Psyllid ID: psy9166


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MCGSGDNPDNMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQMEDELLLH
cccccccccccEEEEEEcccccccccccccccccccEEccccHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHc
cccccccccccEEEEEcccccHHHccccccccccccEccccEHHHHHHHHHHHccccEEEEEEcccHHHccHHHHcc
mcgsgdnpdnMKALILVGgygtrlrpltlsrpkplvefankpMLLHQIEALVEAGVREVILAVSYRAEQMEDELLLH
mcgsgdnpdnMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQmedelllh
MCGSGDNPDNMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQMEDELLLH
************ALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYR***********
************ALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQMEDELL**
********DNMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQMEDELLLH
********DNMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQMEDELLLH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGSGDNPDNMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQMEDELLLH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query77 2.2.26 [Sep-21-2011]
Q7JZB4 369 Mannose-1-phosphate guany yes N/A 0.961 0.200 0.783 5e-27
Q295Y7 371 Mannose-1-phosphate guany yes N/A 0.961 0.199 0.776 1e-26
A3QMC8 365 Mannose-1-phosphate guany yes N/A 0.870 0.183 0.791 8e-26
Q61S97 364 Mannose-1-phosphate guany N/A N/A 0.870 0.184 0.776 9e-25
Q4I1Y5 364 Mannose-1-phosphate guany yes N/A 0.792 0.167 0.803 2e-22
Q6DBU5 360 Mannose-1-phosphate guany yes N/A 0.831 0.177 0.796 2e-22
Q6FRY2 361 Mannose-1-phosphate guany yes N/A 0.831 0.177 0.765 3e-22
Q68EQ1 360 Mannose-1-phosphate guany yes N/A 0.831 0.177 0.765 9e-22
Q68EY9 360 Mannose-1-phosphate guany N/A N/A 0.831 0.177 0.765 1e-21
A2VD83 360 Mannose-1-phosphate guany N/A N/A 0.831 0.177 0.765 1e-21
>sp|Q7JZB4|GMPPB_DROME Mannose-1-phosphate guanyltransferase beta OS=Drosophila melanogaster GN=CG1129 PE=2 SV=1 Back     alignment and function desciption
 Score =  119 bits (298), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 65/74 (87%)

Query: 1  MCGSGDNPDNMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVI 60
          MCG+    +  +ALILVGGYGTRLRPLTLS PKPLVEFANKP+LLHQ+EALV+AG R+VI
Sbjct: 1  MCGNPAVGNGTRALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVI 60

Query: 61 LAVSYRAEQMEDEL 74
          LAVSYRAEQME EL
Sbjct: 61 LAVSYRAEQMEKEL 74





Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 1EC: 3
>sp|Q295Y7|GMPPB_DROPS Mannose-1-phosphate guanyltransferase beta OS=Drosophila pseudoobscura pseudoobscura GN=GA10892 PE=3 SV=1 Back     alignment and function description
>sp|A3QMC8|GMPPB_CAEEL Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis elegans GN=tag-335 PE=3 SV=1 Back     alignment and function description
>sp|Q61S97|GMPPB_CAEBR Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis briggsae GN=tag-335 PE=3 SV=2 Back     alignment and function description
>sp|Q4I1Y5|MPG1_GIBZE Mannose-1-phosphate guanyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MPG1 PE=3 SV=1 Back     alignment and function description
>sp|Q6DBU5|GMPPB_DANRE Mannose-1-phosphate guanyltransferase beta OS=Danio rerio GN=gmppb PE=2 SV=1 Back     alignment and function description
>sp|Q6FRY2|MPG12_CANGA Mannose-1-phosphate guanyltransferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPG1 PE=3 SV=1 Back     alignment and function description
>sp|Q68EQ1|GMPPB_XENTR Mannose-1-phosphate guanyltransferase beta OS=Xenopus tropicalis GN=gmppb PE=2 SV=1 Back     alignment and function description
>sp|Q68EY9|GMPBA_XENLA Mannose-1-phosphate guanyltransferase beta-A OS=Xenopus laevis GN=gmppb-a PE=2 SV=1 Back     alignment and function description
>sp|A2VD83|GMPBB_XENLA Mannose-1-phosphate guanyltransferase beta-B OS=Xenopus laevis GN=gmppb-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
328700431 371 PREDICTED: mannose-1-phosphate guanyltra 0.961 0.199 0.824 5e-27
321471012 359 hypothetical protein DAPPUDRAFT_101964 [ 0.831 0.178 0.906 5e-26
270009027 364 hypothetical protein TcasGA2_TC015659 [T 0.857 0.181 0.893 5e-26
242018682 348 Mannose-1-phosphate guanyltransferase, p 0.961 0.212 0.786 6e-26
195568287 202 GD19749 [Drosophila simulans] gi|1941980 0.961 0.366 0.797 8e-26
189238443 359 PREDICTED: similar to mannose-1-phosphat 0.831 0.178 0.921 8e-26
195497164 369 GE25436 [Drosophila yakuba] gi|194182088 0.961 0.200 0.783 2e-25
345484840 369 PREDICTED: mannose-1-phosphate guanyltra 0.870 0.181 0.850 2e-25
21355443 369 CG1129, isoform A [Drosophila melanogast 0.961 0.200 0.783 2e-25
195343509 369 GM10777 [Drosophila sechellia] gi|194133 0.961 0.200 0.783 2e-25
>gi|328700431|ref|XP_001946280.2| PREDICTED: mannose-1-phosphate guanyltransferase beta-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 61/74 (82%), Positives = 63/74 (85%)

Query: 1  MCGSGDNPDNMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVI 60
          MCG        KALILVGGYGTRLRPLTLSRPKPLVEFANKPM+LHQIEALV  GVREVI
Sbjct: 1  MCGVDTKMAQTKALILVGGYGTRLRPLTLSRPKPLVEFANKPMILHQIEALVTVGVREVI 60

