 1051 | 99.24 | ||
| cd05753 | 83 | Ig2_FcgammaR_like Second immunoglobulin (Ig)-like | 99.24 | |
| smart00410 | 86 | IG_like Immunoglobulin like. IG domains that canno | 99.22 | |
| smart00409 | 86 | IG Immunoglobulin. | 99.22 | |
| KOG3513|consensus | 1051 | 99.22 | ||
| PF13895 | 80 | Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V | 99.21 | |
| cd05871 | 91 | Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do | 99.2 | |
| KOG4194|consensus | 873 | 99.18 | ||
| cd05717 | 95 | Ig1_Necl-1-3_like First (N-terminal) immunoglobuli | 99.15 | |
| cd05727 | 96 | Ig2_Contactin-2-like Second Ig domain of the neura | 99.15 | |
| cd05759 | 82 | Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d | 99.15 | |
| cd05885 | 80 | Ig2_Necl-4 Second immunoglobulin (Ig)-like domain | 99.13 | |
| PHA02826 | 227 | IL-1 receptor-like protein; Provisional | 99.12 | |
| PF00047 | 64 | ig: Immunoglobulin domain The Prosite family only | 99.12 | |
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 99.02 | |
| cd05872 | 85 | Ig_Sema4B_like Immunoglobulin (Ig)-like domain of | 99.01 | |
| cd05714 | 106 | Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho | 99.0 | |
| cd05845 | 95 | Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do | 99.0 | |
| cd05900 | 112 | Ig_Aggrecan Immunoglobulin (Ig)-like domain of the | 98.94 | |
| cd05896 | 104 | Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like | 98.93 | |
| cd05751 | 91 | Ig1_LILRB1_like First immunoglobulin (Ig)-like dom | 98.92 | |
| KOG4221|consensus | 1381 | 98.91 | ||
| cd05877 | 106 | Ig_LP_like Immunoglobulin (Ig)-like domain of huma | 98.9 | |
| cd05878 | 110 | Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o | 98.89 | |
| PHA02785 | 326 | IL-beta-binding protein; Provisional | 98.87 | |
| cd05902 | 110 | Ig_Neurocan Immunoglobulin (Ig)-like domain of the | 98.86 | |
| cd05897 | 95 | Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom | 98.86 | |
| cd05713 | 100 | Ig_MOG_like Immunoglobulin (Ig)-like domain of mye | 98.85 | |
| cd05879 | 116 | Ig_P0 Immunoglobulin (Ig)-like domain of Protein z | 98.84 | |
| PF13927 | 75 | Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V | 98.8 | |
| PHA02826 | 227 | IL-1 receptor-like protein; Provisional | 98.8 | |
| cd05901 | 117 | Ig_Versican Immunoglobulin (Ig)-like domain of the | 98.74 | |
| cd05883 | 82 | Ig2_Necl-2 Second immunoglobulin (Ig)-like domain | 98.71 | |
| cd05881 | 95 | Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- | 98.7 | |
| cd04983 | 109 | IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V | 98.7 | |
| cd07694 | 88 | Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. | 98.7 | |
| cd05718 | 98 | Ig1_PVR_like First immunoglobulin (Ig) domain of p | 98.69 | |
| cd05761 | 82 | Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like | 98.64 | |
| cd00098 | 95 | IgC Immunoglobulin Constant domain. IgC: Immunoglo | 98.64 | |
| cd05774 | 105 | Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain | 98.63 | |
| cd05888 | 100 | Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain | 98.63 | |
| cd05775 | 97 | Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) | 98.63 | |
| cd07705 | 83 | Ig2_Necl-1 Second immunoglobulin (Ig)-like domain | 98.62 | |
| cd05741 | 92 | Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d | 98.6 | |
| cd00099 | 105 | IgV Immunoglobulin variable domain (IgV). IgV: Imm | 98.59 | |
| cd05886 | 99 | Ig1_Nectin-1_like First immunoglobulin (Ig) domain | 98.58 | |
| cd05711 | 94 | Ig_FcalphaRI Immunoglobulin (IG)-like domain of of | 98.56 | |
| cd05846 | 97 | Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain | 98.55 | |
| cd05884 | 83 | Ig2_Necl-3 Second immunoglobulin (Ig)-like domain | 98.55 | |
| cd05899 | 110 | IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma | 98.55 | |
| cd04980 | 106 | IgV_L_kappa Immunoglobulin (Ig) light chain, kappa | 98.51 | |
| cd05880 | 115 | Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel | 98.48 | |
| KOG4194|consensus | 873 | 98.48 | ||
| cd04984 | 98 | IgV_L_lambda Immunoglobulin (Ig) lambda light chai | 98.47 | |
| PF07686 | 114 | V-set: Immunoglobulin V-set domain; InterPro: IPR0 | 98.47 | |
| cd00096 | 74 | Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) | 98.44 | |
| KOG4222|consensus | 1281 | 98.42 | ||
| cd05715 | 116 | Ig_P0-like Immunoglobulin (Ig)-like domain of Prot | 98.42 | |
| cd04982 | 116 | IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom | 98.41 | |
| cd05887 | 96 | Ig1_Nectin-3_like First immunoglobulin (Ig) domain | 98.38 | |
| PF08205 | 89 | C2-set_2: CD80-like C2-set immunoglobulin domain ; | 98.37 | |
| cd05755 | 100 | Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do | 98.35 | |
| KOG4221|consensus | 1381 | 98.34 | ||
| PHA02987 | 189 | Ig domain OX-2-like protein; Provisional | 98.33 | |
| KOG4222|consensus | 1281 | 98.23 | ||
| cd05889 | 96 | Ig1_DNAM-1_like First immunoglobulin (Ig) domain o | 98.17 | |
| cd05716 | 98 | Ig_pIgR Immunoglobulin (Ig)-like domain in the pol | 98.16 | |
| cd05720 | 104 | Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD | 98.15 | |
| cd07700 | 107 | IgV_CD8_beta Immunoglobulin (Ig) like domain of CD | 98.12 | |
| cd07703 | 95 | Ig2_Nectin-2_like Second immunoglobulin (Ig) domai | 98.12 | |
| cd05719 | 95 | Ig2_PVR_like Second immunoglobulin (Ig) domain of | 98.11 | |
| smart00407 | 75 | IGc1 Immunoglobulin C-Type. | 98.09 | |
| cd05772 | 111 | IgC_SIRP Signal-regulatory protein (SIRP) immunogl | 98.05 | |
| cd07698 | 93 | IgC_MHC_I_alpha3 Class I major histocompatibility | 98.03 | |
| cd07706 | 116 | IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom | 97.99 | |
| cd05771 | 139 | IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | 97.97 | |
| PHA03376 | 221 | BARF1; Provisional | 97.92 | |
| cd05712 | 119 | Ig_Siglec_N Immunoglobulin (Ig) domain at the N te | 97.92 | |
| cd05766 | 94 | IgC_MHC_II_beta Class II major histocompatibility | 97.87 | |
| cd05770 | 93 | IgC_beta2m Class I major histocompatibility comple | 97.84 | |
| cd07699 | 100 | IgC_L Immunoglobulin Constant domain. IgC_L: Immun | 97.82 | |
| cd05768 | 102 | IgC_CH4 CH4 domain (fourth constant Ig domain of t | 97.78 | |
| cd05847 | 94 | IgC_CH2_IgE CH2 domain (second constant Ig domain | 97.74 | |
| cd04981 | 117 | IgV_H Immunoglobulin (Ig) heavy chain (H), variabl | 97.66 | |
| PF07654 | 83 | C1-set: Immunoglobulin C1-set domain; InterPro: IP | 97.62 | |
| cd05767 | 94 | IgC_MHC_II_alpha Class II major histocompatibility | 97.61 | |
| cd05771 | 139 | IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | 97.6 | |
| smart00406 | 81 | IGv Immunoglobulin V-Type. | 97.49 | |
| cd07692 | 65 | Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of | 97.47 | |
| cd07704 | 97 | Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom | 97.43 | |
| cd07696 | 96 | IgC_CH3 CH3 domain (third constant Ig domain of th | 97.38 | |
| cd07697 | 96 | IgC_TCR_gamma T cell receptor (TCR) gamma chain co | 97.36 | |
| cd05769 | 115 | IgC_TCR_beta T cell receptor (TCR) beta chain cons | 97.27 | |
| PHA02633 | 63 | hypothetical protein; Provisional | 97.19 | |
| cd04985 | 95 | IgC_CH1 CH1 domain (first constant Ig domain of th | 97.17 | |
| cd07691 | 69 | Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain | 97.16 | |
| cd04986 | 99 | IgC_CH2 CH2 domain (second constant Ig domain of t | 96.56 | |
| PF08204 | 130 | V-set_CD47: CD47 immunoglobulin-like domain; Inter | 95.97 | |
| KOG3515|consensus | 741 | 95.87 | ||
| cd05721 | 115 | IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic | 95.74 | |
| cd07689 | 99 | Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain | 95.61 | |
| KOG1480|consensus | 909 | 95.57 | ||
| PF06328 | 89 | Lep_receptor_Ig: Ig-like C2-type domain; InterPro: | 95.51 | |
| PF11465 | 108 | Receptor_2B4: Natural killer cell receptor 2B4; In | 95.22 | |
| KOG4597|consensus | 560 | 95.07 | ||
| PHA03042 | 286 | CD47-like protein; Provisional | 95.04 | |
| PF07354 | 271 | Sp38: Zona-pellucida-binding protein (Sp38); Inter | 95.04 | |
| cd05890 | 98 | Ig2_Nectin-1_like Second immunoglobulin (Ig) domai | 94.93 | |
| PF05790 | 80 | C2-set: Immunoglobulin C2-set domain; InterPro: IP | 94.66 | |
| PHA03270 | 466 | envelope glycoprotein C; Provisional | 93.93 | |
| KOG3515|consensus | 741 | 93.45 | ||
| PHA02865 | 338 | MHC-like TNF binding protein; Provisional | 91.02 | |
| PHA03273 | 486 | envelope glycoprotein C; Provisional | 89.78 | |
| PHA02982 | 251 | hypothetical protein; Provisional | 89.52 | |
| PHA03269 | 566 | envelope glycoprotein C; Provisional | 88.88 | |
| PHA03271 | 490 | envelope glycoprotein C; Provisional | 85.42 | |
| PF06832 | 89 | BiPBP_C: Penicillin-Binding Protein C-terminus Fam | 83.48 | |
| PHA02914 | 500 | Immunoglobulin-like domain protein; Provisional | 81.77 | |
| PHA03052 | 69 | Hypothetical protein; Provisional | 81.0 |
| >cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins | Back alignment and domain information |
|---|
Probab=99.77 E-value=3.2e-17 Score=87.29 Aligned_cols=87 Identities=21% Similarity=0.319 Sum_probs=67.2
Q ss_pred eeecCCeEEEEeEEcc-cCCCeEEEEECCEEeccccceeeEEeEecCcceEEEEEEcCCCCCCCEEEEEEeecCCceeeE
Q psy9145 22 LSVLGHKIVFICMAKG-KPRPHITWFKDGVELYAHMYVNLHEWHYGTDRIKSKIEIDPATQMDAGIYECYADNMYNVDTR 100 (111)
Q Consensus 22 ~~~~g~~~~l~C~~~~-~p~p~i~w~~~g~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~~g~y~C~~~n~~g~~~~ 100 (111)
.+.+|+.+.|.|.+.| .|+|.+.|+++|..+...................+.|.|..++..|+|.|.|.|.|..|....
T Consensus 14 ~v~~G~~v~L~c~v~g~~P~p~v~W~Kdg~~i~~~~~~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Ytc~A~N~~G~~~~ 93 (101)
T cd04975 14 FVNLGENLNLVVEVEAYPPPPHINWTYDNRTLTNKLTEIVTSENESEYRYVSELKLVRLKESEAGTYTFLASNSDASKSL 93 (101)
T ss_pred EEECCCCEEEEEEEEecCCCCccEEEeCCeeCCCCcceeEEEeccCcceEEEEEEEeecCHhhCeeEEEEEECCCccEEE
Confidence 5679999999999999 889999999999888643322111100011122467999999999999999999999999999
Q ss_pred EEEEEEEE
Q psy9145 101 TFKTDFSI 108 (111)
Q Consensus 101 ~~~l~v~~ 108 (111)
.+.|.|.+
T Consensus 94 t~~L~V~v 101 (101)
T cd04975 94 TFELYVNV 101 (101)
T ss_pred EEEEEEEC
Confidence 99888753
|
Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes |
| >cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein | Back alignment and domain information |
|---|
| >cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) | Back alignment and domain information |
|---|
| >cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) | Back alignment and domain information |
|---|
| >cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha | Back alignment and domain information |
|---|
| >cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) | Back alignment and domain information |
|---|
| >cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB | Back alignment and domain information |
|---|
| >cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin | Back alignment and domain information |
|---|
| >cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) | Back alignment and domain information |
|---|
| >cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) | Back alignment and domain information |
|---|
| >cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins | Back alignment and domain information |
|---|
| >cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor | Back alignment and domain information |
|---|
| >cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins | Back alignment and domain information |
|---|
| >cd04969 Ig5_Contactin_like Fifth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins | Back alignment and domain information |
|---|
| >cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) | Back alignment and domain information |
|---|
| >cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) | Back alignment and domain information |
|---|
| >cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin | Back alignment and domain information |
|---|
| >cd04968 Ig3_Contactin_like Third Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) | Back alignment and domain information |
|---|
| >cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin | Back alignment and domain information |
|---|
| >cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) | Back alignment and domain information |
|---|
| >cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 | Back alignment and domain information |
|---|
| >cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC | Back alignment and domain information |
|---|
| >PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 | Back alignment and domain information |
|---|
| >cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin | Back alignment and domain information |
|---|
| >cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin | Back alignment and domain information |
|---|
| >cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) | Back alignment and domain information |
|---|
| >cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 | Back alignment and domain information |
|---|
| >cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins | Back alignment and domain information |
|---|
| >cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) | Back alignment and domain information |
|---|
| >cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) | Back alignment and domain information |
|---|
| >cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins | Back alignment and domain information |
|---|
| >cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 | Back alignment and domain information |
|---|
| >cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins | Back alignment and domain information |
|---|
| >cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) | Back alignment and domain information |
|---|
| >cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins | Back alignment and domain information |
|---|
| >cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily | Back alignment and domain information |
|---|
| >cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 | Back alignment and domain information |
|---|
| >cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) | Back alignment and domain information |
|---|
| >cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR | Back alignment and domain information |
|---|
| >cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors | Back alignment and domain information |
|---|
| >cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 | Back alignment and domain information |
|---|
| >cd04970 Ig6_Contactin_like Sixth Ig domain of contactin | Back alignment and domain information |
|---|
| >cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) | Back alignment and domain information |
|---|
| >cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins | Back alignment and domain information |
|---|
| >cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) | Back alignment and domain information |
|---|
| >cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins | Back alignment and domain information |
|---|
| >cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 | Back alignment and domain information |
|---|
| >cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins | Back alignment and domain information |
|---|
| >cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 | Back alignment and domain information |
|---|
| >cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) | Back alignment and domain information |
|---|
| >cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) | Back alignment and domain information |
|---|
| >cd04967 Ig1_Contactin First Ig domain of contactin | Back alignment and domain information |
|---|
| >cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) | Back alignment and domain information |
|---|
| >cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) | Back alignment and domain information |
|---|
| >cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins | Back alignment and domain information |
|---|
| >cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 | Back alignment and domain information |
|---|
| >cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) | Back alignment and domain information |
|---|
| >cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins | Back alignment and domain information |
|---|
| >cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin | Back alignment and domain information |
|---|
| >cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D | Back alignment and domain information |
|---|
| >cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >smart00408 IGc2 Immunoglobulin C-2 Type | Back alignment and domain information |
|---|
| >cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins | Back alignment and domain information |
|---|
| >smart00410 IG_like Immunoglobulin like | Back alignment and domain information |
|---|
| >smart00409 IG Immunoglobulin | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A | Back alignment and domain information |
|---|
| >cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) | Back alignment and domain information |
|---|
| >cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins | Back alignment and domain information |
|---|
| >cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) | Back alignment and domain information |
|---|
| >cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) | Back alignment and domain information |
|---|
| >PHA02826 IL-1 receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B | Back alignment and domain information |
|---|
| >cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins | Back alignment and domain information |
|---|
| >cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins | Back alignment and domain information |
|---|
| >cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan | Back alignment and domain information |
|---|
| >cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) | Back alignment and domain information |
|---|
| >cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins | Back alignment and domain information |
|---|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) | Back alignment and domain information |
|---|