Query: 61 LAVSYRAEQMEDEL 74
          LAVSYRAEQME E+
Sbjct: 61 LAVSYRAEQMEKEM 74




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321471012|gb|EFX81986.1| hypothetical protein DAPPUDRAFT_101964 [Daphnia pulex] Back     alignment and taxonomy information
>gi|270009027|gb|EFA05475.1| hypothetical protein TcasGA2_TC015659 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242018682|ref|XP_002429803.1| Mannose-1-phosphate guanyltransferase, putative [Pediculus humanus corporis] gi|212514815|gb|EEB17065.1| Mannose-1-phosphate guanyltransferase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195568287|ref|XP_002102149.1| GD19749 [Drosophila simulans] gi|194198076|gb|EDX11652.1| GD19749 [Drosophila simulans] Back     alignment and taxonomy information
>gi|189238443|ref|XP_974073.2| PREDICTED: similar to mannose-1-phosphate guanyltransferase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195497164|ref|XP_002095987.1| GE25436 [Drosophila yakuba] gi|194182088|gb|EDW95699.1| GE25436 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|345484840|ref|XP_001598989.2| PREDICTED: mannose-1-phosphate guanyltransferase beta-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|21355443|ref|NP_649498.1| CG1129, isoform A [Drosophila melanogaster] gi|24644084|ref|NP_730877.1| CG1129, isoform B [Drosophila melanogaster] gi|122129600|sp|Q7JZB4.1|GMPPB_DROME RecName: Full=Mannose-1-phosphate guanyltransferase beta; AltName: Full=GDP-mannose pyrophosphorylase B; AltName: Full=GTP-mannose-1-phosphate guanylyltransferase beta gi|7296813|gb|AAF52089.1| CG1129, isoform B [Drosophila melanogaster] gi|10727176|gb|AAG22216.1| CG1129, isoform A [Drosophila melanogaster] gi|16768684|gb|AAL28561.1| HL02883p [Drosophila melanogaster] gi|17945978|gb|AAL49033.1| RE49494p [Drosophila melanogaster] gi|220943166|gb|ACL84126.1| CG1129-PA [synthetic construct] gi|220960314|gb|ACL92693.1| CG1129-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195343509|ref|XP_002038340.1| GM10777 [Drosophila sechellia] gi|194133361|gb|EDW54877.1| GM10777 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
FB|FBgn0037279 369 CG1129 [Drosophila melanogaste 0.961 0.200 0.783 2.2e-25
UNIPROTKB|Q295Y7 371 GA10892 "Mannose-1-phosphate g 0.961 0.199 0.776 2.9e-25
WB|WBGene00016583 365 tag-335 [Caenorhabditis elegan 0.870 0.183 0.791 3.3e-24
ZFIN|ZDB-GENE-040801-234 360 gmppb "GDP-mannose pyrophospho 0.831 0.177 0.796 5.5e-22
MGI|MGI:2660880 360 Gmppb "GDP-mannose pyrophospho 0.831 0.177 0.75 8e-21
RGD|1560458 360 Gmppb "GDP-mannose pyrophospho 0.831 0.177 0.75 8e-21
UNIPROTKB|F1SPR4 360 GMPPB "Mannose-1-phosphate gua 0.831 0.177 0.75 1e-20
UNIPROTKB|P0C5I2 360 GMPPB "Mannose-1-phosphate gua 0.831 0.177 0.75 1e-20
UNIPROTKB|E2R2I6 360 GMPPB "Uncharacterized protein 0.831 0.177 0.75 1.3e-20
UNIPROTKB|Q9Y5P6 360 GMPPB "Mannose-1-phosphate gua 0.831 0.177 0.75 1.3e-20
FB|FBgn0037279 CG1129 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 288 (106.4 bits), Expect = 2.2e-25, P = 2.2e-25
 Identities = 58/74 (78%), Positives = 65/74 (87%)

Query:     1 MCGSGDNPDNMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVI 60
             MCG+    +  +ALILVGGYGTRLRPLTLS PKPLVEFANKP+LLHQ+EALV+AG R+VI
Sbjct:     1 MCGNPAVGNGTRALILVGGYGTRLRPLTLSTPKPLVEFANKPILLHQLEALVDAGCRQVI 60

Query:    61 LAVSYRAEQMEDEL 74
             LAVSYRAEQME EL
Sbjct:    61 LAVSYRAEQMEKEL 74




GO:0004475 "mannose-1-phosphate guanylyltransferase activity" evidence=ISS
GO:0005575 "cellular_component" evidence=ND
GO:0009058 "biosynthetic process" evidence=IEA
UNIPROTKB|Q295Y7 GA10892 "Mannose-1-phosphate guanyltransferase beta" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
WB|WBGene00016583 tag-335 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-234 gmppb "GDP-mannose pyrophosphorylase B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2660880 Gmppb "GDP-mannose pyrophosphorylase B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1560458 Gmppb "GDP-mannose pyrophosphorylase B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SPR4 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P0C5I2 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2I6 GMPPB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y5P6 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A3QMC8GMPPB_CAEEL2, ., 7, ., 7, ., 1, 30.79100.87010.1835yesN/A
O74484MPG1_SCHPO2, ., 7, ., 7, ., 1, 30.71870.83110.1763yesN/A
Q4I1Y5MPG1_GIBZE2, ., 7, ., 7, ., 1, 30.80320.79220.1675yesN/A
Q2YDJ9GMPPB_BOVIN2, ., 7, ., 7, ., 1, 30.73430.83110.1777yesN/A
Q9Y5P6GMPPB_HUMAN2, ., 7, ., 7, ., 1, 30.750.83110.1777yesN/A
Q68EQ1GMPPB_XENTR2, ., 7, ., 7, ., 1, 30.76560.83110.1777yesN/A
Q295Y7GMPPB_DROPS2, ., 7, ., 7, ., 1, 30.77630.96100.1994yesN/A
Q6BN12MPG1_DEBHA2, ., 7, ., 7, ., 1, 30.71870.83110.1767yesN/A
Q6FRY2MPG12_CANGA2, ., 7, ., 7, ., 1, 30.76560.83110.1772yesN/A
Q8BTZ7GMPPB_MOUSE2, ., 7, ., 7, ., 1, 30.750.83110.1777yesN/A
Q7JZB4GMPPB_DROME2, ., 7, ., 7, ., 1, 30.78370.96100.2005yesN/A
Q9M2S0GMPP2_ARATH2, ., 7, ., 7, ., 1, 30.76660.77920.1648yesN/A
P0C5I2GMPPB_PIG2, ., 7, ., 7, ., 1, 30.750.83110.1777yesN/A
Q6DBU5GMPPB_DANRE2, ., 7, ., 7, ., 1, 30.79680.83110.1777yesN/A
Q70SJ2MPG1_KLULA2, ., 7, ., 7, ., 1, 30.71870.83110.1772yesN/A
Q54K39GMPPB_DICDI2, ., 7, ., 7, ., 1, 30.73430.83110.1782yesN/A
Q6Z9A3GMPP3_ORYSJ2, ., 7, ., 7, ., 1, 30.80.77920.1662yesN/A
Q6CCU3MPG1_YARLI2, ., 7, ., 7, ., 1, 30.70310.83110.1763yesN/A
P0CO20MPG1_CRYNJ2, ., 7, ., 7, ., 1, 30.78330.77920.1648yesN/A
Q2UJU5MPG1_ASPOR2, ., 7, ., 7, ., 1, 30.67180.83110.1758yesN/A
P41940MPG1_YEAST2, ., 7, ., 7, ., 1, 30.71870.83110.1772yesN/A
Q5B1J4MPG1_EMENI2, ., 7, ., 7, ., 1, 30.67180.83110.1758yesN/A
Q941T9GMPP2_ORYSJ2, ., 7, ., 7, ., 1, 30.80.77920.1662yesN/A
Q752H4MPG1_ASHGO2, ., 7, ., 7, ., 1, 30.71870.83110.1772yesN/A
Q4U3E8MPG1_ASPFU2, ., 7, ., 7, ., 1, 30.70.77920.1648yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
cd06425 233 cd06425, M1P_guanylylT_B_like_N, N-terminal domain 9e-43
COG1208 358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph 3e-29
cd04181 217 cd04181, NTP_transferase, NTP_transferases catalyz 1e-27
cd06422 221 cd06422, NTP_transferase_like_1, NTP_transferase_l 4e-24
cd04189 236 cd04189, G1P_TT_long, G1P_TT_long represents the l 1e-23
TIGR03992 393 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph 1e-22
COG1209 286 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel 6e-21
cd06915 223 cd06915, NTP_transferase_WcbM_like, WcbM_like is a 9e-21
cd02523 229 cd02523, PC_cytidylyltransferase, Phosphocholine c 2e-20
TIGR01208 353 TIGR01208, rmlA_long, glucose-1-phosphate thymidyl 4e-20
pfam00483 247 pfam00483, NTP_transferase, Nucleotidyl transferas 1e-18
cd06426 220 cd06426, NTP_transferase_like_2, NTP_trnasferase_l 7e-18
COG4750 231 COG4750, LicC, CTP:phosphocholine cytidylyltransfe 3e-17
cd02507 216 cd02507, eIF-2B_gamma_N_like, The N-terminal of eI 2e-15
COG1213 239 COG1213, COG1213, Predicted sugar nucleotidyltrans 3e-14
cd06428 257 cd06428, M1P_guanylylT_A_like_N, N-terminal domain 5e-14
cd02524 253 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltr 2e-12
TIGR02623 254 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cyti 1e-11
cd02538 240 cd02538, G1P_TT_short, G1P_TT_short is the short f 1e-11
cd04198 214 cd04198, eIF-2B_gamma_N, The N-terminal domain of 4e-11
cd04197 217 cd04197, eIF-2B_epsilon_N, The N-terminal domain o 6e-11
cd02541 267 cd02541, UGPase_prokaryotic, Prokaryotic UGPase ca 1e-10
cd02540 229 cd02540, GT2_GlmU_N_bac, N-terminal domain of bact 6e-09
COG1207 460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uri 2e-08
TIGR01099 260 TIGR01099, galU, UTP-glucose-1-phosphate uridylylt 2e-08
COG1210 291 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell 5e-08
cd04182 186 cd04182, GT_2_like_f, GT_2_like_f is a subfamily o 5e-08
TIGR01207 286 TIGR01207, rmlA, glucose-1-phosphate thymidylyltra 6e-08
PRK15480 292 PRK15480, PRK15480, glucose-1-phosphate thymidylyl 6e-08
TIGR01173 451 TIGR01173, glmU, UDP-N-acetylglucosamine diphospho 6e-08
COG2266 177 COG2266, COG2266, GTP:adenosylcobinamide-phosphate 6e-08
PRK14354 458 PRK14354, glmU, bifunctional N-acetylglucosamine-1 1e-07
TIGR01105 297 TIGR01105, galF, UTP-glucose-1-phosphate uridylylt 5e-07
COG0448 393 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb 5e-07
TIGR02091 361 TIGR02091, glgC, glucose-1-phosphate adenylyltrans 7e-07
PRK10122 297 PRK10122, PRK10122, GalU regulator GalF; Provision 8e-07
PRK02862 429 PRK02862, glgC, glucose-1-phosphate adenylyltransf 9e-07
pfam12804 178 pfam12804, NTP_transf_3, MobA-like NTP transferase 1e-06
PRK00725 425 PRK00725, glgC, glucose-1-phosphate adenylyltransf 1e-06
cd02508 200 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphory 2e-06
cd02516 218 cd02516, CDP-ME_synthetase, CDP-ME synthetase is i 3e-06
PRK14355 459 PRK14355, glmU, bifunctional N-acetylglucosamine-1 4e-06
PRK00155 227 PRK00155, ispD, 2-C-methyl-D-erythritol 4-phosphat 5e-06
PRK14353 446 PRK14353, glmU, bifunctional N-acetylglucosamine-1 5e-06
PRK13389 302 PRK13389, PRK13389, UTP--glucose-1-phosphate uridy 6e-06
TIGR00453 217 TIGR00453, ispD, 2-C-methyl-D-erythritol 4-phospha 7e-06
PRK05293 380 PRK05293, glgC, glucose-1-phosphate adenylyltransf 7e-06
PRK00844 407 PRK00844, glgC, glucose-1-phosphate adenylyltransf 9e-06
COG2068 199 COG2068, COG2068, Uncharacterized MobA-related pro 1e-05
COG1211 230 COG1211, IspD, 4-diphosphocytidyl-2-methyl-D-erith 2e-05
PLN02241 436 PLN02241, PLN02241, glucose-1-phosphate adenylyltr 3e-05
cd02509 274 cd02509, GDP-M1P_Guanylyltransferase, GDP-M1P_Guan 3e-05
COG0746 192 COG0746, MobA, Molybdopterin-guanine dinucleotide 4e-05
TIGR00454 175 TIGR00454, TIGR00454, TIGR00454 family protein 6e-05
cd02503 181 cd02503, MobA, MobA catalyzes the formation of mol 9e-05
PRK14356 456 PRK14356, glmU, bifunctional N-acetylglucosamine-1 1e-04
PRK00317 193 PRK00317, mobA, molybdopterin-guanine dinucleotide 2e-04
PRK14358 481 PRK14358, glmU, bifunctional N-acetylglucosamine-1 4e-04
TIGR03310 188 TIGR03310, matur_ygfJ, molybdenum hydroxylase acce 9e-04
PRK09451 456 PRK09451, glmU, bifunctional N-acetylglucosamine-1 0.001
PRK14352 482 PRK14352, glmU, bifunctional N-acetylglucosamine-1 0.002
PRK05450 245 PRK05450, PRK05450, 3-deoxy-manno-octulosonate cyt 0.002
PRK14359 430 PRK14359, glmU, bifunctional N-acetylglucosamine-1 0.003
>gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
 Score =  137 bits (348), Expect = 9e-43
 Identities = 49/64 (76%), Positives = 55/64 (85%)

Query: 11 MKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQM 70
          MKALILVGGYGTRLRPLTL+ PKPLVEF NKPM+ HQIEAL +AGV+E+ILAV+YR E M
Sbjct: 1  MKALILVGGYGTRLRPLTLTVPKPLVEFCNKPMIEHQIEALAKAGVKEIILAVNYRPEDM 60

Query: 71 EDEL 74
             L
Sbjct: 61 VPFL 64


GDP-mannose pyrophosphorylase (GTP: alpha-d-mannose-1-phosphate guanyltransferase) catalyzes the formation of GDP-d-mannose from GTP and alpha-d-mannose-1-Phosphate. It contains an N-terminal catalytic domain and a C-terminal Lefthanded-beta-Helix fold domain. GDP-d-mannose is the activated form of mannose for formation of cell wall lipoarabinomannan and various mannose-containing glycolipids and polysaccharides. The function of GDP-mannose pyrophosphorylase is essential for cell wall integrity, morphogenesis and viability. Repression of GDP-mannose pyrophosphorylase in yeast leads to phenotypes, such as cell lysis, defective cell wall, and failure of polarized growth and cell separation. Length = 233

>gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase Back     alignment and domain information
>gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|227093 COG4750, LicC, CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>gnl|CDD|224134 COG1213, COG1213, Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|133040 cd04197, eIF-2B_epsilon_N, The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU Back     alignment and domain information
>gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233272 TIGR01099, galU, UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>gnl|CDD|224131 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133025 cd04182, GT_2_like_f, GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>gnl|CDD|130274 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>gnl|CDD|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|225175 COG2266, COG2266, GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|130175 TIGR01105, galF, UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|182252 PRK10122, PRK10122, GalU regulator GalF; Provisional Back     alignment and domain information
>gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|221780 pfam12804, NTP_transf_3, MobA-like NTP transferase domain Back     alignment and domain information
>gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>gnl|CDD|133009 cd02516, CDP-ME_synthetase, CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234670 PRK00155, ispD, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184021 PRK13389, PRK13389, UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>gnl|CDD|213532 TIGR00453, ispD, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|224979 COG2068, COG2068, Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|224132 COG1211, IspD, 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|133003 cd02509, GDP-M1P_Guanylyltransferase, GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>gnl|CDD|223817 COG0746, MobA, Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|200016 TIGR00454, TIGR00454, TIGR00454 family protein Back     alignment and domain information
>gnl|CDD|133000 cd02503, MobA, MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>gnl|CDD|237686 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234725 PRK00317, mobA, molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>gnl|CDD|237688 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234166 TIGR03310, matur_ygfJ, molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>gnl|CDD|181867 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184641 PRK14352, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235473 PRK05450, PRK05450, 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237689 PRK14359, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 77
TIGR01105 297 galF UTP-glucose-1-phosphate uridylyltransferase, 99.83
cd04197 217 eIF-2B_epsilon_N The N-terminal domain of epsilon 99.82
PRK10122 297 GalU regulator GalF; Provisional 99.81
PRK05293 380 glgC glucose-1-phosphate adenylyltransferase; Prov 99.81
PRK00844 407 glgC glucose-1-phosphate adenylyltransferase; Prov 99.81
COG1208 358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 99.79
TIGR01099 260 galU UTP-glucose-1-phosphate uridylyltransferase. 99.79
cd02541 267 UGPase_prokaryotic Prokaryotic UGPase catalyses th 99.79
cd06422 221 NTP_transferase_like_1 NTP_transferase_like_1 is a 99.79
cd02508 200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 99.78
cd06425 233 M1P_guanylylT_B_like_N N-terminal domain of the M1 99.78
PF00483 248 NTP_transferase: Nucleotidyl transferase This Pros 99.77
cd04189 236 G1P_TT_long G1P_TT_long represents the long form o 99.76
PRK02862 429 glgC glucose-1-phosphate adenylyltransferase; Prov 99.76
TIGR02623 254 G1P_cyt_trans glucose-1-phosphate cytidylyltransfe 99.76
cd02538 240 G1P_TT_short G1P_TT_short is the short form of glu 99.76
cd04198 214 eIF-2B_gamma_N The N-terminal domain of gamma subu 99.76
cd02524 253 G1P_cytidylyltransferase G1P_cytidylyltransferase 99.76
PRK00725 425 glgC glucose-1-phosphate adenylyltransferase; Prov 99.76
cd02507 216 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma 99.76
PRK15480 292 glucose-1-phosphate thymidylyltransferase RfbA; Pr 99.76
cd06426 220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a 99.76
COG4750 231 LicC CTP:phosphocholine cytidylyltransferase invol 99.75
PLN02241 436 glucose-1-phosphate adenylyltransferase 99.75
cd06915 223 NTP_transferase_WcbM_like WcbM_like is a subfamily 99.75
cd02523 229 PC_cytidylyltransferase Phosphocholine cytidylyltr 99.75
TIGR02092 369 glgD glucose-1-phosphate adenylyltransferase, GlgD 99.74
cd04181 217 NTP_transferase NTP_transferases catalyze the tran 99.74
PRK13389 302 UTP--glucose-1-phosphate uridylyltransferase subun 99.73
cd06428 257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 99.73
TIGR01207 286 rmlA glucose-1-phosphate thymidylyltransferase, sh 99.72
TIGR02091 361 glgC glucose-1-phosphate adenylyltransferase. This 99.72
TIGR01208 353 rmlA_long glucose-1-phosphate thymidylylransferase 99.7
COG1209 286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 99.7
COG1213 239 Predicted sugar nucleotidyltransferases [Cell enve 99.69
COG1210 291 GalU UDP-glucose pyrophosphorylase [Cell envelope 99.68
cd04183 231 GT2_BcE_like GT2_BcbE_like is likely involved in t 99.65
KOG1322|consensus 371 99.65
cd02509 274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf 99.64
cd02540 229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 99.64
TIGR00454 183 conserved hypothetical protein TIGR00454. At this 99.62
PF12804 160 NTP_transf_3: MobA-like NTP transferase domain; PD 99.61
PRK14356 456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.61
PRK14358 481 glmU bifunctional N-acetylglucosamine-1-phosphate 99.6
TIGR01173 451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 99.59
PRK14353 446 glmU bifunctional N-acetylglucosamine-1-phosphate 99.59
PRK14354 458 glmU bifunctional N-acetylglucosamine-1-phosphate 99.59
PRK14359 430 glmU bifunctional N-acetylglucosamine-1-phosphate 99.57
PRK09451 456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.57
COG1207 460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 99.56
PRK14355 459 glmU bifunctional N-acetylglucosamine-1-phosphate 99.56
PRK14352 482 glmU bifunctional N-acetylglucosamine-1-phosphate 99.56
PF01128 221 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidyly 99.56
PLN02728 252 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.55
cd04182 186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 99.55
PRK14360 450 glmU bifunctional N-acetylglucosamine-1-phosphate 99.54
TIGR01479 468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.52
PRK00155 227 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 99.52
TIGR03310 188 matur_ygfJ molybdenum hydroxylase accessory protei 99.51
COG1211 230 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt 99.51
PRK00317 193 mobA molybdopterin-guanine dinucleotide biosynthes 99.51
COG0448 393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 99.51
TIGR00453 217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 99.49
PRK13385 230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.48
PRK09382 378 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp 99.48
cd02516 218 CDP-ME_synthetase CDP-ME synthetase is involved in 99.47
KOG1462|consensus 433 99.47
cd02503 181 MobA MobA catalyzes the formation of molybdopterin 99.47
TIGR03202 190 pucB xanthine dehydrogenase accessory protein pucB 99.47
PRK14357 448 glmU bifunctional N-acetylglucosamine-1-phosphate 99.46
COG0836 333 {ManC} Mannose-1-phosphate guanylyltransferase [Ce 99.45
PRK02726 200 molybdopterin-guanine dinucleotide biosynthesis pr 99.45
PRK05450 245 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.44
COG2266 177 GTP:adenosylcobinamide-phosphate guanylyltransfera 99.42
COG2068 199 Uncharacterized MobA-related protein [General func 99.42
PRK15460 478 cpsB mannose-1-phosphate guanyltransferase; Provis 99.42
PRK13368 238 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.42
cd02517 239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 99.41
PRK00560 196 molybdopterin-guanine dinucleotide biosynthesis pr 99.41
TIGR02665 186 molyb_mobA molybdopterin-guanine dinucleotide bios 99.4
KOG1461|consensus 673 99.38
KOG1460|consensus 407 99.36
TIGR00466 238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 99.35
PRK14489 366 putative bifunctional molybdopterin-guanine dinucl 99.33
cd02513 223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 99.31
PRK14490 369 putative bifunctional molybdopterin-guanine dinucl 99.3
cd02518 233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 99.3
PLN02917 293 CMP-KDO synthetase 99.27
PRK14500 346 putative bifunctional molybdopterin-guanine dinucl 99.19
COG0746 192 MobA Molybdopterin-guanine dinucleotide biosynthes 99.19
cd04180 266 UGPase_euk_like Eukaryotic UGPase-like includes UD 99.16
TIGR03584 222 PseF pseudaminic acid CMP-transferase. The sequenc 99.08
PF02348 217 CTP_transf_3: Cytidylyltransferase; InterPro: IPR0 99.03
PTZ00339 482 UDP-N-acetylglucosamine pyrophosphorylase; Provisi 98.99
cd04193 323 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala 98.92
COG1212 247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase 98.87
COG1083 228 NeuA CMP-N-acetylneuraminic acid synthetase [Cell 98.56
COG1861 241 SpsF Spore coat polysaccharide biosynthesis protei 98.49
cd00897 300 UGPase_euk Eukaryotic UGPase catalyses the synthes 98.36
cd06424 315 UGGPase UGGPase catalyzes the synthesis of UDP-Glu 98.31
PF01704 420 UDPGP: UTP--glucose-1-phosphate uridylyltransferas 98.16
PLN02474 469 UTP--glucose-1-phosphate uridylyltransferase 98.06
PLN02435 493 probable UDP-N-acetylglucosamine pyrophosphorylase 97.98
PLN02830 615 UDP-sugar pyrophosphorylase 97.94
COG4284 472 UDP-glucose pyrophosphorylase [Carbohydrate transp 97.81
PRK00576 178 molybdopterin-guanine dinucleotide biosynthesis pr 97.53
KOG2388|consensus 477 96.14
KOG2638|consensus 498 89.4
TIGR03552 195 F420_cofC 2-phospho-L-lactate guanylyltransferase 86.49
PF05060 356 MGAT2: N-acetylglucosaminyltransferase II (MGAT2); 80.19
>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
Probab=99.83  E-value=2.5e-20  Score=121.37  Aligned_cols=67  Identities=30%  Similarity=0.563  Sum_probs=63.7