| >cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) | Back alignment and domain information |
|---|
| >PHA02785 IL-beta-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan | Back alignment and domain information |
|---|
| >cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) | Back alignment and domain information |
|---|
| >cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) | Back alignment and domain information |
|---|
| >cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) | Back alignment and domain information |
|---|
| >PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C | Back alignment and domain information |
|---|
| >PHA02826 IL-1 receptor-like protein; Provisional | Back alignment and domain information |
|---|
| >cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican | Back alignment and domain information |
|---|
| >cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) | Back alignment and domain information |
|---|
| >cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins | Back alignment and domain information |
|---|
| >cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 | Back alignment and domain information |
|---|
| >cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) | Back alignment and domain information |
|---|
| >cd00098 IgC Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) | Back alignment and domain information |
|---|
| >cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins | Back alignment and domain information |
|---|
| >cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like | Back alignment and domain information |
|---|
| >cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) | Back alignment and domain information |
|---|
| >cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins | Back alignment and domain information |
|---|
| >cd00099 IgV Immunoglobulin variable domain (IgV) | Back alignment and domain information |
|---|
| >cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins | Back alignment and domain information |
|---|
| >cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI | Back alignment and domain information |
|---|
| >cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins | Back alignment and domain information |
|---|
| >cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) | Back alignment and domain information |
|---|
| >cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain | Back alignment and domain information |
|---|
| >cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain | Back alignment and domain information |
|---|
| >cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain | Back alignment and domain information |
|---|
| >PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd00096 Ig Immunoglobulin domain | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins | Back alignment and domain information |
|---|
| >cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain | Back alignment and domain information |
|---|
| >cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins | Back alignment and domain information |
|---|
| >PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins | Back alignment and domain information |
|---|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >PHA02987 Ig domain OX-2-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins | Back alignment and domain information |
|---|
| >cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) | Back alignment and domain information |
|---|
| >cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain | Back alignment and domain information |
|---|
| >cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain | Back alignment and domain information |
|---|
| >cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins | Back alignment and domain information |
|---|
| >cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins | Back alignment and domain information |
|---|
| >smart00407 IGc1 Immunoglobulin C-Type | Back alignment and domain information |
|---|
| >cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain | Back alignment and domain information |
|---|
| >cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain | Back alignment and domain information |
|---|
| >cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | Back alignment and domain information |
|---|
| >PHA03376 BARF1; Provisional | Back alignment and domain information |
|---|
| >cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) | Back alignment and domain information |
|---|
| >cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin | Back alignment and domain information |
|---|
| >cd07699 IgC_L Immunoglobulin Constant domain | Back alignment and domain information |
|---|
| >cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) | Back alignment and domain information |
|---|
| >cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain | Back alignment and domain information |
|---|
| >PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain | Back alignment and domain information |
|---|
| >smart00406 IGv Immunoglobulin V-Type | Back alignment and domain information |
|---|
| >cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain | Back alignment and domain information |
|---|
| >cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins | Back alignment and domain information |
|---|
| >cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain | Back alignment and domain information |
|---|
| >cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain | Back alignment and domain information |
|---|
| >PHA02633 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains | Back alignment and domain information |
|---|
| >cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin | Back alignment and domain information |
|---|
| >PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] | Back alignment and domain information |
|---|
| >KOG3515|consensus | Back alignment and domain information |
|---|
| >cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) | Back alignment and domain information |
|---|
| >cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins | Back alignment and domain information |
|---|
| >KOG1480|consensus | Back alignment and domain information |
|---|
| >PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] | Back alignment and domain information |
|---|
| >PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells | Back alignment and domain information |
|---|
| >KOG4597|consensus | Back alignment and domain information |
|---|
| >PHA03042 CD47-like protein; Provisional | Back alignment and domain information |
|---|
| >PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals | Back alignment and domain information |
|---|
| >cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins | Back alignment and domain information |
|---|
| >PF05790 C2-set: Immunoglobulin C2-set domain; InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds | Back alignment and domain information |
|---|
| >PHA03270 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >KOG3515|consensus | Back alignment and domain information |
|---|
| >PHA02865 MHC-like TNF binding protein; Provisional | Back alignment and domain information |
|---|
| >PHA03273 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >PHA02982 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA03269 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >PHA03271 envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >PF06832 BiPBP_C: Penicillin-Binding Protein C-terminus Family; InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs) | Back alignment and domain information |
|---|
| >PHA02914 Immunoglobulin-like domain protein; Provisional | Back alignment and domain information |
|---|
| >PHA03052 Hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 111 | ||||
| 2yd5_A | 214 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 4e-06 | ||
| 3pxh_A | 201 | Tandem Ig Domains Of Tyrosine Phosphatase Lar Lengt | 5e-06 | ||
| 2yd6_A | 212 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 1e-05 | ||
| 3kld_A | 384 | Ptprg Cntn4 Complex Length = 384 | 4e-05 | ||
| 3jxa_A | 383 | Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = | 4e-05 | ||
| 2yd4_A | 210 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 5e-05 | ||
| 2yd2_A | 214 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 5e-05 | ||
| 2yd3_A | 202 | Crystal Structure Of The N-Terminal Ig1-2 Module Of | 6e-05 | ||
| 2yd9_A | 304 | Crystal Structure Of The N-Terminal Ig1-3 Module Of | 9e-05 | ||
| 1cs6_A | 382 | N-terminal Fragment Of Axonin-1 From Chicken Length | 1e-04 | ||
| 1f97_A | 212 | Soluble Part Of The Junction Adhesion Molecule From | 1e-04 | ||
| 2om5_A | 381 | N-Terminal Fragment Of Human Tax1 Length = 381 | 4e-04 | ||
| 1nbq_A | 209 | Crystal Structure Of Human Junctional Adhesion Mole | 5e-04 | ||
| 1cvs_C | 225 | Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex L | 8e-04 | ||
| 3ojv_C | 226 | Crystal Structure Of Fgf1 Complexed With The Ectodo | 8e-04 |
| >pdb|2YD5|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Lar Length = 214 | Back alignment and structure |
|
| >pdb|3PXH|A Chain A, Tandem Ig Domains Of Tyrosine Phosphatase Lar Length = 201 | Back alignment and structure |
| >pdb|2YD6|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Delta Length = 212 | Back alignment and structure |
| >pdb|3KLD|A Chain A, Ptprg Cntn4 Complex Length = 384 | Back alignment and structure |
| >pdb|3JXA|A Chain A, Immunoglobulin Domains 1-4 Of Mouse Cntn4 Length = 383 | Back alignment and structure |
| >pdb|2YD4|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Chicken Receptor Protein Tyrosine Phosphatase Sigma Length = 210 | Back alignment and structure |
| >pdb|2YD2|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 214 | Back alignment and structure |
| >pdb|2YD3|A Chain A, Crystal Structure Of The N-Terminal Ig1-2 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 202 | Back alignment and structure |
| >pdb|2YD9|A Chain A, Crystal Structure Of The N-Terminal Ig1-3 Module Of Human Receptor Protein Tyrosine Phosphatase Sigma Length = 304 | Back alignment and structure |
| >pdb|1CS6|A Chain A, N-terminal Fragment Of Axonin-1 From Chicken Length = 382 | Back alignment and structure |
| >pdb|1F97|A Chain A, Soluble Part Of The Junction Adhesion Molecule From Mouse Length = 212 | Back alignment and structure |
| >pdb|2OM5|A Chain A, N-Terminal Fragment Of Human Tax1 Length = 381 | Back alignment and structure |
| >pdb|1NBQ|A Chain A, Crystal Structure Of Human Junctional Adhesion Molecule Type 1 Length = 209 | Back alignment and structure |
| >pdb|1CVS|C Chain C, Crystal Structure Of A Dimeric Fgf2-Fgfr1 Complex Length = 225 | Back alignment and structure |
| >pdb|3OJV|C Chain C, Crystal Structure Of Fgf1 Complexed With The Ectodomain Of Fgfr1c Exhibiting An Ordered Ligand Specificity-Determining Betac'-Betae Loop Length = 226 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 111 | |||
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 2e-20 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 2e-17 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 5e-17 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 1e-15 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 2e-15 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 2e-13 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 3e-15 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 2e-12 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 2e-12 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 3e-12 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 8e-12 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 3e-11 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 3e-10 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 9e-07 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 4e-15 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 1e-14 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 4e-15 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 4e-15 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 8e-14 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 7e-13 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 5e-15 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 3e-09 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 5e-15 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 7e-15 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 8e-15 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 9e-15 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 1e-14 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 6e-14 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 1e-14 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 1e-14 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 1e-14 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 1e-14 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 8e-12 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 2e-11 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 4e-08 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 1e-14 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 6e-13 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 2e-14 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 3e-13 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 2e-14 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 5e-10 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 2e-09 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 2e-14 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 8e-10 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 2e-14 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 2e-14 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 2e-12 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 4e-11 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 2e-14 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 3e-13 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 2e-14 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 6e-14 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 1e-12 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 4e-12 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 1e-11 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 4e-11 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 3e-14 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 3e-14 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 3e-12 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 3e-14 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 5e-12 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 3e-14 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 3e-14 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 4e-14 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 5e-14 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 4e-12 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 5e-14 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 7e-13 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 6e-14 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 6e-14 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 4e-13 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 7e-14 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 9e-14 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 9e-14 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 1e-13 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 2e-12 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 4e-10 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 1e-13 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 1e-12 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 2e-12 | |
| 2v9t_A | 117 | Roundabout homolog 1; structural protein-receptor | 1e-13 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 1e-13 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 9e-13 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 1e-13 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 1e-13 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 5e-13 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 2e-11 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 1e-09 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 6e-07 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 8e-07 | |
| 3qr2_A | 137 | Basigin; CD147, EMMPRIN, immunoglobulin-like domai | 1e-13 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 1e-13 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 7e-13 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 1e-12 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 1e-11 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 1e-13 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 2e-13 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 2e-13 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 2e-06 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 2e-13 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 7e-11 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 7e-11 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 7e-06 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 2e-13 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 2e-13 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 6e-12 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 2e-13 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 9e-12 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 4e-08 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 2e-13 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 3e-13 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 4e-13 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 6e-13 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 1e-12 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 7e-13 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 8e-13 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 7e-13 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 7e-12 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 8e-13 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 8e-13 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 6e-06 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-12 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 1e-09 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 2e-12 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 9e-12 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 1e-10 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 1e-08 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 2e-12 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 1e-11 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 3e-11 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 1e-08 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 2e-12 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 5e-11 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 3e-10 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 2e-09 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 3e-06 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 3e-12 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 3e-12 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 2e-11 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 2e-04 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 3e-12 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 3e-12 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 5e-12 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 3e-11 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 5e-07 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 5e-12 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 9e-10 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 5e-12 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 6e-12 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 3e-11 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 1e-11 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 6e-11 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 7e-11 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 7e-07 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 2e-11 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 2e-11 | |
| 1nn8_R | 302 | CD155 antigen, poliovirus receptor; icosahedral vi | 2e-11 | |
| 1nn8_R | 302 | CD155 antigen, poliovirus receptor; icosahedral vi | 5e-09 | |
| 1nn8_R | 302 | CD155 antigen, poliovirus receptor; icosahedral vi | 7e-05 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 4e-11 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 3e-05 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 4e-11 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 6e-09 | |
| 2eo1_A | 102 | OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 | 4e-11 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 5e-11 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 8e-09 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 1e-06 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 5e-11 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 8e-06 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 6e-11 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 7e-11 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 7e-11 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 3e-10 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 1e-10 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 1e-08 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 3e-07 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 1e-10 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 1e-10 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 1e-06 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 9e-06 | |
| 2e6p_A | 104 | Obscurin-like protein 1; IG-like domain, structura | 1e-10 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 2e-10 | |
| 2cr6_A | 115 | KIAA1556 protein, obscurin; IG-fold, immunoglobuli | 2e-10 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 3e-10 | |
| 2edk_A | 101 | Myosin-binding protein C, fast-type; IG fold, fast | 3e-10 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 3e-10 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 5e-10 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 8e-10 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 7e-09 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 1e-08 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 3e-08 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 3e-07 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 4e-10 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 3e-09 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 3e-09 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 4e-10 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 5e-10 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 8e-10 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 8e-10 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 9e-10 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 4e-09 | |
| 3cx2_A | 108 | Myosin-binding protein C, cardiac-type; protonatio | 1e-09 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 2e-09 | |
| 2yuv_A | 100 | Myosin-binding protein C, SLOW-type; SLOW-type myo | 2e-09 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 3e-09 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 3e-09 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 3e-09 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 1e-07 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 3e-09 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 3e-09 | |
| 2k1m_A | 95 | Myosin-binding protein C, cardiac-type; IG-I domai | 4e-09 | |
| 2e7b_A | 103 | Obscurin; IG-like domain, structural genomics, NPP | 4e-09 | |
| 3s35_X | 122 | Vascular endothelial growth factor receptor 2; ant | 7e-09 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 7e-09 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 1e-04 | |
| 2ch8_A | 201 | BARF1, P33, 33 kDa early protein; viral protein, i | 8e-09 | |
| 2ch8_A | 201 | BARF1, P33, 33 kDa early protein; viral protein, i | 2e-05 | |
| 2dm7_A | 108 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 1e-08 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 1e-08 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 2e-07 | |
| 2edh_A | 113 | Obscurin; structural genomics, NPPSFA, national pr | 2e-08 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 2e-08 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 4e-05 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 3e-04 | |
| 3so5_A | 112 | LIG-3, leucine-rich repeats and immunoglobulin-lik | 2e-08 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 2e-08 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 4e-07 | |
| 2dku_A | 103 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 2e-08 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 3e-08 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 3e-08 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 1e-05 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 3e-08 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 5e-07 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 4e-08 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 2e-07 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 5e-08 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 7e-06 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 1e-04 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 5e-08 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 4e-06 | |
| 1pd6_A | 104 | Cardiac MYBP-C;, myosin-binding protein C, cardiac | 6e-08 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 8e-08 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 7e-06 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 8e-08 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 9e-08 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 5e-05 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 1e-07 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 1e-05 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 1e-07 | |
| 2pet_A | 231 | Lutheran blood group glycoprotein; immunoglobulin | 1e-07 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-07 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 3e-07 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 1e-06 | |
| 3m45_A | 108 | Cell adhesion molecule 2; IG fold, dimer, disulfid | 5e-07 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 6e-07 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 3e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 7e-07 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 1e-06 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 5e-06 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 2e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 4e-06 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 5e-06 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 2e-05 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 8e-06 | |
| 2edn_A | 118 | Myosin-binding protein C, fast-type; beta-sandwich | 1e-05 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 2e-05 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 2e-05 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 2e-05 | |
| 1z9m_A | 145 | GAPA225; nectin-like, IG-like domain, V domain, ce | 2e-05 | |
| 3rbg_A | 124 | Cytotoxic and regulatory T-cell molecule; IGV, crt | 2e-05 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 3e-05 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 4e-04 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 3e-04 | |
| 1xiw_A | 105 | T-cell surface glycoprotein CD3 epsilon chain; CD3 | 4e-04 | |
| 3shs_A | 304 | HOC head outer capsid protein; immunoglobulin-like | 6e-04 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 8e-04 |
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Length = 103 | Back alignment and structure |
|---|
Score = 78.2 bits (193), Expect = 2e-20
Identities = 20/91 (21%), Positives = 31/91 (34%)
Query: 16 QVKYFPLSVLGHKIVFICMAKGKPRPHITWFKDGVELYAHMYVNLHEWHYGTDRIKSKIE 75
+ + H KG P+P + WF +G L Y+ ++
Sbjct: 6 TITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQ 65
Query: 76 IDPATQMDAGIYECYADNMYNVDTRTFKTDF 106
+D T M+ G Y A N Y D + F
Sbjct: 66 LDNPTHMNNGDYTLIAKNEYGKDEKQISAHF 96
|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Length = 126 | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 118 | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Length = 213 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Length = 122 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Length = 214 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Length = 204 | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Length = 349 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Length = 222 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Length = 176 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Length = 170 | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Length = 231 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Length = 182 | Back alignment and structure |
|---|
| >3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Length = 175 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Length = 204 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Length = 585 | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Length = 201 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Length = 186 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1xiw_A T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon, CD3-delta, UCHT1-SCFV, immunoglobulin fold, antibody-antigen complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 Length = 105 | Back alignment and structure |
|---|
| >3shs_A HOC head outer capsid protein; immunoglobulin-like domain, phage capsid decorative protein, interaction with bacteria; 1.95A {Enterobacteria phage RB49} Length = 304 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Length = 268 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 111 | |||
| 3knb_A | 100 | Titin; IG-like, titin, OBSL1, ATP-binding, calmodu | 99.76 | |
| 3knb_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, AT | 99.75 | |
| 1wwb_X | 103 | Protein (brain derived neurotrophic factor recepto | 99.73 | |
| 1he7_A | 126 | High affinity nerve growth factor receptor; transf | 99.7 | |
| 1g1c_A | 99 | Immunoglobulin-like domain I1 from titin; immunogl | 99.68 | |
| 3qp3_A | 103 | Titin; I-SET IG-like, sarcomere, M-BAND, transfera | 99.68 | |
| 3puc_A | 99 | Titin; I-SET IG-like domain, M-BAND, transferase; | 99.68 | |
| 1wit_A | 93 | Twitchin 18TH IGSF module; immunoglobulin superfam | 99.67 | |
| 2cqv_A | 114 | MLCK, myosin light chain kinase, smooth muscle and | 99.67 | |
| 1u2h_A | 99 | APEG-1, aortic preferentially expressed protein 1; | 99.67 | |
| 1nct_A | 106 | Titin; cell adhesion, glycoprotein, transmembrane, | 99.66 | |
| 2kdg_A | 100 | Myotilin; immonoglobulin domain, actin-binding, st | 99.66 | |
| 2e7c_A | 118 | Myosin-binding protein C, fast-type; IG-like domai | 99.65 | |
| 3irg_A | 100 | Titin; IG-like, titin, OBSL1, complex, alternative | 99.65 | |
| 2bk8_A | 97 | Connectin, M1, titin heart isoform N2-B; IG domain | 99.64 | |
| 3irg_B | 107 | Obscurin-like protein 1; IG-like, titin, OBSL1, co | 99.64 | |
| 1gxe_A | 139 | Myosin binding protein C, cardiac-type; cytoskelet | 99.63 | |
| 3caf_A | 100 | Fibroblast growth factor receptor 2; FGFR2, D2, AT | 99.63 | |
| 2ckn_A | 95 | Basic fibroblast growth factor receptor 1; kinase, | 99.62 | |
| 2kkq_A | 116 | Myotilin; unknown function, actin-binding, cell me | 99.62 | |
| 3cx2_A | 108 | Myosin-binding protein C, cardiac-type; protonatio | 99.62 | |
| 2yr3_A | 99 | Myosin light chain kinase, smooth muscle; IG domai | 99.62 | |
| 1fhg_A | 154 | Telokin; immunoglobulin fold, beta barrel, contrac | 99.61 | |
| 1wwc_A | 118 | Protein (NT-3 growth factor receptor TRKC); TRK re | 99.6 | |
| 3kvq_A | 108 | Vascular endothelial growth factor receptor 2; veg | 99.59 | |
| 2edj_A | 100 | Roundabout homolog 2; KIAA1568 protein, beta sandw | 99.58 | |
| 1gl4_B | 98 | Basement membrane-specific heparan sulfate proteog | 99.58 | |
| 2dm2_A | 110 | Palladin; beta-sandwich, KIAA0992, actin-associate | 99.58 | |
| 3bfo_A | 91 | Mucosa-associated lymphoid tissue lymphoma translo | 99.58 | |
| 2cr3_A | 99 | Basic fibroblast growth factor receptor 1; IG fold | 99.57 | |
| 4hwu_A | 95 | Fibroblast growth factor receptor 2; FGFR2, KGFR, | 99.55 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 99.55 | |
| 2lu7_A | 84 | Obscurin-like protein 1; structural genomics, nort | 99.55 | |
| 2dm3_A | 110 | KIAA0992 protein, palladin; beta-sandwich, myopall | 99.55 | |
| 2eo9_A | 118 | Roundabout homolog 1; beta-sandwich, IG-fold, H-RO | 99.54 | |
| 2yuz_A | 100 | Myosin-binding protein C, SLOW-type; immunoglobuli | 99.53 | |
| 2dav_A | 126 | SLOW MYBP-C, myosin-binding protein C, SLOW-type; | 99.52 | |
| 3s35_X | 122 | Vascular endothelial growth factor receptor 2; ant | 99.52 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 99.52 | |
| 3so5_A | 112 | LIG-3, leucine-rich repeats and immunoglobulin-lik | 99.51 | |
| 2ens_A | 96 | Advanced glycosylation END product-specific recept | 99.51 | |
| 2v9t_A | 117 | Roundabout homolog 1; structural protein-receptor | 99.51 | |
| 1waa_A | 93 | Titin; metal binding protein, calmodulin-binding, | 99.5 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 99.49 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 99.49 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 99.48 | |
| 2cry_A | 122 | KIN of IRRE-like protein 3; IG fold, KIN of irregu | 99.48 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 99.48 | |
| 2lvc_A | 91 | Obscurin-like protein 1; structural genomics, nort | 99.47 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 99.47 | |
| 2edn_A | 118 | Myosin-binding protein C, fast-type; beta-sandwich | 99.47 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 99.47 | |
| 2k1m_A | 95 | Myosin-binding protein C, cardiac-type; IG-I domai | 99.46 | |
| 3m45_A | 108 | Cell adhesion molecule 2; IG fold, dimer, disulfid | 99.46 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 99.46 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 99.45 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 99.44 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 99.44 | |
| 2cr6_A | 115 | KIAA1556 protein, obscurin; IG-fold, immunoglobuli | 99.44 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 99.44 | |
| 2dlt_A | 106 | Myosin binding protein C, fast-type; IG-like domai | 99.44 | |
| 2e6p_A | 104 | Obscurin-like protein 1; IG-like domain, structura | 99.43 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 99.43 | |
| 2edh_A | 113 | Obscurin; structural genomics, NPPSFA, national pr | 99.43 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 99.43 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 99.43 | |
| 1x44_A | 103 | Myosin-binding protein C, SLOW-type; IG-like domai | 99.42 | |
| 2edf_A | 103 | Obscurin; beta-sandwich, IG-fold, structural genom | 99.42 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.42 | |
| 3lcy_A | 197 | Titin; A-BAND, IG tandem domains, ATP-binding, cal | 99.41 | |
| 2a38_A | 194 | Titin; Z1Z2, structural protein; 2.00A {Homo sapie | 99.41 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 99.41 | |
| 3qr2_A | 137 | Basigin; CD147, EMMPRIN, immunoglobulin-like domai | 99.41 | |
| 2j8h_A | 197 | Titin, connectin; cardiomyopathy, nuclear protein, | 99.4 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.4 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 99.4 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 99.4 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 99.4 | |
| 3rbg_A | 124 | Cytotoxic and regulatory T-cell molecule; IGV, crt | 99.4 | |
| 2cpc_A | 113 | KIAA0657 protein; immunoglobulin domain, IG domain | 99.4 | |
| 4fqp_A | 313 | Poliovirus receptor; immunoglobulin-like domain, I | 99.39 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 99.39 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 99.39 | |
| 4frw_A | 218 | Poliovirus receptor-related protein 4; immunoglobu | 99.39 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 99.39 | |