Q ss_pred             CCcEEEEEeCCCCCCCCCCCCCCCcceeeeCCeeHHHHHHHHHHhcCCCeEEEEccCCHHHHHHHHh
Q psy9166           9 DNMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQMEDELL   75 (77)
Q Consensus         9 ~~~~~vIlaaG~~~R~~~~t~~~~K~ll~i~g~~li~~~l~~l~~~~~~~ivvv~~~~~~~~~~~~~   75 (77)
                      .++++||||||.|+||+|+|...||+|+|++|+|+|+|+++.+.++|+++|+|++++..+.+.+++.
T Consensus         2 ~~mkavILAaG~GTRL~PlT~~~PKpLvpV~gkPiI~~vl~~l~~~Gi~~ivivv~~~~~~i~~~~~   68 (297)
T TIGR01105         2 TNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASKNAVENHFD   68 (297)
T ss_pred             CceEEEEECCCCCcccCcccCCCCceeeEECCEEHHHHHHHHHHHCCCCEEEEEecCChHHHHHHHh
Confidence            3689999999999999999999999999999999999999999999999999999999899998874



GalF is a non-catalytic subunit of the UTP-glucose pyrophosphorylase modulating the enzyme activity to increase the formation of UDP-glucose

>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>PRK10122 GalU regulator GalF; Provisional Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>KOG1322|consensus Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>TIGR00454 conserved hypothetical protein TIGR00454 Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PF01128 IspD: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, a bacterial ispD protein, catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate [] Back     alignment and domain information
>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>KOG1462|consensus Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>KOG1461|consensus Back     alignment and domain information
>KOG1460|consensus Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional Back     alignment and domain information
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2 Back     alignment and domain information
>PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional Back     alignment and domain information
>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc Back     alignment and domain information
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose Back     alignment and domain information
>cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose Back     alignment and domain information
>PF01704 UDPGP: UTP--glucose-1-phosphate uridylyltransferase; InterPro: IPR002618 This family consists of UTP--glucose-1-phosphate uridylyltransferases (2 Back     alignment and domain information
>PLN02474 UTP--glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>PLN02435 probable UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>PLN02830 UDP-sugar pyrophosphorylase Back     alignment and domain information
>COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>KOG2388|consensus Back     alignment and domain information
>KOG2638|consensus Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>PF05060 MGAT2: N-acetylglucosaminyltransferase II (MGAT2); InterPro: IPR007754 N-acetylglucosaminyltransferase II (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
1jyl_A 254 Catalytic Mechanism Of Ctp:phosphocholine Cytidylyt 7e-12
1jyk_A 254 Catalytic Mechanism Of Ctp:phosphocholine Cytidylyt 7e-12
2ggo_A 401 Crystal Structure Of Glucose-1-Phosphate Thymidylyl 3e-09
1tzf_A 259 X-Ray Crystal Structure Of Alpha-D-Glucose-1-Phosph 4e-08
4arw_A 302 Pseudomonas Aeruginosa Rmla In Complex With Alloste 1e-06
1fxo_A 293 The Structural Basis Of The Catalytic Mechanism And 1e-06
4b2x_A 303 Pseudomonas Aeruginosa Rmla In Complex With Alloste 1e-06
1h5r_B 293 Thymidylyltransferase Complexed With Thimidine And 2e-06
1h5t_A 293 Thymidylyltransferase Complexed With Thymidylyldiph 2e-06
1h5s_D 293 Thymidylyltransferase Complexed With Tmp Length = 2 2e-06
3pkq_A 292 Q83d Variant Of S. Enterica Rmla With Dgtp Length = 2e-06
3pkp_A 292 Q83s Variant Of S. Enterica Rmla With Datp Length = 2e-06
1h5s_A 293 Thymidylyltransferase Complexed With Tmp Length = 2 3e-06
1lvw_A 295 Crystal Structure Of Glucose-1-phosphate Thymidylyl 3e-06
1mp3_A 292 L89t Variant Of S. Enterica Rmla Length = 292 6e-06
1iim_A 292 Thymidylyltransferase Complexed With Ttp Length = 2 6e-06
1mp5_A 292 Y177f Variant Of S. Enterica Rmla Length = 292 6e-06
1mp4_A 292 W224h Variant Of S. Enterica Rmla Length = 292 6e-06
1g23_A 293 The Structural Basis Of The Catalytic Mechanism And 8e-06
1mc3_A 296 Crystal Structure Of Rffh Length = 296 1e-05
2ux8_A 297 Crystal Structure Of Sphingomonas Elodea Atcc 31461 3e-05
3juj_A 281 The Crystal Structure Of Apo- Udp-Glucose Pyrophosp 3e-05
2e3d_A 302 Crystal Structure Of E. Coli Glucose-1-Phosphate Ur 3e-05
3brk_X 420 Crystal Structure Of Adp-Glucose Pyrophosphorylase 2e-04
3hl3_A 269 2.76 Angstrom Crystal Structure Of A Putative Gluco 6e-04
>pdb|1JYL|A Chain A, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) Length = 254 Back     alignment and structure