| 2va4_A | 192 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; t | 99.39 | |
| 1pd6_A | 104 | Cardiac MYBP-C;, myosin-binding protein C, cardiac | 99.39 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 99.38 | |
| 4fa8_A | 203 | Secreted protein BARF1; immunoglobulin-like domain | 99.38 | |
| 2yuv_A | 100 | Myosin-binding protein C, SLOW-type; SLOW-type myo | 99.38 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 99.37 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 99.36 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 99.36 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 99.36 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 99.36 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 99.36 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 99.35 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 99.35 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 99.35 | |
| 2edk_A | 101 | Myosin-binding protein C, fast-type; IG fold, fast | 99.35 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 99.35 | |
| 2yd1_A | 212 | Tyrosine-protein phosphatase LAR; hydrolase; 1.80A | 99.35 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 99.35 | |
| 2yd6_A | 212 | PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa | 99.34 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.34 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 99.34 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 99.34 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 99.33 | |
| 2eny_A | 104 | Obscurin; beta-sandwich, IG-fold, structural genom | 99.33 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 99.33 | |
| 3k0w_A | 218 | Mucosa-associated lymphoid tissue lymphoma translo | 99.33 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 99.33 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 99.33 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 99.33 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 99.32 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 99.32 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 99.32 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 99.31 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.31 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 99.31 | |
| 2wv3_A | 190 | Neuroplastin; igcam, membrane, glycoprotein, cell | 99.31 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 99.31 | |
| 2c5d_C | 195 | AXL oncogene, tyrosine-protein kinase receptor UFO | 99.31 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 99.31 | |
| 2dku_A | 103 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 99.31 | |
| 2e7b_A | 103 | Obscurin; IG-like domain, structural genomics, NPP | 99.3 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 99.3 | |
| 1rhf_A | 182 | Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 | 99.3 | |
| 3grw_A | 241 | Fibroblast growth factor receptor 3; FGFR3, protei | 99.3 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 99.29 | |
| 2yd9_A | 304 | Receptor-type tyrosine-protein phosphatase S; hydr | 99.29 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 99.29 | |
| 3qs7_E | 423 | FL cytokine receptor; immunoglobulin-like domain, | 99.29 | |
| 2eo1_A | 102 | OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 | 99.29 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 99.28 | |
| 3ojm_B | 231 | Fibroblast growth factor receptor 2; beta trefoil | 99.28 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 99.28 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 99.28 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 99.28 | |
| 2e6q_A | 112 | Obscurin-like protein 1; IG-like domain, structura | 99.28 | |
| 1z9m_A | 145 | GAPA225; nectin-like, IG-like domain, V domain, ce | 99.28 | |
| 3rbs_A | 207 | Myomesin-1; immunoglobulin C-SET domain, contractI | 99.28 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 99.27 | |
| 4fa8_A | 203 | Secreted protein BARF1; immunoglobulin-like domain | 99.27 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 99.26 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 99.26 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 99.26 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 99.25 | |
| 3bp6_B | 202 | Programmed cell death 1 ligand 2; PD-1, PD-L2, com | 99.25 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.25 | |
| 2iep_A | 192 | Muscle-specific kinase receptor; beta-sandwich, si | 99.25 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 99.24 | |
| 2v44_A | 189 | NCAM2, neural cell adhesion molecule 2; phosphoryl | 99.24 | |
| 2vr9_A | 217 | Roundabout 1, ROBO; immunoglobulin-like domain, AX | 99.24 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 99.24 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 99.23 | |
| 2dm7_A | 108 | KIAA1556 protein; beta-sandwich, IG-fold, obscurin | 99.23 | |
| 1epf_A | 191 | NCAM, protein (neural cell adhesion molecule); imm | 99.23 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 99.23 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 99.22 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 99.22 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 99.22 | |
| 4fom_A | 308 | Poliovirus receptor-related protein 3; immunoglobu | 99.22 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.22 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 99.22 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 99.22 | |
| 1pko_A | 139 | Myelin oligodendrocyte glycoprotein; IGV-domain, i | 99.21 | |
| 4i0k_A | 222 | CD276 antigen; immunoglobulin domain, glycoprotein | 99.21 | |
| 2y25_A | 317 | Myomesin; structural protein, sarcomere, M-BAND, i | 99.21 | |
| 4hwn_A | 108 | FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG | 99.2 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 99.19 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 99.19 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 99.19 | |
| 4f80_A | 226 | Butyrophilin subfamily 3 member A1; B7 superfamily | 99.19 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 99.19 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 99.19 | |
| 4gos_A | 125 | V-SET domain-containing T-cell activation inhibit; | 99.19 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 99.18 | |
| 1fnl_A | 175 | Low affinity immunoglobulin gamma FC region recept | 99.18 | |
| 3p2t_A | 196 | Leukocyte immunoglobulin-like receptor subfamily 4 | 99.18 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 99.18 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 99.18 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 99.18 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 99.18 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 99.17 | |
| 2d3v_A | 196 | Leukocyte immunoglobulin-like receptor subfamily A | 99.17 | |
| 2r15_A | 212 | Myomesin-1; sarcomeric protein, IG-like domains, h | 99.16 | |
| 2v9r_A | 212 | Roundabout homolog 1; proto-oncogene, differentiat | 99.16 | |
| 1jbj_A | 186 | CD3 epsilon and gamma ectodomain fragment complex; | 99.16 | |
| 3qs9_E | 527 | FL cytokine receptor; immunoglobulin-like domain, | 99.15 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 99.15 | |
| 1eaj_A | 126 | Coxsackie virus and adenovirus receptor; virus/vir | 99.15 | |
| 3sgj_C | 204 | Human FCG3A receptor; receptor complex, FC recepto | 99.15 | |
| 2vsd_A | 105 | CHIR AB1; immune system receptor, FC receptor; HET | 99.15 | |
| 1gsm_A | 210 | Madcam-1, mucosal addressin cell adhesion molecule | 99.14 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 99.14 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 99.14 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 99.14 | |
| 1ry7_B | 334 | FGFR-3, fibroblast growth factor receptor 3; FGF-F | 99.13 | |
| 1xau_A | 122 | B- and T-lymphocyte attenuator; IG domain, beta sa | 99.13 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 99.13 | |
| 2v5t_A | 189 | NCAM2, N-CAM 2, neural cell adhesion molecule 2; p | 99.12 | |
| 3udw_C | 118 | Poliovirus receptor; PVR tigit IGSF signal transdu | 99.12 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 99.12 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 99.11 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 99.11 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 99.11 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 99.11 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 99.11 | |
| 3r08_E | 82 | T-cell surface glycoprotein CD3 epsilon chain; ant | 99.11 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.1 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.1 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 99.1 | |
| 3sbw_C | 222 | Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- | 99.1 | |
| 1hng_A | 176 | CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra | 99.08 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 99.08 | |
| 1jhl_L | 108 | IGG1-kappa D11.15 FV (light chain); complex(antibo | 99.08 | |
| 1vca_A | 202 | VCAM-D1,2, human vascular cell adhesion molecule-1 | 99.08 | |
| 1f2q_A | 176 | High affinity immunoglobulin epsilon receptor ALP | 99.08 | |
| 4dep_C | 349 | Interleukin-1 receptor accessory protein; B-trefoi | 99.08 | |
| 3jz7_A | 214 | MCAR, CAR, coxsackievirus and adenovirus receptor | 99.07 | |
| 1uct_A | 218 | Immunoglobulin alpha FC receptor; beta stands, imm | 99.07 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 99.07 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 99.06 | |
| 3rjd_A | 262 | High affinity immunoglobulin gamma FC receptor I; | 99.06 | |
| 3oq3_B | 329 | IFN-alpha/beta binding protein C12R; mousepox viru | 99.06 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 99.06 | |
| 1oll_A | 188 | NK receptor; immune system/receptor, NK cell trigg | 99.06 | |
| 3mj8_L | 213 | Stimulatory hamster antibody HL4E10 FAB light CHA; | 99.05 | |
| 1z7z_I | 450 | Intercellular adhesion molecule-1; ICAM-1,kilifi,C | 99.05 | |
| 2y23_A | 312 | Myomesin; structural protein, sarcomere, M-BAND, i | 99.05 | |
| 1ugn_A | 198 | LIR1, leukocyte immunoglobulin-like receptor 1; im | 99.05 | |
| 2pet_A | 231 | Lutheran blood group glycoprotein; immunoglobulin | 99.05 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 99.04 | |
| 2gi7_A | 184 | GPVI protein; IG-like domains, blood clotting, cel | 99.03 | |
| 3d9a_L | 213 | Light chain of hyhel10 antibody fragment (FAB); ly | 99.03 | |
| 1nbq_A | 209 | JAM, junctional adhesion molecule 1, PAM-1; reovir | 99.03 | |
| 3nl4_L | 213 | Antigen binding fragment, immunoglobulin IGG - LI; | 99.03 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 99.02 | |
| 3mj8_L | 213 | Stimulatory hamster antibody HL4E10 FAB light CHA; | 99.02 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 99.01 | |
| 2oyp_A | 109 | Hepatitis A virus cellular receptor 2; TIM-3, T-ce | 99.01 | |
| 3ry4_A | 170 | Low affinity immunoglobulin gamma FC region recep; | 99.01 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 99.0 | |
| 3s96_B | 218 | 3B5H10 FAB light chain; huntingtin, immune system; | 98.99 | |
| 1ccz_A | 171 | Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 | 98.99 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 98.99 | |
| 2wng_A | 327 | Tyrosine-protein phosphatase non-receptor type sub | 98.99 | |
| 3b5h_A | 184 | Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce | 98.98 | |
| 1nkr_A | 201 | P58-CL42 KIR; inhibitory receptor, natural killer | 98.98 | |
| 1qfw_M | 108 | FV, antibody (anti beta subunit) (light chain); gl | 98.97 | |
| 2qsq_A | 111 | Carcinoembryonic antigen-related cell adhesion MO; | 98.97 | |
| 1wio_A | 363 | CD4, T-cell surface glycoprotein CD4; immunoglobul | 98.97 | |
| 2yz1_A | 120 | Tyrosine-protein phosphatase non-receptor type sub | 98.97 | |
| 2oz4_A | 265 | Intercellular adhesion molecule 1; IGSF domain, st | 98.96 | |
| 1itb_B | 315 | Type 1 interleukin-1 receptor; immunoglobulin fold | 98.96 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 98.96 | |
| 3o4o_C | 339 | Interleukin-1 receptor type 2; cytokine-receptor c | 98.95 | |
| 1nkr_A | 201 | P58-CL42 KIR; inhibitory receptor, natural killer | 98.95 | |
| 4dzb_B | 246 | Vbeta2 (MAIT T cell receptor); immune system; 1.70 | 98.95 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 98.95 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 98.95 | |
| 2fbo_J | 250 | V1V2;, variable region-containing chitin-binding p | 98.95 | |
| 2rcj_C | 523 | Light chain; immunoglobulin M, polymeric antibodie | 98.94 | |
| 3khq_A | 133 | B-cell antigen receptor complex-associated protei | 98.94 | |
| 4gjt_B | 123 | Poliovirus receptor-related protein 4; six-bladed | 98.94 | |
| 3q0h_A | 117 | T cell immunoreceptor with IG and ITIM domains; im | 98.93 | |
| 1xt5_A | 135 | Variable region-containing chitin-binding protein | 98.93 | |
| 2aw2_A | 120 | B and T lymphocyte attenuator; IGI domain, IGG dom | 98.93 | |
| 1lk3_L | 210 | 9D7 light chain; antigen-antibody complex, immune | 98.93 | |
| 2ywz_A | 111 | NEW antigen receptor variable domain; IG VNAR, imm | 98.93 | |
| 1q0x_L | 212 | FAB 9B1, light chain; anti-morphine antibody, FAB | 98.92 | |
| 2q20_A | 109 | VK1 O18/O8 germline light chain variable domain; A | 98.91 | |
| 2if7_A | 193 | SLAM family member 6; NTB-A, homophilic receptor, | 98.91 | |
| 1mqk_L | 120 | Antibody 7E2 FV fragment, light chain; membrane pr | 98.91 | |
| 2ny1_B | 184 | T-cell surface glycoprotein CD4; HIV, GP120, CD4, | 98.91 | |
| 2p1y_A | 238 | Bispecific alpha/beta TCR; autoimmunity, immunoglo | 98.91 | |
| 3r06_A | 213 | Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; | 98.91 | |
| 1c1e_H | 219 | Catalytic antibody 1E9 (heavy chain); diels-alder, | 98.91 | |
| 1dr9_A | 201 | B7-1 (CD80), T lymphocyte activation antigen; IG s | 98.9 | |
| 3pv7_A | 248 | B7-H6, IG-like domain-containing protein DKFZP686O | 98.9 | |
| 2e27_L | 119 | Anti-ciguatoxin antibody, light chain; immunoglobu | 98.9 | |
| 3s96_B | 218 | 3B5H10 FAB light chain; huntingtin, immune system; | 98.9 | |
| 3d9a_L | 213 | Light chain of hyhel10 antibody fragment (FAB); ly | 98.9 | |
| 3ejj_X | 289 | Macrophage colony-stimulating factor 1 receptor; g | 98.9 | |
| 3esu_F | 250 | Antibody 14B7* light chain and antibody 14B7* heav | 98.9 | |
| 2d9c_A | 136 | Signal-regulatory protein beta-1; beta-sandwich, S | 98.9 | |
| 1sy6_A | 204 | T-cell surface glycoprotein CD3 gamma/epsilon chai | 98.9 | |
| 1f3r_B | 257 | FV antibody fragment; IG-fold, immuno complex, ant | 98.9 | |
| 1i8k_A | 107 | Epidermal growth factor receptor antibody MR1SCFV | 98.9 | |
| 2jju_A | 127 | Signal regulatory protein beta-1; immunoglobulin d | 98.9 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 98.89 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 98.89 | |
| 3s97_C | 201 | Contactin-1; carbonic anhdyrase like immunoglobuli | 98.89 | |
| 1p6f_A | 242 | NKP46, natural cytotoxicity triggering receptor 1; | 98.89 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 98.89 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 98.89 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.89 | |
| 1h5b_A | 113 | Murine T cell receptor (TCR) valpha domain; immune | 98.89 | |
| 2rcj_C | 523 | Light chain; immunoglobulin M, polymeric antibodie | 98.89 | |
| 3r0n_A | 128 | Poliovirus receptor-related protein 2; IG-domain, | 98.89 | |
| 1lk3_L | 210 | 9D7 light chain; antigen-antibody complex, immune | 98.88 | |
| 2xzc_L | 216 | FAB A.17 light chain; immune system; HET: XOP; 1.3 | 98.88 | |
| 1za6_B | 344 | IGG heavy chain; immunoglobulin fold, CH2-domain-d | 98.88 | |
| 2rgs_A | 218 | I, IG gamma-2B heavy chain; FC-fragment, immunoglo | 98.87 | |
| 1c1e_H | 219 | Catalytic antibody 1E9 (heavy chain); diels-alder, | 98.87 | |
| 1hnf_A | 182 | CD2; T lymphocyte adhesion glycoprotein; HET: NAG; | 98.87 | |
| 3tv3_L | 211 | PGT128 light chain, IG lambda-2 chain C regions; F | 98.87 | |
| 3r4d_A | 208 | CEA-related cell adhesion molecule 1, isoform 1/2; | 98.87 | |
| 3tv3_L | 211 | PGT128 light chain, IG lambda-2 chain C regions; F | 98.87 | |
| 1q0x_L | 212 | FAB 9B1, light chain; anti-morphine antibody, FAB | 98.87 | |
| 1q9r_B | 222 | S25-2 FAB (IGG1K) heavy chain; antigen-binding fra | 98.86 | |
| 4fmk_A | 225 | Poliovirus receptor-related protein 2; immunoglobu | 98.86 | |
| 2x1w_L | 213 | Vascular endothelial growth factor receptor 2; hor | 98.86 | |
| 1moe_A | 240 | Anti-CEA MAB T84.66; anti carcinoembryonic antigen | 98.86 | |
| 3mjg_X | 289 | Beta-type platelet-derived growth factor receptor; | 98.85 | |
| 2pet_A | 231 | Lutheran blood group glycoprotein; immunoglobulin | 98.85 | |
| 2coq_A | 108 | NEW antigen receptor variable domain; IG VNAR, nat | 98.85 | |
| 2ghw_B | 247 | Anti-SARS SCFV antibody, 80R; S protein, neutraliz | 98.84 | |
| 1zox_A | 113 | CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid I | 98.84 | |
| 2or8_A | 116 | Hepatitis A virus cellular receptor 1 homolog; bet | 98.84 | |
| 2ghw_B | 247 | Anti-SARS SCFV antibody, 80R; S protein, neutraliz | 98.84 | |
| 2vol_A | 207 | Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, | 98.84 | |
| 2dru_A | 180 | Chimera of CD48 antigen and T-cell surface antige; | 98.84 | |
| 1igt_B | 444 | IGG2A intact antibody - MAB231; intact immunoglobu | 98.84 | |
| 3sob_L | 237 | Antibody light chain; beta propeller, protein bind | 98.83 | |
| 1ccz_A | 171 | Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 | 98.83 | |
| 1f3r_B | 257 | FV antibody fragment; IG-fold, immuno complex, ant | 98.83 | |
| 3gkz_A | 257 | Anti-methamphetamine single chain FV; therapeutic | 98.83 | |
| 3omz_A | 259 | Human vdelta1 gamma delta T cell receptor delta1A; | 98.82 | |
| 3moq_A | 126 | NEW antigen receptor variable domain, P3(40) PEPT | 98.82 | |
| 1nfd_E | 212 | H57 FAB; complex (immunoreceptor-immunoglobulin), | 98.82 | |
| 3vh8_G | 316 | Killer cell immunoglobulin-like receptor 3DL1; imm | 98.82 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 98.82 | |
| 4fmk_A | 225 | Poliovirus receptor-related protein 2; immunoglobu | 98.82 | |
| 3d9a_H | 210 | Heavy chain of hyhel10 antibody fragment (FAB); ly | 98.82 | |
| 1ncn_A | 110 | T lymphocyte activation antigen CD86; IG V, beta s | 98.82 | |
| 2q87_A | 110 | CMRF35-H antigen; all-beta, immunoglobulin, IG-sup | 98.82 | |
| 4ei6_B | 245 | Vbeta16 XV19 type II natural killer T cell recept | 98.82 | |
| 1nqb_A | 256 | Single-chain antibody fragment; multivalent antibo | 98.81 | |
| 1dee_B | 223 | IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin | 98.81 | |
| 3d9a_H | 210 | Heavy chain of hyhel10 antibody fragment (FAB); ly | 98.81 | |
| 3nl4_L | 213 | Antigen binding fragment, immunoglobulin IGG - LI; | 98.81 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 98.81 | |
| 1op3_H | 225 | FAB 2G12, heavy chain; domain-swapped FAB 2G12, an | 98.81 | |
| 1q9r_B | 222 | S25-2 FAB (IGG1K) heavy chain; antigen-binding fra | 98.81 | |
| 3nfj_J | 245 | T cell receptor beta chain; immunoglobulin family, | 98.8 | |
| 3auv_A | 276 | SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid | 98.8 | |
| 3tf7_C | 256 | 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; | 98.8 | |
| 1b6u_A | 257 | KIR2DL3, P58 killer cell inhibitory receptor; natu | 98.8 | |
| 3mj6_A | 268 | Junctional adhesion molecule-like; immunoglobulin | 98.8 | |
| 1dn0_B | 232 | IGM-kappa cold agglutinin (heavy chain); FAB, anti | 98.8 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 98.8 | |
| 1b6u_A | 257 | KIR2DL3, P58 killer cell inhibitory receptor; natu | 98.8 | |
| 1i1c_A | 239 | IGG2A, IG gamma-2A chain C region; FC, immune syst | 98.8 | |
| 1svz_A | 247 | Immunoglobulin;, single-chain FV fragment 1696; an | 98.79 | |
| 2j6e_L | 234 | IGM, FAB light chain; autoimmune complex human IGM | 98.79 | |
| 1pz5_B | 220 | Heavy chain of FAB (SYA/J6); antibody-antigen stru | 98.79 | |
| 1i3g_L | 111 | Antibody FV fragment; antibiotic; 2.44A {Mus muscu | 98.79 | |
| 1pz5_B | 220 | Heavy chain of FAB (SYA/J6); antibody-antigen stru | 98.79 | |
| 3uzq_A | 253 | Anti-dengue MAB 4E11; dengue antibody neutralizati | 98.79 | |
| 3sob_L | 237 | Antibody light chain; beta propeller, protein bind | 98.79 | |
| 2c1o_A | 254 | IGK-C protein; FAB fragment, enantioselective, fin | 98.78 | |
| 4frw_A | 218 | Poliovirus receptor-related protein 4; immunoglobu | 98.78 | |
| 4ety_A | 118 | LAIR-1, mlair1, leukocyte-associated immunoglobuli | 98.78 | |
| 4esk_A | 102 | LAIR-1, mlair1, leukocyte-associated immunoglobuli | 98.76 | |
| 2znx_A | 242 | SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s | 98.76 | |
| 2wqr_A | 323 | IG epsilon chain C region; immune system, immunogl | 98.76 | |
| 4fom_A | 308 | Poliovirus receptor-related protein 3; immunoglobu | 98.76 | |
| 4dkd_C | 292 | Macrophage colony-stimulating factor 1 receptor; d | 98.76 | |
| 2p1y_A | 238 | Bispecific alpha/beta TCR; autoimmunity, immunoglo | 98.75 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 98.75 | |
| 2wbj_D | 279 | OB TCR; transmembrane, immune response, T cell rec | 98.75 | |
| 1sq2_N | 113 | Novel antigen receptor; immunoglobulin fold, prote | 98.75 | |
| 1j05_L | 111 | T84.66 antibody, anti-CEA MAB T84.66, light chain; | 98.75 | |
| 1neu_A | 124 | Myelin P0 protein; structural protein, glycoprotei | 98.75 | |
| 3esu_F | 250 | Antibody 14B7* light chain and antibody 14B7* heav | 98.74 | |
| 3bkj_L | 252 | WO2 IGG2A FAB fragment light chain kappa; abeta, F | 98.74 | |
| 3umt_A | 256 | SCFV heavy chain and light chain; stability engine | 98.74 | |
| 2c1o_A | 254 | IGK-C protein; FAB fragment, enantioselective, fin | 98.74 | |
| 3umt_A | 256 | SCFV heavy chain and light chain; stability engine | 98.73 | |
| 4ffy_L | 126 | DENV1-E111 single chain variable fragment (light; | 98.73 | |
| 3r06_A | 213 | Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; | 98.73 | |
| 2ptt_A | 110 | CD48 antigen; CD244, CD48, NK cell receptor, X-RAY | 98.72 | |
| 4fqp_A | 313 | Poliovirus receptor; immunoglobulin-like domain, I | 98.71 | |
| 3q5y_A | 240 | TCR N15 beta; IG, T cell receptor, antigen peptide | 98.71 | |
| 2vol_A | 207 | Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, | 98.71 | |
| 2fbj_H | 220 | IGA-kappa J539 FAB (heavy chain); immunoglobulin; | 98.7 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 98.7 | |
| 3juy_B | 256 | 3B3 single chain variant HIV-1 antibody; envelope | 98.7 | |
| 3pl6_D | 268 | MBP peptide / T-cell receptor beta chain chimera; | 98.69 | |
| 3o3u_N | 581 | Maltose-binding periplasmic protein, advanced Gly | 98.69 | |
| 1qgc_4 | 438 | Protein (immunoglobulin); virus-antibody complex, | 98.69 | |
| 3kgr_A | 106 | LAIR-1, hlair1, leukocyte-associated immunoglobuli | 98.69 | |
| 1mju_H | 227 | Immunoglobulin MS6-12; catalytic antibody, ester h | 98.69 | |
| 1eeq_A | 114 | Kappa-4 immunoglobulin (light chain); protein stab | 98.69 | |
| 3rrq_A | 129 | Protein PD-1, programmed cell death protein 1; pro | 98.68 | |
| 1nfd_E | 212 | H57 FAB; complex (immunoreceptor-immunoglobulin), | 98.68 | |
| 1qok_A | 282 | MFE-23 recombinant antibody fragment; immunoglobul | 98.68 | |
| 3bae_H | 228 | WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO | 98.68 | |
| 3juy_B | 256 | 3B3 single chain variant HIV-1 antibody; envelope | 98.67 | |
| 1qok_A | 282 | MFE-23 recombinant antibody fragment; immunoglobul | 98.67 | |
| 2yc1_B | 146 | Single chain antibody fragment 9004G; immune syste | 98.67 | |
| 2xzc_L | 216 | FAB A.17 light chain; immune system; HET: XOP; 1.3 | 98.67 | |
| 1nqb_A | 256 | Single-chain antibody fragment; multivalent antibo | 98.67 | |
| 1l6x_A | 207 | Immunoglobulin gamma-1 heavy chain constant regio; | 98.67 | |
| 3bae_H | 228 | WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO | 98.66 | |
| 1dee_B | 223 | IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin | 98.66 | |
| 2fbj_H | 220 | IGA-kappa J539 FAB (heavy chain); immunoglobulin; | 98.66 | |
| 2wqr_A | 323 | IG epsilon chain C region; immune system, immunogl | 98.66 | |
| 2gjj_A | 264 | A21 single-chain antibody fragment against ERBB2; | 98.65 | |
| 3auv_A | 276 | SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid | 98.65 | |
| 3ux9_B | 256 | SCFV antibody; five helices, long loop connecting | 98.65 | |
| 1qgc_4 | 438 | Protein (immunoglobulin); virus-antibody complex, | 98.65 | |
| 1dlf_L | 113 | Anti-dansyl immunoglobulin IGG2A(S); FV fragment; | 98.64 | |
| 1mju_H | 227 | Immunoglobulin MS6-12; catalytic antibody, ester h | 98.64 | |
| 3bkj_L | 252 | WO2 IGG2A FAB fragment light chain kappa; abeta, F | 98.64 | |
| 3ux9_B | 256 | SCFV antibody; five helices, long loop connecting | 98.64 | |
| 3eow_R | 221 | Poliovirus receptor; immunoglobulin super family, | 98.64 | |
| 2rgs_A | 218 | I, IG gamma-2B heavy chain; FC-fragment, immunoglo | 98.64 | |
| 3m8o_H | 221 | Immunoglobulin A1 heavy chain; immunoglobulin fold | 98.64 | |
| 1pew_A | 109 | JTO2, A lambda-6 type immunoglobulin light chain, | 98.63 | |
| 3u6r_L | 143 | Antibody 1:7 (light chain); IG-like domain, neutra | 98.62 | |
| 1iam_A | 185 | ICAM-1, CD54, intercellular adhesion molecule-1; r | 98.62 | |
| 2zg1_A | 214 | Sialic acid-binding IG-like lectin 5; siglec-5 inh | 98.62 | |
| 1nko_A | 132 | Sialic acid binding IG-like lectin 7; immunoglobul | 98.62 | |
| 3bqu_C | 233 | 3H6 FAB light chain; beta sheet, immune system; 3. | 98.62 | |
| 2or7_A | 115 | T-cell immunoglobulin and mucin domain- containing | 98.62 | |
| 3nl4_H | 215 | Antigen binding fragment,immunoglobulin IGG - HEA; | 98.6 | |
| 3uzq_A | 253 | Anti-dengue MAB 4E11; dengue antibody neutralizati | 98.6 | |
| 1c5d_H | 215 | Monoclonal antibody against the main immunogenic t | 98.6 | |
| 1fo0_B | 112 | Protein (BM3.3 T cell receptor beta-chain); class | 98.6 | |
| 3bqu_C | 233 | 3H6 FAB light chain; beta sheet, immune system; 3. | 98.6 | |
| 2w59_A | 231 | IGY FCU3-4; immunoglobulin, avian, immune system; | 98.59 | |
| 1op3_H | 225 | FAB 2G12, heavy chain; domain-swapped FAB 2G12, an | 98.59 | |
| 1u3h_A | 110 | T-cell receptor alpha-chain; complex, immune syste | 98.01 | |
| 2xqy_G | 261 | A13-D6.3 monoclonal antibody, envelope glycoprotei | 98.59 | |
| 2j6e_L | 234 | IGM, FAB light chain; autoimmune complex human IGM | 98.59 | |
| 2znx_A | 242 | SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s | 98.58 | |
| 3m8o_H | 221 | Immunoglobulin A1 heavy chain; immunoglobulin fold | 98.58 | |
| 3gkz_A | 257 | Anti-methamphetamine single chain FV; therapeutic | 98.58 | |
| 1x9q_A | 268 | SCFV, 4M5.3 anti-fluorescein single chain antibody | 98.58 | |
| 3qib_D | 270 | 2B4 beta chain; IG domain, immune system; HET: NAG | 98.57 | |
| 3bn9_D | 257 | E2 FAB heavy chain; antibody-protease complex, pro | 98.57 | |
| 1l6x_A | 207 | Immunoglobulin gamma-1 heavy chain constant regio; | 98.57 | |
| 3kg5_A | 134 | B-cell antigen receptor complex-associated protei | 98.57 | |
| 3tf7_C | 256 | 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; | 98.56 | |
| 2i24_N | 121 | NEW antigen receptor PBLA8; immunoglobulin fold, i | 98.56 | |
| 2dru_A | 180 | Chimera of CD48 antigen and T-cell surface antige; | 98.55 | |
| 1moe_A | 240 | Anti-CEA MAB T84.66; anti carcinoembryonic antigen | 98.55 | |
| 1tvd_A | 116 | T cell receptor, ES204 V delta; immunoreceptor, TC | 98.54 | |
| 2gki_A | 291 | Nuclease; anti-DNA antibody, catalytic antibody, i | 98.54 | |
| 3liz_H | 253 | 4C3 monoclonal antibody heavy chain; hydrolase-imm | 98.54 | |
| 1svz_A | 247 | Immunoglobulin;, single-chain FV fragment 1696; an | 98.54 | |
| 4i0k_A | 222 | CD276 antigen; immunoglobulin domain, glycoprotein | 98.53 | |
| 1dn0_B | 232 | IGM-kappa cold agglutinin (heavy chain); FAB, anti | 98.53 | |
| 2aty_A | 376 | Complement receptor chimeric conjugate CR2-IG; imm | 98.53 | |
| 1fo0_A | 116 | Protein (BM3.3 T cell receptor alpha-chain); class | 98.52 | |
| 3to4_D | 253 | NKT vbeta2 (mouse variable domain, human constant; | 98.52 | |
| 1iga_A | 475 | IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg | 98.52 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 98.52 | |
| 1hzh_H | 457 | IGG, immunoglobulin heavy chain; antibody, immune | 98.51 | |
| 4dzb_B | 246 | Vbeta2 (MAIT T cell receptor); immune system; 1.70 | 98.51 | |
| 2qhl_A | 111 | Novel immune-type receptor 10; immunoglobulin vari | 98.51 | |
| 1hxm_B | 242 | Gamma-delta T-cell receptor; IG domain, TCR, GDTCR | 98.49 | |
| 3o3u_N | 581 | Maltose-binding periplasmic protein, advanced Gly | 98.49 | |
| 1igy_B | 434 | IGG1 intact antibody MAB61.1.3; intact immunoglobu | 98.49 | |
| 2gjj_A | 264 | A21 single-chain antibody fragment against ERBB2; | 98.49 | |
| 3bp6_A | 117 | Programmed cell death protein 1; PD-1, PD-L2, comp | 98.48 | |
| 1iga_A | 475 | IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg | 98.48 | |
| 3liz_H | 253 | 4C3 monoclonal antibody heavy chain; hydrolase-imm | 98.48 | |
| 1j05_H | 121 | T84.66 antibody, anti-CEA MAB T84.66, heavy chain; | 98.47 | |
| 3fku_X | 280 | Neutralizing antibody F10; influenza, hemagglutini | 98.47 | |
| 1mq8_A | 291 | ICAM-1, intercellular adhesion molecule-1, CD54 an | 98.47 | |
| 1a2y_B | 116 | IGG1-kappa D1.3 FV (heavy chain); complex (immunog | 98.47 | |
| 2nms_A | 124 | CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP4 | 98.47 | |
| 1olz_A | 663 | Semaphorin 4D; developmental protein, CD100, beta- | 98.46 | |
| 1igt_B | 444 | IGG2A intact antibody - MAB231; intact immunoglobu | 98.46 | |
| 1x9q_A | 268 | SCFV, 4M5.3 anti-fluorescein single chain antibody | 98.46 | |
| 1k5n_B | 100 | Beta-2-microglobulin, light chain; MHC(major histo | 98.45 | |
| 2z35_A | 112 | T-cell receptor alpha-chain; immune receptor, immu | 98.45 | |
| 1bec_A | 238 | 14.3.D T cell antigen receptor; T cell receptor; 1 | 98.44 | |
| 1oaq_L | 120 | Light chain; antibody, allergy, IGE, conformationa | 98.44 | |
| 2edo_A | 121 | CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte | 98.44 | |
| 2jjs_C | 127 | Leukocyte surface antigen CD47; signal regulatory | 98.43 | |
| 3q5y_A | 240 | TCR N15 beta; IG, T cell receptor, antigen peptide | 98.43 | |
| 1kxv_C | 121 | Camelid VHH domain CAB10; beta 8 alpha 8, beta bar | 98.43 | |
| 1gsm_A | 210 | Madcam-1, mucosal addressin cell adhesion molecule | 98.43 | |
| 2wzp_D | 123 | Camelid VHH5; baseplate, viral protein; 2.60A {Lam | 98.43 | |
| 2xt1_B | 121 | Camelid VHH 9; viral protein-immune system complex | 98.43 | |
| 2gki_A | 291 | Nuclease; anti-DNA antibody, catalytic antibody, i | 98.43 | |
| 1hxm_B | 242 | Gamma-delta T-cell receptor; IG domain, TCR, GDTCR | 98.42 | |
| 2otu_A | 115 | FV light chain variable domain; antibody FV polygl | 98.42 | |
| 3noi_A | 120 | Natural cytotoxicity triggering receptor 3; immune | 98.42 | |
| 1p4b_L | 135 | Antibody variable light chain; FV antibody, antige | 98.42 | |
| 1hkf_A | 122 | NKP44, NK cell activating receptor; natural cytoto | 98.41 | |
| 1mfa_H | 120 | IGG1-lambda Se155-4 FAB (heavy chain); immunoglobu | 98.4 | |
| 1zvo_C | 512 | Myeloma immunoglobulin D delta; immunoglobulin fol | 98.4 | |
| 1hzh_H | 457 | IGG, immunoglobulin heavy chain; antibody, immune | 98.4 | |
| 2h32_A | 126 | Immunoglobulin IOTA chain; beta sheets, V and C-ty | 98.4 |
| >3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* | Back alignment and structure |
|---|
Probab=99.76 E-value=4.7e-17 Score=85.86 Aligned_cols=83 Identities=19% Similarity=0.314 Sum_probs=67.3
Q ss_pred eeecCCeEEEEeEEcccCCCeEEEEECCEEeccccceeeEEeEecCcceEEEEEEcCCCCCCCEEEEEEeecCCceeeEE
Q psy9145 22 LSVLGHKIVFICMAKGKPRPHITWFKDGVELYAHMYVNLHEWHYGTDRIKSKIEIDPATQMDAGIYECYADNMYNVDTRT 101 (111)
Q Consensus 22 ~~~~g~~~~l~C~~~~~p~p~i~w~~~g~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~~g~y~C~~~n~~g~~~~~ 101 (111)
.+.+|+.+.|.|.+.|.|.|.+.|++++..+......+.... .......|.|..++..|.|.|.|.+.|..|....+
T Consensus 16 ~v~~G~~~~l~C~~~g~P~p~v~W~k~g~~i~~~~~~~~~~~---~~~~~~~L~I~~~~~~D~G~Y~C~a~N~~G~~~~~ 92 (100)
T 3knb_A 16 SIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIE---NTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSAT 92 (100)
T ss_dssp EEETTSEEEEEEEEEEESCCEEEEEETTEECCTTGGGTEEEE---ECSSEEEEEESSCCGGGCEEEEEEEEETTEEEEEE
T ss_pred EEeCCCeEEEEEEEEEecCCEEEEEECceEeeeeccceeeee---cccceEEEEEcCCCccCCEEEEEEEEECCCEEEEE
Confidence 567999999999999999999999999998865443222211 11123579999999999999999999999999988
Q ss_pred EEEEEE
Q psy9145 102 FKTDFS 107 (111)
Q Consensus 102 ~~l~v~ 107 (111)
+.|.|.
T Consensus 93 ~~l~V~ 98 (100)
T 3knb_A 93 VNIHIR 98 (100)
T ss_dssp EEEEEE
T ss_pred EEEEEE
Confidence 888875
|
| >3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O | Back alignment and structure |
|---|
| >1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X | Back alignment and structure |
|---|
| >1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X | Back alignment and structure |
|---|
| >1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A | Back alignment and structure |
|---|
| >2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} | Back alignment and structure |
|---|
| >1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A | Back alignment and structure |
|---|
| >2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} | Back alignment and structure |
|---|
| >3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A | Back alignment and structure |
|---|
| >2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A | Back alignment and structure |
|---|
| >2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A | Back alignment and structure |
|---|
| >1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 | Back alignment and structure |
|---|
| >2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A | Back alignment and structure |
|---|
| >2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A | Back alignment and structure |
|---|
| >2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A | Back alignment and structure |
|---|
| >3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A | Back alignment and structure |
|---|
| >2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A | Back alignment and structure |
|---|
| >1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* | Back alignment and structure |
|---|
| >2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... | Back alignment and structure |
|---|
| >2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A | Back alignment and structure |
|---|
| >3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A | Back alignment and structure |
|---|
| >2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X | Back alignment and structure |
|---|
| >2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A | Back alignment and structure |
|---|
| >3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* | Back alignment and structure |
|---|
| >3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A | Back alignment and structure |
|---|
| >1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A | Back alignment and structure |
|---|
| >4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* | Back alignment and structure |
|---|
| >1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A | Back alignment and structure |
|---|
| >4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} | Back alignment and structure |
|---|
| >2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4hwn_A FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG superfamily, immune system, ST genomics, PSI-biology; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 | Back alignment and structure |
|---|
| >4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* | Back alignment and structure |
|---|
| >3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A | Back alignment and structure |
|---|
| >1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A | Back alignment and structure |
|---|
| >3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B | Back alignment and structure |
|---|
| >3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* | Back alignment and structure |
|---|
| >2vsd_A CHIR AB1; immune system receptor, FC receptor; HET: NAG NDG MAN; 1.82A {Gallus gallus} | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* | Back alignment and structure |
|---|
| >1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1xau_A B- and T-lymphocyte attenuator; IG domain, beta sandwich, structural genomics, PSI, protein structure initiative; 1.80A {Mus musculus} SCOP: b.1.1.4 | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R | Back alignment and structure |
|---|