Iteration: 1

Score = 65.5 bits (158), Expect = 7e-12, Method: Composition-based stats. Identities = 30/61 (49%), Positives = 42/61 (68%) Query: 11 MKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQM 70 +KA+IL G GTRLRPLT + PK LV+ KP++ +QIE L E G+ ++I+ V Y EQ Sbjct: 26 VKAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQF 85 Query: 71 E 71 + Sbjct: 86 D 86
>pdb|1JYK|A Chain A, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) Length = 254 Back     alignment and structure
>pdb|2GGO|A Chain A, Crystal Structure Of Glucose-1-Phosphate Thymidylyltransferase From Sulfolobus Tokodaii Length = 401 Back     alignment and structure
>pdb|1TZF|A Chain A, X-Ray Crystal Structure Of Alpha-D-Glucose-1-Phosphate Cytidylyltransferase From Salmonella Typhi Length = 259 Back     alignment and structure
>pdb|4ARW|A Chain A, Pseudomonas Aeruginosa Rmla In Complex With Allosteric Inhibitor Length = 302 Back     alignment and structure
>pdb|1FXO|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. Length = 293 Back     alignment and structure
>pdb|4B2X|A Chain A, Pseudomonas Aeruginosa Rmla In Complex With Allosteric Inhibitor Length = 303 Back     alignment and structure
>pdb|1H5R|B Chain B, Thymidylyltransferase Complexed With Thimidine And Glucose- 1-Phospate Length = 293 Back     alignment and structure
>pdb|1H5T|A Chain A, Thymidylyltransferase Complexed With Thymidylyldiphosphate- Glucose Length = 293 Back     alignment and structure
>pdb|1H5S|D Chain D, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>pdb|3PKQ|A Chain A, Q83d Variant Of S. Enterica Rmla With Dgtp Length = 292 Back     alignment and structure
>pdb|3PKP|A Chain A, Q83s Variant Of S. Enterica Rmla With Datp Length = 292 Back     alignment and structure
>pdb|1H5S|A Chain A, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>pdb|1LVW|A Chain A, Crystal Structure Of Glucose-1-phosphate Thymidylyltransferase, Rmla, Complex With Dtdp Length = 295 Back     alignment and structure
>pdb|1MP3|A Chain A, L89t Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1IIM|A Chain A, Thymidylyltransferase Complexed With Ttp Length = 292 Back     alignment and structure
>pdb|1MP5|A Chain A, Y177f Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1MP4|A Chain A, W224h Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1G23|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Glucose-1-Phosphate Complex. Length = 293 Back     alignment and structure
>pdb|1MC3|A Chain A, Crystal Structure Of Rffh Length = 296 Back     alignment and structure
>pdb|2UX8|A Chain A, Crystal Structure Of Sphingomonas Elodea Atcc 31461 Glucose- 1-phosphate Uridylyltransferase In Complex With Glucose- 1-phosphate. Length = 297 Back     alignment and structure
>pdb|3JUJ|A Chain A, The Crystal Structure Of Apo- Udp-Glucose Pyrophosphorylase Length = 281 Back     alignment and structure
>pdb|2E3D|A Chain A, Crystal Structure Of E. Coli Glucose-1-Phosphate Uridylyltransferase Length = 302 Back     alignment and structure
>pdb|3BRK|X Chain X, Crystal Structure Of Adp-Glucose Pyrophosphorylase From Agrobacterium Tumefaciens Length = 420 Back     alignment and structure
>pdb|3HL3|A Chain A, 2.76 Angstrom Crystal Structure Of A Putative Glucose-1-Phosphate Thymidylyltransferase From Bacillus Anthracis In Complex With A Sucrose. Length = 269 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
1jyk_A 254 LICC protein, CTP:phosphocholine cytidylytransfera 1e-34
3rsb_A 196 Adenosylcobinamide-phosphate guanylyltransferase; 3e-26
1tzf_A 259 Glucose-1-phosphate cytidylyltransferase; nucleoti 4e-26
2xme_A 232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 2e-24
2ggo_A 401 401AA long hypothetical glucose-1-phosphate thymid 2e-23
4evw_A 255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 2e-15
2wee_A 197 MOBA-related protein; unknown function; 1.65A {Myc 5e-11
2waw_A 199 MOBA relate protein; unknown function; HET: PGE; 1 2e-10
1hm9_A 468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 9e-10
2dpw_A 232 Hypothetical protein TTHA0179; transferase, struct 2e-09
4ecm_A 269 Glucose-1-phosphate thymidylyltransferase; HET: DA 2e-09
1lvw_A 295 Glucose-1-phosphate thymidylyltransferase; protein 5e-09
1mc3_A 296 Glucose-1-phosphate thymidylyltransferase; glucose 7e-09
1fxo_A 293 Glucose-1-phosphate thymidylyltransferase; rhamnos 7e-09
4fce_A 459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 8e-09
2v0h_A 456 Bifunctional protein GLMU; cell WALL, magnesium, c 1e-08
3st8_A 501 Bifunctional protein GLMU; acetyltransferase, pyro 2e-08
3brk_X 420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 5e-08
1yp2_A 451 Glucose-1-phosphate adenylyltransferase small subu 1e-07
2xwl_A 223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 1e-06
2yc3_A 228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 2e-06
1i52_A 236 4-diphosphocytidyl-2-C-methylerythritol synthase; 2e-06
1vgw_A 231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 3e-06
3d5n_A 197 Q97W15_sulso; NESG, SSR125, structural genomics, P 3e-06
1vpa_A 234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 3e-06
2px7_A 236 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 3e-06
3f1c_A 246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 3e-06
3pnn_A 303 Conserved domain protein; structural genomics, PSI 3e-06
3q80_A 231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 5e-06
2vsh_A 236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 6e-06
3juk_A 281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 1e-05
3ngw_A 208 Molybdopterin-guanine dinucleotide biosynthesis P 2e-05
2ux8_A 297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 2e-05
2e3d_A 302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 2e-05
1w55_A 371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 5e-05
2e8b_A 201 Probable molybdopterin-guanine dinucleotide biosy 1e-04
2qh5_A 308 PMI, ALGA, mannose-6-phosphate isomerase; structur 1e-04
1e5k_A 201 Molybdopterin-guanine dinucleotide biosynthesis pr 1e-04
2pa4_A 323 UTP-glucose-1-phosphate uridylyltransferase; phosp 2e-04
3oam_A 252 3-deoxy-manno-octulosonate cytidylyltransferase; c 6e-04
3k8d_A 264 3-deoxy-manno-octulosonate cytidylyltransferase; K 7e-04
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 Back     alignment and structure
 Score =  117 bits (294), Expect = 1e-34
 Identities = 30/65 (46%), Positives = 42/65 (64%)