| >3r08_E T-cell surface glycoprotein CD3 epsilon chain; antibody, T-cell receptor, signalling, immune SY; 4.10A {Cricetulus migratorius} | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* | Back alignment and structure |
|---|
| >3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A | Back alignment and structure |
|---|
| >1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1jhl_L IGG1-kappa D11.15 FV (light chain); complex(antibody-antigen); 2.40A {Mus musculus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A | Back alignment and structure |
|---|
| >1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* | Back alignment and structure |
|---|
| >4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* | Back alignment and structure |
|---|
| >3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X | Back alignment and structure |
|---|
| >1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* | Back alignment and structure |
|---|
| >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... | Back alignment and structure |
|---|
| >1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2oyp_A Hepatitis A virus cellular receptor 2; TIM-3, T-cell immunoglobulin mucin, signaling protein; 1.95A {Mus musculus} PDB: 3kaa_A* | Back alignment and structure |
|---|
| >3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* | Back alignment and structure |
|---|
| >2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} | Back alignment and structure |
|---|
| >3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A | Back alignment and structure |
|---|
| >1qfw_M FV, antibody (anti beta subunit) (light chain); glycoprotein hormone; HET: NAG; 3.50A {Mus musculus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >2qsq_A Carcinoembryonic antigen-related cell adhesion MO; glycoprotein, GPI-anchor, immunoglobulin DOMA lipoprotein, membrane; 1.95A {Homo sapiens} PDB: 2qst_A 2ver_N* 2gk2_A | Back alignment and structure |
|---|
| >1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E | Back alignment and structure |
|---|
| >2yz1_A Tyrosine-protein phosphatase non-receptor type substrate 1; beta-sandwich, structural genomics, NPPSFA; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* | Back alignment and structure |
|---|
| >1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A | Back alignment and structure |
|---|
| >4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* | Back alignment and structure |
|---|
| >2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* | Back alignment and structure |
|---|
| >4gjt_B Poliovirus receptor-related protein 4; six-bladed -propeller, IGV-like fold, viral entry, MV-H, NEC BETA4/BETA5 groove; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A | Back alignment and structure |
|---|
| >1xt5_A Variable region-containing chitin-binding protein 3; innate immunity, VCBP, primordial antigen receptor, florida lancelet, amphioxus; 1.15A {Branchiostoma floridae} | Back alignment and structure |
|---|
| >2aw2_A B and T lymphocyte attenuator; IGI domain, IGG domain, TNFRSF, protein-protein complex, IMM system; HET: NAG FUL; 2.80A {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* | Back alignment and structure |
|---|
| >2ywz_A NEW antigen receptor variable domain; IG VNAR, immune system; 2.21A {Orectolobus maculatus} PDB: 2ywy_A | Back alignment and structure |
|---|
| >1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... | Back alignment and structure |
|---|
| >2q20_A VK1 O18/O8 germline light chain variable domain; Al, light chain amyloidosis, amyloid, immunoglobulin, protein fibril; 1.30A {Homo sapiens} PDB: 2kqm_A 3cdf_A 3cdc_A 2kqn_A 3cdy_A 2q1e_A 3dvi_A 1igm_L 1bww_A 1b0w_A 1bre_A 1qp1_A 3dvf_A 1rei_A 1wtl_A 1ar2_A 1fgv_L 2bx5_A 2uzi_L* 1bvk_A ... | Back alignment and structure |
|---|
| >2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1mqk_L Antibody 7E2 FV fragment, light chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_D 3ehb_D* 3hb3_D* 1qle_L* 1f6l_L 3iy2_A 1vfa_A 1dvf_A 1kir_A 1g7i_A 1g7j_A 1a2y_A 1kip_A 1kiq_A 1vfb_A 1g7h_A 1a7o_L 1g7l_A 1g7m_A 1a7n_L ... | Back alignment and structure |
|---|
| >2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... | Back alignment and structure |
|---|
| >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A | Back alignment and structure |
|---|
| >3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* | Back alignment and structure |
|---|
| >1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H | Back alignment and structure |
|---|
| >1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* | Back alignment and structure |
|---|
| >3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* | Back alignment and structure |
|---|
| >2e27_L Anti-ciguatoxin antibody, light chain; immunoglobulin fold, immune system; HET: AB0; 1.70A {Mus musculus} PDB: 3iy1_A | Back alignment and structure |
|---|
| >3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A | Back alignment and structure |
|---|
| >3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... | Back alignment and structure |
|---|
| >3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* | Back alignment and structure |
|---|
| >3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* | Back alignment and structure |
|---|
| >2d9c_A Signal-regulatory protein beta-1; beta-sandwich, SIRP-beta-1, CD172B antigen, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* | Back alignment and structure |
|---|
| >1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >1i8k_A Epidermal growth factor receptor antibody MR1SCFV light chain; antibody-peptide complex, immunoglobulin fold, type II' beta turn., immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 PDB: 1i8i_A | Back alignment and structure |
|---|
| >2jju_A Signal regulatory protein beta-1; immunoglobulin domain, immunoglobulin superfamily, immune system, transmembrane, paired receptor; 1.19A {Homo sapiens} PDB: 2jjv_A 2uv3_A* 2jjt_A* 2jjs_A* 2jjw_A | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1h5b_A Murine T cell receptor (TCR) valpha domain; immune response, immunoglobulin fold; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1h5b_C 1h5b_B | Back alignment and structure |
|---|
| >2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r0n_A Poliovirus receptor-related protein 2; IG-domain, cell-adhesion molecule, virus entry receptor, STR genomics, PSI-biology; 1.30A {Homo sapiens} PDB: 4dfh_A 4dfi_A | Back alignment and structure |
|---|
| >1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* | Back alignment and structure |
|---|
| >2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... | Back alignment and structure |
|---|
| >1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} | Back alignment and structure |
|---|
| >1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H | Back alignment and structure |
|---|
| >1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A | Back alignment and structure |
|---|
| >3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... | Back alignment and structure |
|---|
| >3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* | Back alignment and structure |
|---|
| >3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... | Back alignment and structure |
|---|
| >1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... | Back alignment and structure |
|---|
| >1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... | Back alignment and structure |
|---|
| >4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* | Back alignment and structure |
|---|
| >2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* | Back alignment and structure |
|---|
| >1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A | Back alignment and structure |
|---|
| >2coq_A NEW antigen receptor variable domain; IG VNAR, natural TYPE2, immune system; 2.10A {Orectolobus maculatus} | Back alignment and structure |
|---|
| >2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >1zox_A CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, structural genomics, PSI, protein structure initiative; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >2or8_A Hepatitis A virus cellular receptor 1 homolog; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* | Back alignment and structure |
|---|
| >1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B | Back alignment and structure |
|---|
| >1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A | Back alignment and structure |
|---|
| >3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} | Back alignment and structure |
|---|
| >3moq_A NEW antigen receptor variable domain, P3(40) PEPT amyloid beta A4 protein; AB-ignar, AB-12Y-2, glycoprotein, membran protease inhibitor; 2.05A {Orectolobus maculatus} PDB: 2z8w_C 2z8v_C 1ves_A 1ver_A | Back alignment and structure |
|---|
| >1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D | Back alignment and structure |
|---|
| >4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* | Back alignment and structure |
|---|
| >3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... | Back alignment and structure |
|---|
| >1ncn_A T lymphocyte activation antigen CD86; IG V, beta strands, immune system; 2.70A {Homo sapiens} SCOP: b.1.1.1 PDB: 1i85_A | Back alignment and structure |
|---|
| >2q87_A CMRF35-H antigen; all-beta, immunoglobulin, IG-superfamily, IG-V, NKP44-like, natural killer cell IG-like receptor, inhibitory receptor; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D | Back alignment and structure |
|---|
| >1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H | Back alignment and structure |
|---|
| >1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H | Back alignment and structure |
|---|
| >3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* | Back alignment and structure |
|---|
| >1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... | Back alignment and structure |
|---|
| >3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L | Back alignment and structure |
|---|
| >3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* | Back alignment and structure |
|---|
| >1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* | Back alignment and structure |
|---|
| >1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A | Back alignment and structure |
|---|
| >2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* | Back alignment and structure |
|---|
| >1i3g_L Antibody FV fragment; antibiotic; 2.44A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy6_A | Back alignment and structure |
|---|
| >1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* | Back alignment and structure |
|---|
| >3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A | Back alignment and structure |
|---|
| >3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* | Back alignment and structure |
|---|
| >2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4ety_A LAIR-1, mlair1, leukocyte-associated immunoglobulin-like receptor; IG-like domain, extra celluar domain, domain swappin nysgrc, structural genomics; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >4esk_A LAIR-1, mlair1, leukocyte-associated immunoglobulin-like receptor; IG-like domain, domain swapping, collagen receptor, structural genomics; 1.76A {Mus musculus} | Back alignment and structure |
|---|
| >2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* | Back alignment and structure |
|---|
| >2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A | Back alignment and structure |
|---|
| >4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} | Back alignment and structure |
|---|
| >4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1sq2_N Novel antigen receptor; immunoglobulin fold, protein-protein complex, hydrolase/immune system complex; 1.45A {Ginglymostoma cirratum} SCOP: b.1.1.1 PDB: 1t6v_N | Back alignment and structure |
|---|
| >1j05_L T84.66 antibody, anti-CEA MAB T84.66, light chain; immunoglobulin, immune system; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1qfw_L* 1qnz_L 3iy3_A 3iy4_A | Back alignment and structure |
|---|
| >1neu_A Myelin P0 protein; structural protein, glycoprotein, transmembrane, phosphorylation, immunoglobulin fold, signal; 1.90A {Rattus norvegicus} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* | Back alignment and structure |
|---|
| >3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L | Back alignment and structure |
|---|
| >3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D | Back alignment and structure |
|---|
| >2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D | Back alignment and structure |
|---|
| >4ffy_L DENV1-E111 single chain variable fragment (light; viral envelope proteins, structural genomics, antibody epito flavivirus, niaid; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* | Back alignment and structure |
|---|
| >2ptt_A CD48 antigen; CD244, CD48, NK cell receptor, X-RAY, immune system; 1.63A {Mus musculus} PDB: 2ptv_A | Back alignment and structure |
|---|
| >4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R | Back alignment and structure |
|---|
| >3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A | Back alignment and structure |
|---|
| >2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A | Back alignment and structure |
|---|
| >2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A | Back alignment and structure |
|---|
| >1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 | Back alignment and structure |
|---|
| >3kgr_A LAIR-1, hlair1, leukocyte-associated immunoglobulin-like receptor; IG-like domain, cell membrane, glycoprotein; 1.80A {Homo sapiens} PDB: 3rp1_A | Back alignment and structure |
|---|
| >1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... | Back alignment and structure |
|---|
| >1eeq_A Kappa-4 immunoglobulin (light chain); protein stability, hydrogen bonds, immune system; 1.50A {Homo sapiens} SCOP: b.1.1.1 PDB: 1eeu_A 1lve_A 2lve_A 3lve_A 5lve_A 4lve_A 1efq_A 1qac_A 1ek3_A 2imm_A 1mvu_A 2ap2_A 1ap2_A 3bd3_A* 3bd4_A* 3bd5_A* 2imn_A 3dus_A* 3duu_A* 3dv4_A* ... | Back alignment and structure |
|---|
| >3rrq_A Protein PD-1, programmed cell death protein 1; programmed death-1, costimulatory, immune system; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... | Back alignment and structure |
|---|
| >3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >2yc1_B Single chain antibody fragment 9004G; immune system-toxin complex, scorpion toxin; 1.90A {Homo sapiens} PDB: 2ybr_B 3lh2_L 3h3p_L 3lhp_L | Back alignment and structure |
|---|
| >2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... | Back alignment and structure |
|---|
| >1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H | Back alignment and structure |
|---|
| >1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... | Back alignment and structure |
|---|
| >3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... | Back alignment and structure |
|---|
| >1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H | Back alignment and structure |
|---|
| >2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* | Back alignment and structure |
|---|
| >2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A | Back alignment and structure |
|---|
| >2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C | Back alignment and structure |
|---|
| >3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L | Back alignment and structure |
|---|
| >3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 | Back alignment and structure |
|---|
| >1dlf_L Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 1.45A {Mus musculus} SCOP: b.1.1.1 PDB: 1wz1_L* 2dlf_L 1maj_A 1mak_A 1ktr_L 2cju_L* 2uud_K* 1dsf_L 3nn8_B 1n4x_L 1bfv_L* 1cfv_L* 2bfv_L* 1wt5_C | Back alignment and structure |
|---|
| >1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... | Back alignment and structure |
|---|
| >3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L | Back alignment and structure |
|---|
| >3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} | Back alignment and structure |
|---|
| >3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B | Back alignment and structure |
|---|
| >1pew_A JTO2, A lambda-6 type immunoglobulin light chain, domain; beta sheet, immune system; 1.60A {Homo sapiens} SCOP: b.1.1.1 PDB: 1cd0_A 1pw3_A 2cd0_A 2w0k_A 3b5g_A 3bdx_A* 2w0l_A | Back alignment and structure |
|---|
| >3u6r_L Antibody 1:7 (light chain); IG-like domain, neutralizing single chain FV, immune system; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A | Back alignment and structure |
|---|
| >2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A | Back alignment and structure |
|---|
| >1nko_A Sialic acid binding IG-like lectin 7; immunoglobulin, siglec7, immune system; 1.45A {Homo sapiens} SCOP: b.1.1.1 PDB: 2g5r_A* 1o7v_A* 2df3_A* 1o7s_A* 2hrl_A* | Back alignment and structure |
|---|
| >3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2or7_A T-cell immunoglobulin and mucin domain- containing protein 2; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A | Back alignment and structure |
|---|
| >1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* | Back alignment and structure |
|---|
| >1fo0_B Protein (BM3.3 T cell receptor beta-chain); class I MHC, H-2KB, TCR-PMHC complex, immune system; 2.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1nam_B* 2ol3_B* 1kb5_B 1kj2_B* | Back alignment and structure |
|---|
| >3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} | Back alignment and structure |
|---|
| >1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* | Back alignment and structure |
|---|
| >1u3h_A T-cell receptor alpha-chain; complex, immune system; 2.42A {Mus musculus} SCOP: b.1.1.1 PDB: 1b88_A 1kj2_A* 1kb5_A 1d9k_A* | Back alignment and structure |
|---|
| >2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* | Back alignment and structure |
|---|
| >3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B | Back alignment and structure |
|---|
| >3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A | Back alignment and structure |
|---|
| >1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E | Back alignment and structure |
|---|
| >1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... | Back alignment and structure |
|---|
| >3kg5_A B-cell antigen receptor complex-associated protei chain; CD79B, IG-beta, BCR, immunoglobulin domain, protein binding; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >2i24_N NEW antigen receptor PBLA8; immunoglobulin fold, immune system; 1.35A {Ginglymostoma cirratum} PDB: 2i25_N 2i27_N 2i26_N | Back alignment and structure |
|---|
| >2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 | Back alignment and structure |
|---|
| >1tvd_A T cell receptor, ES204 V delta; immunoreceptor, TCR, delta chain, variable domain; 1.90A {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} | Back alignment and structure |
|---|
| >3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H | Back alignment and structure |
|---|
| >1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A | Back alignment and structure |
|---|
| >4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} | Back alignment and structure |
|---|
| >1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H | Back alignment and structure |
|---|
| >2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fo0_A Protein (BM3.3 T cell receptor alpha-chain); class I MHC, H-2KB, TCR-PMHC complex, immune system; 2.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1nam_A* | Back alignment and structure |
|---|
| >3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* | Back alignment and structure |
|---|
| >4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E | Back alignment and structure |
|---|
| >2qhl_A Novel immune-type receptor 10; immunoglobulin variable domain-like beta-sandwich, immune system; 1.56A {Ictalurus punctatus} PDB: 3b5t_A 2qjd_A 2qte_A 2qqq_A | Back alignment and structure |
|---|
| >1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A | Back alignment and structure |
|---|
| >1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C | Back alignment and structure |
|---|
| >3bp6_A Programmed cell death protein 1; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3rnk_A 3sbw_A 3bp5_A 1npu_A 3rnq_A | Back alignment and structure |
|---|
| >1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A | Back alignment and structure |
|---|
| >3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H | Back alignment and structure |
|---|
| >1j05_H T84.66 antibody, anti-CEA MAB T84.66, heavy chain; immunoglobulin, immune system; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1dvf_D 1mvu_B 1ap2_B 2ap2_B | Back alignment and structure |
|---|
| >3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 | Back alignment and structure |
|---|
| >1a2y_B IGG1-kappa D1.3 FV (heavy chain); complex (immunoglobulin/hydrolase), immunoglobulin V region, signal, hydrolase, glycosidase, bacteriolytic enzyme, egg white; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1a7r_H 1dvf_B 1g7h_B 1g7i_B 1g7j_B 1g7l_B 1g7m_B 1kir_B 1vfa_B 1vfb_B 1kiq_B 1a7o_H 1a7n_H 1a7p_H 1kip_B 1a7q_H 1dl7_H* 1bvk_B 1bvl_A 1p4i_H ... | Back alignment and structure |
|---|
| >2nms_A CMRF35-like-molecule 1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, inhibitory receptor, myelo-monocytic cells; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1olz_A Semaphorin 4D; developmental protein, CD100, beta-propeller, PSI domain, IG-like domain, extracellular receptor, neurogenesis; 2.0A {Homo sapiens} SCOP: b.1.1.4 b.69.12.1 g.16.2.1 PDB: 3ol2_A* | Back alignment and structure |
|---|
| >1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 | Back alignment and structure |
|---|
| >1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1k5n_B Beta-2-microglobulin, light chain; MHC(major histocompatibility complex), HLA(human leukocyte A immune system; 1.09A {Homo sapiens} SCOP: b.1.1.2 PDB: 1a9b_B 1b0g_B 1b0r_B 1bd2_B 1cg9_B 1a9e_B 1duy_B 1eey_B 1eez_B 1efx_B 1gzp_B* 1gzq_B* 1hhg_B 1hhh_B 1hhi_B 1hhj_B 1hhk_B 1i1f_B 1i1y_B 1duz_B* ... | Back alignment and structure |
|---|
| >2z35_A T-cell receptor alpha-chain; immune receptor, immune system; 2.20A {Mus musculus} PDB: 2pxy_A 2z31_A 1ac6_A | Back alignment and structure |
|---|
| >1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... | Back alignment and structure |
|---|
| >1oaq_L Light chain; antibody, allergy, IGE, conformational diversity, multispecificity; 1.50A {Rattus rattus} SCOP: b.1.1.1 PDB: 1ocw_L 2bjm_L* 1oau_L* 1oar_L* 1oaz_L 1mfa_L* 1a6v_L* 1oax_L* 1oay_L* 1a6w_L* 1a6u_L 1dl7_L* | Back alignment and structure |
|---|
| >2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jjs_C Leukocyte surface antigen CD47; signal regulatory protein alpha, immunoglobulin superfamily, transmembrane, phosphoprotein, paired receptor; HET: NAG; 1.85A {Homo sapiens} PDB: 2jjt_C* 2vsc_A* | Back alignment and structure |
|---|
| >3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A | Back alignment and structure |
|---|
| >1kxv_C Camelid VHH domain CAB10; beta 8 alpha 8, beta barrel, hydrolase, immune system; 1.60A {Camelus dromedarius} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* | Back alignment and structure |
|---|
| >2wzp_D Camelid VHH5; baseplate, viral protein; 2.60A {Lama glama} PDB: 2bse_D | Back alignment and structure |
|---|
| >2xt1_B Camelid VHH 9; viral protein-immune system complex; 1.32A {Vicugna pacos} PDB: 2xv6_B 2xxc_B 2xxm_B | Back alignment and structure |
|---|
| >2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} | Back alignment and structure |
|---|
| >1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 | Back alignment and structure |
|---|
| >2otu_A FV light chain variable domain; antibody FV polyglutamine complex, immune system; 1.68A {Mus musculus} PDB: 2otw_A 2gsg_A | Back alignment and structure |
|---|
| >3noi_A Natural cytotoxicity triggering receptor 3; immune system, innate immunity, immunoglobulin-like I2 type natural killer cell activation; HET: 1PG; 1.84A {Homo sapiens} PDB: 3pv6_B* | Back alignment and structure |
|---|
| >1p4b_L Antibody variable light chain; FV antibody, antigen peptide binder, SCFV, picomolar binder, immune system; 2.35A {Mus musculus} SCOP: b.1.1.1 PDB: 1p4i_L | Back alignment and structure |
|---|
| >1hkf_A NKP44, NK cell activating receptor; natural cytotoxicity receptor, immunoglobulin domain; 2.2A {Homo sapiens} SCOP: b.1.1.1 | Back alignment and structure |
|---|
| >1mfa_H IGG1-lambda Se155-4 FAB (heavy chain); immunoglobulin; HET: GLA MMA; 1.70A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy2_B | Back alignment and structure |
|---|
| >1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* | Back alignment and structure |
|---|
| >2h32_A Immunoglobulin IOTA chain; beta sheets, V and C-type IG folds, immune system; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 111 | ||||
| d3dara1 | 97 | b.1.1.4 (A:153-249) Fibroblast growth factor recep | 4e-12 | |
| d2fdbp2 | 109 | b.1.1.4 (P:2252-2360) Fibroblast growth factor rec | 1e-10 | |
| d2cqva1 | 101 | b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T | 7e-10 | |
| d1he7a_ | 107 | b.1.1.4 (A:) High affinity nerve growth factor rec | 1e-09 | |
| d1qz1a3 | 100 | b.1.1.4 (A:190-289) Neural cell adhesion molecule | 1e-09 | |
| d1wwbx_ | 103 | b.1.1.4 (X:) Ligand binding domain of trkB recepto | 2e-09 | |
| d1rhfa1 | 91 | b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor | 9e-09 | |
| d1f97a2 | 110 | b.1.1.4 (A:129-238) Junction adhesion molecule, JA | 1e-08 | |
| d1biha4 | 89 | b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr | 2e-08 | |
| d1nbqa2 | 104 | b.1.1.4 (A:130-233) Junction adhesion molecule, JA | 6e-08 | |
| d1tnna_ | 91 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 2e-07 | |
| d1cs6a3 | 91 | b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gall | 2e-07 | |
| d1g1ca_ | 98 | b.1.1.4 (A:) Titin {Human (Homo sapiens), differen | 6e-07 | |
| d1wwca_ | 105 | b.1.1.4 (A:) NT3 binding domain of trkC receptor { | 1e-06 | |
| d1koaa1 | 97 | b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha | 2e-06 | |
| d1epfa2 | 92 | b.1.1.4 (A:98-189) Neural cell adhesion molecule ( | 2e-06 | |
| d1gxea_ | 130 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 3e-06 | |
| d1zxqa1 | 106 | b.1.1.3 (A:87-192) Intercellular cell adhesion mol | 5e-06 | |
| d1cs6a1 | 97 | b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus | 6e-06 | |
| d1biha3 | 97 | b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecr | 7e-06 | |
| d2aw2a1 | 104 | b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator | 9e-06 | |
| d1fhga_ | 102 | b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) | 1e-05 | |
| d1x44a1 | 90 | b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty | 1e-05 | |
| d1cs6a4 | 89 | b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall | 2e-05 | |
| d2c9aa1 | 96 | b.1.1.4 (A:184-279) Receptor-type tyrosine-protein | 2e-05 | |
| d1iray3 | 107 | b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor | 4e-05 | |
| d1pd6a_ | 94 | b.1.1.4 (A:) Cardiac myosin binding protein C, dif | 1e-04 | |
| d1ccza1 | 93 | b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-ter | 1e-04 | |
| d1n26a1 | 93 | b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chai | 3e-04 | |
| d2avga1 | 110 | b.1.1.4 (A:1-110) Cardiac myosin binding protein C | 3e-04 | |
| d1gl4b_ | 89 | b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus muscu | 4e-04 | |
| d1l6xa2 | 102 | b.1.1.2 (A:342-443) Immunoglobulin heavy chain gam | 4e-04 | |
| d1fp5a2 | 105 | b.1.1.2 (A:439-543) Immunoglobulin heavy chain eps | 5e-04 | |
| d3b5ha1 | 101 | b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo | 6e-04 | |
| d1wiua_ | 93 | b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis el | 8e-04 | |
| d1k5nb_ | 100 | b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapi | 0.001 | |
| d2oz4a3 | 84 | b.1.1.4 (A:367-450) Intercellular adhesion molecul | 0.001 | |
| d2crya1 | 115 | b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRR | 0.002 | |
| d1iama1 | 103 | b.1.1.3 (A:83-185) Intercellular cell adhesion mol | 0.002 | |
| d1o0va1 | 104 | b.1.1.2 (A:228-330) Immunoglobulin heavy chain eps | 0.002 | |
| d1i1ca2 | 102 | b.1.1.2 (A:342-443) Immunoglobulin heavy chain gam | 0.003 | |
| d2dava1 | 113 | b.1.1.4 (A:8-120) Myosin-binding protein C, slow-t | 0.003 | |
| d1f97a1 | 102 | b.1.1.1 (A:27-128) Junction adhesion molecule, JAM | 0.004 | |
| d1mjul2 | 107 | b.1.1.2 (L:108-214) Immunoglobulin light chain kap | 0.004 | |
| d1iray1 | 101 | b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {H | 0.004 | |
| d1igtb4 | 102 | b.1.1.2 (B:363-474) Immunoglobulin heavy chain gam | 0.004 |
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Immunoglobulin family: I set domains domain: Fibroblast growth factor receptor, FGFR species: Human (Homo sapiens), FGFR2a [TaxId: 9606]
Score = 55.6 bits (133), Expect = 4e-12
Identities = 17/78 (21%), Positives = 29/78 (37%), Gaps = 4/78 (5%)
Query: 26 GHKIVFICMAKGKPRPHITWFKDGVELYAHMYVNLHEWHYGTDRIKSKIEIDPATQMDAG 85
+ + F C A G P P + W K+G E + ++ + ++ D G
Sbjct: 20 ANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQH----WSLIMESVVPSDKG 75
Query: 86 IYECYADNMYNVDTRTFK 103
Y C +N Y T+
Sbjct: 76 NYTCVVENEYGSINHTYH 93
|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 97 | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 97 | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 93 | Back information, alignment and structure |
|---|
| >d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 111 | |||
| d1cs6a4 | 89 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.75 | |
| d3dara1 | 97 | Fibroblast growth factor receptor, FGFR {Human (Ho | 99.74 | |
| d1fhga_ | 102 | Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 | 99.74 | |
| d1biha4 | 89 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.73 | |
| d1qz1a3 | 100 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.72 | |
| d1wwbx_ | 103 | Ligand binding domain of trkB receptor {Human (Hom | 99.72 | |
| d1g1ca_ | 98 | Titin {Human (Homo sapiens), different modules [Ta | 99.71 | |
| d1koaa1 | 97 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 99.71 | |
| d2cqva1 | 101 | Telokin {Human (Homo sapiens) [TaxId: 9606]} | 99.71 | |
| d1wiua_ | 93 | Twitchin {Nematode (Caenorhabditis elegans) [TaxId | 99.69 | |
| d1biha3 | 97 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.69 | |
| d1rhfa1 | 91 | Tyrosine-protein kinase receptor tyro3, N-terminal | 99.69 | |
| d2nxyb2 | 84 | CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 | 99.69 | |
| d1tnna_ | 91 | Titin {Human (Homo sapiens), different modules [Ta | 99.68 | |
| d1cs6a3 | 91 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.68 | |
| d1vcaa2 | 90 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 99.68 | |
| d2aw2a1 | 104 | B- and T-lymphocyte attenuator CD272 {Human (Homo | 99.64 | |
| d2fdbp2 | 109 | Fibroblast growth factor receptor, FGFR {Human (Ho | 99.64 | |
| d1wwca_ | 105 | NT3 binding domain of trkC receptor {Human (Homo s | 99.64 | |
| d2avga1 | 110 | Cardiac myosin binding protein C, different domain | 99.63 | |
| d1gl4b_ | 89 | Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: | 99.63 | |
| d1nbqa1 | 105 | Junction adhesion molecule, JAM, N-terminal domain | 99.62 | |
| d1gsma1 | 90 | Mucosal addressin cell adhesion molecule-1 (MADCAM | 99.62 | |
| d1epfa2 | 92 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.61 | |
| d2ifga1 | 92 | High affinity nerve growth factor receptor TrkA, d | 99.61 | |
| d1f97a2 | 110 | Junction adhesion molecule, JAM, C-terminal domain | 99.61 | |
| d3b5ha1 | 101 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 99.61 | |
| d1he7a_ | 107 | High affinity nerve growth factor receptor TrkA, d | 99.6 | |
| d1epfa1 | 97 | Neural cell adhesion molecule (NCAM) {Rat (Rattus | 99.6 | |
| d2oz4a3 | 84 | Intercellular adhesion molecule-1, ICAM-1 {Human ( | 99.6 | |
| d1rhfa2 | 85 | Tyrosine-protein kinase receptor tyro3, second dom | 99.59 | |
| d1f97a1 | 102 | Junction adhesion molecule, JAM, N-terminal domain | 99.59 | |
| d1iray3 | 107 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.59 | |
| d2dava1 | 113 | Myosin-binding protein C, slow-type {Human (Homo s | 99.58 | |
| d1gxea_ | 130 | Cardiac myosin binding protein C, different domain | 99.58 | |
| d2fcba2 | 88 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.55 | |
| d1fnla2 | 89 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.54 | |
| d1l6za2 | 96 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t | 99.53 | |
| d1nbqa2 | 104 | Junction adhesion molecule, JAM, C-terminal domain | 99.51 | |
| d1olza1 | 92 | Semaphorin 4d Ig-like domain {Human (Homo sapiens) | 99.5 | |
| d1n26a1 | 93 | Interleukin-6 receptor alpha chain, N-terminal dom | 99.49 | |
| d1cs6a1 | 97 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.49 | |
| d1f2qa2 | 89 | IgE high affinity receptor alpha subunit {Human (H | 99.48 | |
| d1iray2 | 103 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.48 | |
| d1biha1 | 94 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.47 | |
| d2c9aa1 | 96 | Receptor-type tyrosine-protein phosphatase mu {Hum | 99.47 | |
| d1iray1 | 101 | Type-1 interleukin-1 receptor {Human (Homo sapiens | 99.47 | |
| d1cs6a2 | 105 | Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | 99.46 | |
| d2crya1 | 115 | Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s | 99.44 | |
| d1x44a1 | 90 | Myosin-binding protein C, slow-type {Human (Homo s | 99.44 | |
| d1fnla1 | 84 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.41 | |
| d1iama1 | 103 | Intercellular cell adhesion molecule-1 (ICAM-1) {H | 99.4 | |
| d2fcba1 | 85 | Fc gamma receptor ectodomain (CD32) {Human (Homo s | 99.38 | |
| d1pd6a_ | 94 | Cardiac myosin binding protein C, different domain | 99.38 | |
| d1f2qa1 | 82 | IgE high affinity receptor alpha subunit {Human (H | 99.35 | |
| d1zxqa1 | 106 | Intercellular cell adhesion molecule-2 (ICAM-2) {H | 99.35 | |
| d1tiua_ | 89 | Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI | 99.33 | |
| d1biha2 | 111 | Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | 99.29 | |
| d1pkoa_ | 126 | Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra | 99.24 | |
| d1ccza1 | 93 | CD2-binding domain of CD58, N-terminal domain {Hum | 99.16 | |
| d1hnga1 | 98 | CD2, first domain {Rat (Rattus norvegicus) [TaxId: | 98.96 | |
| d1eaja_ | 124 | Coxsackie virus and adenovirus receptor (Car), dom | 98.91 | |
| d2nxyb1 | 97 | CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 | 98.82 | |
| d1ucta1 | 99 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 98.71 | |
| d1olla1 | 95 | Ligand binding domain of NK receptor NKp46 {Human | 98.71 | |
| d1l6za1 | 107 | Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t | 98.63 | |
| d1a0ql1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.57 | |
| d1vcaa1 | 109 | Vascular cell adhesion molecule-1 (VCAM-1) {Human | 98.53 | |
| d2cdea1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.52 | |
| d1neua_ | 119 | Myelin membrane adhesion molecule P0 {Rat (Rattus | 98.5 | |
| d1i8ka_ | 106 | Immunoglobulin light chain kappa variable domain, | 98.5 | |
| d1ospl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.48 | |
| d1j1pl_ | 107 | Immunoglobulin light chain kappa variable domain, | 98.47 | |
| d2bnqd1 | 113 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.46 | |
| d1c5cl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.44 | |
| d1bwwa_ | 109 | Immunoglobulin light chain kappa variable domain, | 98.43 | |
| d1dr9a2 | 95 | CD80, second domain {Human (Homo sapiens) [TaxId: | 98.43 | |
| d1jhll_ | 108 | Immunoglobulin light chain kappa variable domain, | 98.43 | |
| d1kcvl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.42 | |
| d1ucta2 | 96 | Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa | 98.42 | |
| d1nezg_ | 122 | CD8 {Mouse (Mus musculus) [TaxId: 10090]} | 98.41 | |
| d1mexl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.4 | |
| d1lp9e1 | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.39 | |
| d1vesa_ | 113 | Novel antigen receptor 12Y-2 {Spotted wobbegong (O | 98.37 | |
| d1tjgl1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.36 | |
| d1d5il1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.35 | |
| d1mqkl_ | 109 | Immunoglobulin light chain kappa variable domain, | 98.34 | |
| d2ij0c1 | 118 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.34 | |