Query: 7  NPDNMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYR 66
              +KA+IL  G GTRLRPLT + PK LV+   KP++ +QIE L E G+ ++I+ V Y 
Sbjct: 22 KEIRVKAIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYL 81

Query: 67 AEQME 71
           EQ +
Sbjct: 82 KEQFD 86


>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196 Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Length = 259 Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Length = 255 Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Length = 197 Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Length = 199 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Length = 232 Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Length = 269 Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Length = 295 Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Length = 296 Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Length = 293 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Length = 223 Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Length = 228 Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Length = 236 Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Length = 231 Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Length = 197 Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Length = 234 Back     alignment and structure
>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} Length = 236 Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} Length = 246 Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Length = 303 Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} PDB: 3q7u_A* 3okr_A 2xwn_A* Length = 231 Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Length = 236 Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Length = 281 Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Length = 208 Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Length = 297 Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Length = 302 Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Length = 371 Back     alignment and structure
>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} Length = 201 Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Length = 308 Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Length = 201 Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 323 Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} Length = 252 Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, cytoplasm, lipopolysaccharide biosynthesis, magnesium; HET: KDO CTP; 1.90A {Escherichia coli} PDB: 3k8e_C 1vh1_A 3jtj_A* Length = 264 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
1tzf_A 259 Glucose-1-phosphate cytidylyltransferase; nucleoti 99.81
2ux8_A 297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 99.81
3juk_A 281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 99.81
2e3d_A 302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 99.8
3st8_A 501 Bifunctional protein GLMU; acetyltransferase, pyro 99.78
4ecm_A 269 Glucose-1-phosphate thymidylyltransferase; HET: DA 99.78
2pa4_A 323 UTP-glucose-1-phosphate uridylyltransferase; phosp 99.76
1jyk_A 254 LICC protein, CTP:phosphocholine cytidylytransfera 99.76
3brk_X 420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 99.75
1lvw_A 295 Glucose-1-phosphate thymidylyltransferase; protein 99.74
1fxo_A 293 Glucose-1-phosphate thymidylyltransferase; rhamnos 99.74
1yp2_A 451 Glucose-1-phosphate adenylyltransferase small subu 99.73
4evw_A 255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 99.72
1mc3_A 296 Glucose-1-phosphate thymidylyltransferase; glucose 99.72
2qh5_A 308 PMI, ALGA, mannose-6-phosphate isomerase; structur 99.69
3rsb_A 196 Adenosylcobinamide-phosphate guanylyltransferase; 99.68
2wee_A 197 MOBA-related protein; unknown function; 1.65A {Myc 99.68
2waw_A 199 MOBA relate protein; unknown function; HET: PGE; 1 99.68
1vgw_A 231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 99.67
2yc3_A 228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 99.67
2ggo_A 401 401AA long hypothetical glucose-1-phosphate thymid 99.67
2x65_A 336 Mannose-1-phosphate guanylyltransferase; nucleotid 99.66
2cu2_A 337 Putative mannose-1-phosphate guanylyl transferase; 99.66
3f1c_A 246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 99.65
4fce_A 459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 99.64
2vsh_A 236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 99.63
2v0h_A 456 Bifunctional protein GLMU; cell WALL, magnesium, c 99.62
3pnn_A 303 Conserved domain protein; structural genomics, PSI 99.62
3q80_A 231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 99.6
2xme_A 232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 99.6
1i52_A 236 4-diphosphocytidyl-2-C-methylerythritol synthase; 99.6
3tqd_A 256 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.6
2xwl_A 223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.59
1ezi_A 228 CMP-N-acetylneuraminic acid synthetase; homodimer, 99.59
1e5k_A 201 Molybdopterin-guanine dinucleotide biosynthesis pr 99.58
1vpa_A 234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.58
1hm9_A 468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 99.58
3oam_A 252 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.58
2y6p_A 234 3-deoxy-manno-octulosonate cytidylyltransferase; l 99.57
1h7e_A 245 3-deoxy-manno-octulosonate cytidylyltransferase; n 99.56
3k8d_A 264 3-deoxy-manno-octulosonate cytidylyltransferase; K 99.54
1vic_A 262 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.53
3d5n_A 197 Q97W15_sulso; NESG, SSR125, structural genomics, P 99.52
1qwj_A 229 Cytidine monophospho-N-acetylneuraminic acid synth 99.52
2e8b_A 201 Probable molybdopterin-guanine dinucleotide biosy 99.5
1w55_A 371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 99.49
4fcu_A 253 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.49
2px7_A 236 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.47
3ngw_A 208 Molybdopterin-guanine dinucleotide biosynthesis P 99.44
2dpw_A 232 Hypothetical protein TTHA0179; transferase, struct 99.41
2i5k_A 488 UTP--glucose-1-phosphate uridylyltransferase; LEFT 99.17
2icy_A 469 Probable UTP-glucose-1-phosphate uridylyltransfera 99.13
1jv1_A 505 Glcnac1P uridyltransferase isoform 1: AGX1; nucleo 99.09
2oeg_A 505 UTP-glucose-1-phosphate uridylyltransferase 2, put 99.06
2yqc_A 486 UDP-N-acetylglucosamine pyrophosphorylase; uridine 99.03
3oc9_A 405 UDP-N-acetylglucosamine pyrophosphorylase; structu 98.99
3r3i_A 528 UTP--glucose-1-phosphate uridylyltransferase; ross 98.28
3gue_A 484 UTP-glucose-1-phosphate uridylyltransferase 2; pho 98.18
3ogz_A 630 UDP-sugar pyrophosphorylase; LEFT handed beta heli 97.9
2i5e_A 211 Hypothetical protein MM_2497; APC86122, methanosar 97.21
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Back     alignment and structure
Probab=99.81  E-value=1.1e-19  Score=113.59  Aligned_cols=66  Identities=35%  Similarity=0.670  Sum_probs=54.1

Q ss_pred             CcEEEEEeCCCCCCCCCCCCCCCcceeeeCCeeHHHHHHHHHHhcCCCeEEEEccCCHHHHHHHHh
Q psy9166          10 NMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQMEDELL   75 (77)
Q Consensus        10 ~~~~vIlaaG~~~R~~~~t~~~~K~ll~i~g~~li~~~l~~l~~~~~~~ivvv~~~~~~~~~~~~~   75 (77)
                      .+.+||||||.|+||+|+|...||+|++++|+|+|+|+++++.++|+++|+|+++++.+.+.+++.
T Consensus         2 ~~~avIlAaG~gtRl~~lt~~~pK~l~~i~gkpli~~~l~~l~~~g~~~i~vv~~~~~~~i~~~~~   67 (259)
T 1tzf_A            2 ASKAVILAGGLGTRLSEETIVKPKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEYFA   67 (259)
T ss_dssp             CCEEEEEECSCC--------CCCGGGCEETTEEHHHHHHHHHHHTTCCEEEEEECTTHHHHHHHHH
T ss_pred             CcEEEEECCCCcccCCCccCCCCccccEECCEEHHHHHHHHHHHCCCCEEEEEcccCHHHHHHHHh
Confidence            468999999999999999999999999999999999999999999999999999988888888875