| d3cx5k1 | 107 | Immunoglobulin light chain kappa variable domain, | 98.33 | |
| d1u3ha1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.33 | |
| d1xeda_ | 116 | Polymeric-immunoglobulin receptor, PIGR {Human (Ho | 98.32 | |
| d1k5nb_ | 100 | beta2-microglobulin {Human (Homo sapiens) [TaxId: | 98.32 | |
| d1bd2d1 | 111 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.31 | |
| d1j8hd1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.31 | |
| d2atpb1 | 115 | CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 | 98.3 | |
| d1i9ea_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.29 | |
| d1tvda_ | 116 | T-cell antigen receptor {Human (Homo sapiens), del | 98.27 | |
| d1f3rb2 | 119 | Immunoglobulin light chain kappa variable domain, | 98.26 | |
| d2gj6d1 | 94 | T-cell antigen receptor {Mouse (Mus musculus), bet | 98.25 | |
| d1hkfa_ | 108 | NK cell activating receptor NKP44 {Human (Homo sap | 98.25 | |
| d1akjd_ | 114 | CD8 {Human (Homo sapiens) [TaxId: 9606]} | 98.24 | |
| d1lk3l1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.24 | |
| d1olla2 | 93 | Ligand binding domain of NK receptor NKp46 {Human | 98.24 | |
| d3bp5a1 | 114 | Programmed cell death protein 1, PD1, extracellula | 98.23 | |
| d1sq2n_ | 112 | Novel antigen receptor (against lysozyme) {Nurse s | 98.23 | |
| d1nkra1 | 96 | Killer cell inhibitory receptor {Human (Homo sapie | 98.22 | |
| d1q9ra1 | 113 | Immunoglobulin light chain kappa variable domain, | 98.21 | |
| d2esvd1 | 110 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.21 | |
| d1kgcd1 | 112 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.2 | |
| d8faba1 | 103 | Immunoglobulin light chain lambda variable domain, | 98.19 | |
| d1op3k1 | 106 | Immunoglobulin light chain kappa variable domain, | 98.18 | |
| d1ugna2 | 98 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 98.18 | |
| d2ak4d1 | 114 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.18 | |
| d1h5ba_ | 113 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.17 | |
| d1j05a_ | 111 | Immunoglobulin light chain kappa variable domain, | 98.16 | |
| d1t7va1 | 94 | Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu | 98.15 | |
| d1dr9a1 | 105 | CD80, N-terminal domain {Human (Homo sapiens) [Tax | 98.15 | |
| d1fo0a_ | 115 | T-cell antigen receptor {Mouse (Mus musculus), alp | 98.15 | |
| d1lk2b_ | 99 | beta2-microglobulin {Mouse (Mus musculus) [TaxId: | 98.14 | |
| d1n4xl_ | 113 | Immunoglobulin light chain kappa variable domain, | 98.13 | |
| d1smoa_ | 113 | TREM-1 (triggering receptor expressed on myeloid c | 98.13 | |
| d1ogad1 | 115 | T-cell antigen receptor {Human (Homo sapiens), alp | 98.11 | |
| d1kgce1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.11 | |
| d1nkra2 | 99 | Killer cell inhibitory receptor {Human (Homo sapie | 98.07 | |
| d1mjul1 | 112 | Immunoglobulin light chain kappa variable domain, | 98.07 | |
| d2fx7l1 | 108 | Immunoglobulin light chain kappa variable domain, | 98.07 | |
| d1yqvl1 | 104 | Immunoglobulin light chain kappa variable domain, | 98.06 | |
| d1iqdb1 | 117 | Immunoglobulin heavy chain variable domain, VH {Hu | 98.05 | |
| d1nlbh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 98.05 | |
| d1ncwl1 | 112 | Immunoglobulin light chain kappa variable domain, | 98.05 | |
| d1hxma1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 98.04 | |
| d2aq2a1 | 110 | T-cell antigen receptor {Mouse (Mus musculus), bet | 98.04 | |
| d2esve1 | 111 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.04 | |
| d2gsia1 | 111 | Immunoglobulin light chain kappa variable domain, | 98.03 | |
| d2g5ra1 | 121 | N-terminal domain of sialic acid binding Ig-like l | 98.03 | |
| d1rihh1 | 125 | Immunoglobulin heavy chain variable domain, VH {Mo | 98.03 | |
| d1ncna_ | 110 | CD86 (b7-2), N-terminal domain {Human (Homo sapien | 98.01 | |
| d1j8he1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 98.01 | |
| d1w72l1 | 109 | Immunoglobulin light chain lambda variable domain, | 98.0 | |
| d1ugna1 | 96 | Ligand binding domain of lir-1 (ilt2) {Human (Homo | 98.0 | |
| d1kxvc_ | 119 | Camelid IG heavy chain variable domain, VHh {Camel | 98.0 | |
| d1ypzf1 | 120 | T-cell antigen receptor {Human (Homo sapiens), gam | 97.99 | |
| d1um5h1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.98 | |
| d1hdmb1 | 98 | Class II MHC beta chain, C-terminal domain {Human | 97.98 | |
| d1de4a1 | 94 | Hemochromatosis protein Hfe, alpha-3 domain {Human | 97.98 | |
| d2jelh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.98 | |
| d1c5db1 | 117 | Immunoglobulin heavy chain variable domain, VH {Ra | 97.97 | |
| d1lgva1 | 112 | Immunoglobulin light chain lambda variable domain, | 97.97 | |
| d1ac6a_ | 110 | T-cell antigen receptor {Mouse (Mus musculus), alp | 97.95 | |
| d1a2yb_ | 116 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.95 | |
| d2fx7h1 | 127 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.95 | |
| d1mfah1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.94 | |
| d1muja1 | 100 | Class II MHC alpha chain, C-terminal domain {Mouse | 97.94 | |
| d1oaql_ | 110 | Immunoglobulin light chain lambda variable domain, | 97.93 | |
| d2rhea_ | 114 | Immunoglobulin light chain lambda variable domain, | 97.93 | |
| d1o0va1 | 104 | Immunoglobulin heavy chain epsilon constant domain | 97.93 | |
| d1dn0b1 | 120 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.92 | |
| d1jnhb1 | 117 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.92 | |
| d1q0xl2 | 102 | Immunoglobulin light chain lambda constant domain, | 97.92 | |
| d1fp5a2 | 105 | Immunoglobulin heavy chain epsilon constant domain | 97.92 | |
| d2ntsp1 | 113 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.92 | |
| d1jpth1 | 117 | Immunoglobulin heavy chain variable domain, VH {En | 97.91 | |
| d1ncwh1 | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.91 | |
| d1ct8b1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.91 | |
| d1rzfl1 | 111 | Immunoglobulin light chain lambda variable domain, | 97.91 | |
| d1n0xh1 | 127 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.91 | |
| d1rz7h1 | 119 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.9 | |
| d1zvya1 | 124 | Camelid IG heavy chain variable domain, VHh {Camel | 97.9 | |
| d2ck0h1 | 109 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.89 | |
| d1indh1 | 114 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.89 | |
| d1f3dh1 | 115 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.88 | |
| d1mjuh1 | 116 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.88 | |
| d1cd0a_ | 111 | Immunoglobulin light chain lambda variable domain, | 97.87 | |
| d2fbjh1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.87 | |
| d1qnzh_ | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.87 | |
| d2p49b1 | 121 | Camelid IG heavy chain variable domain, VHh {Camel | 97.87 | |
| d1u9ka_ | 110 | TREM-1 (triggering receptor expressed on myeloid c | 97.86 | |
| d2bnub1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.85 | |
| d1ol0a_ | 121 | Immunoglobulin heavy chain variable domain, VH {En | 97.85 | |
| d7fabh1 | 116 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.85 | |
| d1ieha_ | 135 | Camelid IG heavy chain variable domain, VHh {Llama | 97.85 | |
| d1ogae1 | 114 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.85 | |
| d3b5ha2 | 80 | Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 | 97.85 | |
| d2agjh1 | 120 | Immunoglobulin heavy chain variable domain, VH {En | 97.84 | |
| d2mhaa1 | 89 | Class I MHC, alpha-3 domain {Mouse (Mus musculus) | 97.83 | |
| d1pg7x1 | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.82 | |
| d1mqkh_ | 123 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.82 | |
| d1eapb1 | 119 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.82 | |
| d1lmka1 | 126 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.82 | |
| d1j05b_ | 121 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.81 | |
| d1hdma1 | 103 | Class II MHC alpha chain, C-terminal domain {Human | 97.81 | |
| d1yedb1 | 124 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.8 | |
| d1nfde1 | 108 | Immunoglobulin light chain lambda variable domain, | 97.79 | |
| d3frua1 | 91 | Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor | 97.79 | |
| d1i3ua_ | 127 | Camelid IG heavy chain variable domain, VHh {Llama | 97.79 | |
| d1ad9b1 | 120 | Immunoglobulin heavy chain variable domain, VH {En | 97.78 | |
| d1k5na1 | 95 | Class I MHC, alpha-3 domain {Human (Homo sapiens) | 97.78 | |
| d1fn4b1 | 116 | Immunoglobulin heavy chain variable domain, VH {Ra | 97.78 | |
| d1etzb1 | 126 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.77 | |
| d1dqta_ | 117 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 97.76 | |
| d1xaua_ | 104 | B and T lymphocyte attenuator, Btla {Mouse (Mus mu | 97.75 | |
| d2h26a1 | 96 | CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T | 97.74 | |
| d1rzfl2 | 102 | Immunoglobulin light chain lambda constant domain, | 97.74 | |
| d1hxmb1 | 123 | T-cell antigen receptor {Human (Homo sapiens), del | 97.73 | |
| d1fnga1 | 101 | Class II MHC alpha chain, C-terminal domain {Mouse | 97.73 | |
| d2nxyd1 | 128 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.73 | |
| d1rzga1 | 130 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.72 | |
| d2b1hh1 | 124 | Immunoglobulin heavy chain variable domain, VH {En | 97.71 | |
| d1r0ah1 | 123 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.71 | |
| d1rzfh1 | 133 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.71 | |
| d1ai1h1 | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.7 | |
| d1i8lc_ | 118 | Immunoreceptor CTLA-4 (CD152), N-terminal fragment | 97.69 | |
| d1i1ca2 | 102 | Immunoglobulin heavy chain gamma constant domain 3 | 97.67 | |
| d1fo0b_ | 112 | T-cell antigen receptor {Mouse (Mus musculus), bet | 97.67 | |
| d1lo4h1 | 118 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.66 | |
| d1l6xa2 | 102 | Immunoglobulin heavy chain gamma constant domain 3 | 97.66 | |
| d1uvqa1 | 99 | Class II MHC alpha chain, C-terminal domain {Human | 97.65 | |
| d1rjca1 | 126 | Camelid IG heavy chain variable domain, VHh {Camel | 97.65 | |
| d1op3h1 | 125 | Immunoglobulin heavy chain variable domain, VH {En | 97.65 | |
| d1cqka_ | 101 | Immunoglobulin heavy chain gamma constant domain 3 | 97.65 | |
| d1nfdb1 | 113 | T-cell antigen receptor {Mouse (Mus musculus), bet | 97.64 | |
| d1qfoa_ | 118 | N-terminal domain of sialoadhesin {Mouse (Mus musc | 97.63 | |
| d2cdeb1 | 112 | T-cell antigen receptor {Human (Homo sapiens), bet | 97.62 | |
| d1igtb4 | 102 | Immunoglobulin heavy chain gamma constant domain 3 | 97.62 | |
| d1dlfh_ | 120 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.61 | |
| d3cx5j1 | 127 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.6 | |
| d1nfdf1 | 121 | Immunoglobulin heavy chain variable domain, VH {Ha | 97.58 | |
| d1dfbh1 | 126 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.57 | |
| d3c2ah1 | 131 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.56 | |
| d2fb4h1 | 127 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.55 | |
| d1q9rb1 | 122 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.54 | |
| d1d5mb1 | 98 | Class II MHC beta chain, C-terminal domain {Human | 97.53 | |
| d1hyrc1 | 94 | Class I MHC homolog, alpha-3 domain {Human (Homo s | 97.51 | |
| d1tjgh1 | 132 | Immunoglobulin heavy chain variable domain, VH {En | 97.5 | |
| d1bz7b1 | 122 | Immunoglobulin heavy chain variable domain, VH {Mo | 97.5 | |
| d1dn0b2 | 105 | Immunoglobulin heavy chain mu constant domain 1, C | 97.49 | |
| d1nfde2 | 104 | Immunoglobulin light chain lambda constant domain, | 97.46 | |
| d1sjva_ | 107 | Camelid IG heavy chain variable domain, VHh {Llama | 97.45 | |
| d1ymmd1 | 96 | T-cell antigen receptor {Human (Homo sapiens), alp | 97.45 | |
| d1rhhb1 | 130 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.44 | |
| d1ow0a2 | 108 | Immunoglobulin heavy chain alpha constant domain 3 | 97.41 | |
| d1oari_ | 103 | Immunoglobulin heavy chain variable domain, VH {Ra | 97.4 | |
| d1vgeh1 | 122 | Immunoglobulin heavy chain variable domain, VH {Hu | 97.38 | |
| d1uvqb1 | 97 | Class II MHC beta chain, C-terminal domain {Human | 97.28 | |
| d1b2wh1 | 117 | Immunoglobulin heavy chain variable domain, VH {En | 97.23 | |
| d1jbja2 | 100 | CD3 epsilon chain ectodomain fragment {Mouse (Mus | 97.22 | |
| d1hxmb2 | 107 | T-cell antigen receptor {Human (Homo sapiens), del | 97.12 | |
| d1yjdc1 | 118 | CD28 {Human (Homo sapiens) [TaxId: 9606]} | 97.06 | |
| d1igtb3 | 119 | Immunoglobulin heavy chain gamma constant domain 2 | 97.05 | |
| d1kcvh2 | 101 | Immunoglobulin heavy chain gamma constant domain 1 | 97.01 | |
| d1mjul2 | 107 | Immunoglobulin light chain kappa constant domain, | 97.0 | |
| d1i1ca1 | 103 | Immunoglobulin heavy chain gamma constant domain 2 | 96.93 | |
| d1c5cl2 | 107 | Immunoglobulin light chain kappa constant domain, | 96.77 | |
| d1fltx_ | 95 | Second domain of the Flt-1 receptor {Human (Homo s | 96.76 | |
| d1l6xa1 | 105 | Immunoglobulin heavy chain gamma constant domain 2 | 96.76 | |
| d1mjuh2 | 102 | Immunoglobulin heavy chain gamma constant domain 1 | 96.68 | |
| d1u58a1 | 98 | Immunomodulatory protein m144, alpha-3 domain {Mur | 96.49 | |
| d1fp5a1 | 103 | Immunoglobulin heavy chain epsilon constant domain | 96.38 | |
| d1ogae2 | 127 | T-cell antigen receptor {Human (Homo sapiens), bet | 96.11 | |
| d3d85d1 | 87 | The p40 domain of interleukin-12 (IL-12 beta chain | 96.05 | |
| d1c5ch2 | 103 | Immunoglobulin heavy chain gamma constant domain 1 | 95.97 | |
| d1xiwa_ | 91 | CD3 epsilon chain ectodomain fragment {Human (Homo | 95.91 | |
| d1pfca_ | 111 | Immunoglobulin heavy chain gamma constant domain 3 | 95.62 | |
| d2fbjh2 | 102 | Immunoglobulin heavy chain alpha constant domain 1 | 95.39 | |
| d1i1ra1 | 100 | Cytokine receptor gp130 cytokine-binding domains { | 95.36 | |
| d1hxma2 | 86 | T-cell antigen receptor {Human (Homo sapiens), gam | 95.16 | |
| d1sy6a1 | 81 | CD3 gamma chain ectodomain fragment {Human (Homo s | 94.92 | |
| d1jbja1 | 86 | CD3 gamma chain ectodomain fragment {Mouse (Mus mu | 94.36 | |
| d1xiwb_ | 74 | CD3 delta chain ectodomain fragment {Human (Homo s | 92.74 | |
| d1ow0a1 | 101 | Immunoglobulin heavy chain alpha constant domain 2 | 92.58 | |
| d2d9qb1 | 94 | Granulocyte colony-stimulating factor (GC-SF) rece | 91.92 | |
| d1igyb3 | 116 | Immunoglobulin heavy chain gamma constant domain 2 | 90.3 | |
| d1hnfa1 | 101 | CD2, first domain {Human (Homo sapiens) [TaxId: 96 | 87.29 | |
| d1xmwa2 | 66 | CD3 epsilon chain ectodomain fragment {Sheep (Ovis | 85.06 | |
| d2oz4a1 | 84 | Intercellular cell adhesion molecule-1 (ICAM-1) {H | 81.35 |
| >d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Immunoglobulin family: I set domains domain: Axonin-1 species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.75 E-value=1.6e-17 Score=84.73 Aligned_cols=77 Identities=23% Similarity=0.534 Sum_probs=65.9
Q ss_pred eeecCCeEEEEeEEcccCCCeEEEEECCEEeccccceeeEEeEecCcceEEEEEEcCCCCCCCEEEEEEeecCCceeeEE
Q psy9145 22 LSVLGHKIVFICMAKGKPRPHITWFKDGVELYAHMYVNLHEWHYGTDRIKSKIEIDPATQMDAGIYECYADNMYNVDTRT 101 (111)
Q Consensus 22 ~~~~g~~~~l~C~~~~~p~p~i~w~~~g~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~~g~y~C~~~n~~g~~~~~ 101 (111)
.+..|+.+.|.|.+.|.|.|.+.|+++|..+....+.... ...|.|..+...|.|.|.|.+.|..|....+
T Consensus 12 ~v~~G~~~~l~C~~~g~P~p~v~W~k~g~~i~~~~~~~~~---------~~~L~i~~v~~~D~G~Y~C~a~N~~G~~~~~ 82 (89)
T d1cs6a4 12 EADIGSDLRWSCVASGKPRPAVRWLRDGQPLASQNRIEVS---------GGELRFSKLVLEDSGMYQCVAENKHGTVYAS 82 (89)
T ss_dssp EEETTCCEEEECEEEEESCCEEEEEETTEECCCCSSEEEE---------TTEEEESSCCGGGCEEEEEEEEETTEEEEEE
T ss_pred EECCCCcEEEEEEEEEEcCCEEEEEEeeccccccceeeee---------eeeEEEEeecccCCEEEEEEEEeCCCEEEEE
Confidence 5679999999999999999999999999988765544332 1379999999999999999999999998888
Q ss_pred EEEEEE
Q psy9145 102 FKTDFS 107 (111)
Q Consensus 102 ~~l~v~ 107 (111)
..|.|.
T Consensus 83 ~~l~V~ 88 (89)
T d1cs6a4 83 AELTVQ 88 (89)
T ss_dssp EEEEEE
T ss_pred EEEEEE
Confidence 887763
|
| >d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} | Back information, alignment and structure |
|---|
| >d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} | Back information, alignment and structure |
|---|
| >d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} | Back information, alignment and structure |
|---|
| >d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} | Back information, alignment and structure |
|---|
| >d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} | Back information, alignment and structure |
|---|
| >d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} | Back information, alignment and structure |
|---|
| >d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fn4b1 b.1.1.1 (B:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} | Back information, alignment and structure |
|---|
| >d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin heavy chain variable domain, VH {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c2ah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} | Back information, alignment and structure |
|---|
| >d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b2wh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} | Back information, alignment and structure |
|---|
| >d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} | Back information, alignment and structure |
|---|
| >d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c5ch2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i1ra1 b.1.2.1 (A:2-101) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sy6a1 b.1.1.4 (A:1-81) CD3 gamma chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbja1 b.1.1.4 (A:101-186) CD3 gamma chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ow0a1 b.1.1.2 (A:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb1 b.1.1.3 (B:3-96) Granulocyte colony-stimulating factor (GC-SF) receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igyb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xmwa2 b.1.1.4 (A:113-178) CD3 epsilon chain ectodomain fragment {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2oz4a1 b.1.1.3 (A:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|