>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* Back     alignment and structure
>2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Back     alignment and structure
>2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* Back     alignment and structure
>2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* Back     alignment and structure
>2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* Back     alignment and structure
>3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} Back     alignment and structure
>3r3i_A UTP--glucose-1-phosphate uridylyltransferase; rossmann fold, beta barrel, nucleotidyltransferase; 3.57A {Homo sapiens} PDB: 3r2w_A Back     alignment and structure
>3gue_A UTP-glucose-1-phosphate uridylyltransferase 2; phosphatase, UDP, structural GE structural genomics consortium, SGC; HET: UPG PG4; 1.92A {Trypanosoma brucei} Back     alignment and structure
>3ogz_A UDP-sugar pyrophosphorylase; LEFT handed beta helix, rossmann fold, UDP sugar pyrophospho transferase; 2.03A {Leishmania major} PDB: 3oh3_A* 3oh1_A* 3oh0_A* 3oh2_A* 3oh4_A* Back     alignment and structure
>2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 77
d1mc3a_ 291 c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} 5e-26
d1tzfa_ 259 c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf 6e-26
d1fxoa_ 292 c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa 9e-26
d1lvwa_ 295 c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri 2e-24
d1yp2a2 307 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr 3e-22
d1jyka_ 229 c.68.1.13 (A:) CTP:phosphocholine cytidylytransfer 9e-21
d2oi6a2 248 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate 8e-17
d1g97a2 250 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate 6e-16
d2cu2a2 268 c.68.1.20 (A:1-268) Putative mannose-1-phosphate g 1e-11
d2dpwa1 231 c.68.1.19 (A:1-231) Uncharacterized protein TTHA01 2e-11
d1vpaa_ 221 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 3e-10
d1i52a_ 225 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 1e-09
d1vgwa_ 226 c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-eryt 3e-09
d1w77a1 226 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl- 6e-09
d1w55a1 205 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, 7e-08
d1vh1a_ 246 c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic ac 4e-06
d1vica_ 255 c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic ac 5e-06
d1e5ka_ 188 c.68.1.8 (A:) Molybdenum cofactor biosynthesis pro 1e-05
d1qwja_ 228 c.68.1.13 (A:) CMP acylneuraminate synthetase {Mou 3e-04
d1h7ea_ 245 c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic ac 0.002
d1eyra_ 225 c.68.1.13 (A:) CMP acylneuraminate synthetase {Nei 0.002
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RffH
species: Escherichia coli [TaxId: 562]
 Score = 94.4 bits (235), Expect = 5e-26
 Identities = 24/65 (36%), Positives = 38/65 (58%)

Query: 11 MKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQM 70
          MK +IL GG GTRL P+T    K L+   +KPM+ + +  L+ AG+RE+++  +   +  
Sbjct: 2  MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGY 61

Query: 71 EDELL 75
             LL
Sbjct: 62 FQRLL 66


>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 Back     information, alignment and structure
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Length = 229 Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 248 Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 250 Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Length = 268 Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Length = 231 Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Length = 221 Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Length = 225 Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Length = 226 Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Length = 226 Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Length = 205 Back     information, alignment and structure
>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} Length = 246 Back     information, alignment and structure
>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} Length = 255 Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} Length = 225 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
d1tzfa_ 259 Glucose-1-phosphate cytidylyltransferase RfbF {Sal 99.88
d1jyka_ 229 CTP:phosphocholine cytidylytransferase LicC {Strep 99.85
d1yp2a2 307 Glucose-1-phosphate adenylyltransferase small subu 99.83
d1lvwa_ 295 RmlA (RfbA) {Archaeon Methanobacterium thermoautot 99.8
d1fxoa_ 292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 99.78
d2oi6a2 248 N-acetylglucosamine 1-phosphate uridyltransferase 99.78
d1g97a2 250 N-acetylglucosamine 1-phosphate uridyltransferase 99.76
d1mc3a_ 291 RffH {Escherichia coli [TaxId: 562]} 99.76
d1i52a_ 225 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.7
d2cu2a2 268 Putative mannose-1-phosphate guanylyl transferase 99.69
d1w77a1 226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.67
d1vpaa_ 221 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.66
d1vgwa_ 226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 99.62
d1e5ka_ 188 Molybdenum cofactor biosynthesis protein MobA {Esc 99.6
d2dpwa1 231 Uncharacterized protein TTHA0179 {Thermus thermoph 99.59
d1w55a1 205 IspD/IspF bifunctional enzyme, CDP-me synthase dom 99.52
d1qwja_ 228 CMP acylneuraminate synthetase {Mouse (Mus musculu 99.28
d1eyra_ 225 CMP acylneuraminate synthetase {Neisseria meningit 99.26
d1vica_ 255 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.21
d1vh1a_ 246 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.19
d1h7ea_ 245 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 99.19
d2icya2 378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 98.59
d1jv1a_ 501 UDP-N-acetylglucosamine pyrophosphorylase {Human ( 98.14
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 83.66
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 82.15
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Cytidylytransferase
domain: Glucose-1-phosphate cytidylyltransferase RfbF
species: Salmonella typhimurium [TaxId: 90371]
Probab=99.88  E-value=1e-22  Score=124.55  Aligned_cols=66  Identities=35%  Similarity=0.670  Sum_probs=55.2

Q ss_pred             CcEEEEEeCCCCCCCCCCCCCCCcceeeeCCeeHHHHHHHHHHhcCCCeEEEEccCCHHHHHHHHh
Q psy9166          10 NMKALILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVEAGVREVILAVSYRAEQMEDELL   75 (77)
Q Consensus        10 ~~~~vIlaaG~~~R~~~~t~~~~K~ll~i~g~~li~~~l~~l~~~~~~~ivvv~~~~~~~~~~~~~   75 (77)
                      ...|||||||.|+||+|+|...||+|+|++|+|||+|+++.+.++|+++|+|++++..+.+.+++.
T Consensus         2 ~~kAiILAAG~GtRl~~lT~~~PK~Ll~i~gkplI~~~i~~l~~~gi~~i~iv~gy~~~~i~~~~~   67 (259)
T d1tzfa_           2 ASKAVILAGGLGTRLSEETIVKPKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEYFA   67 (259)
T ss_dssp             CCEEEEEECSCC--------CCCGGGCEETTEEHHHHHHHHHHHTTCCEEEEEECTTHHHHHHHHH
T ss_pred             CceEEEECCCccccCChhhCCCCccceEECCEEHHHHHHHHHHHcCCCeeeeccchhHHHHHHHHh
Confidence            467999999999999999999999999999999999999999999999999999999999999875



>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} Back     information, alignment and structure
>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} Back     information, alignment and structure
>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jv1a_ c.68.1.5 (A:) UDP-N-acetylglucosamine pyrophosphorylase {Human (Homo sapiens), AGX1 [TaxId: 9606]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure