Psyllid ID: psy9181

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
CWGNNFWSVVLVGGWGRWGWAAWLVGHGSGEARDSISVVLNSSQGTVRLDNSVESLYLVSITGLLLALLVTSDWVGNTVLEFVFWVWVDFTISAGNSSHLVWGNLSQSQGGRGEDESKLTSKRHFWFAKLQMSIRVKSENDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVSMMILFVRRPLALWVAEYKNPQFQSENRYFIKPQQHEIINMKILFHRQTYVLSLAIFETFSAVE
ccccccEEEEEEccccHHHHHHHHcccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHcccccccccccccccccccccccHHHHcccccHHHHHHHHHHHcccc
cccccEEEEEEEccccHHHHHHHHHccccccccccEEEEEEccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEHHHHHccccc
CWGNNFWSVVLVGGWGRWGWAAWLVGHGSGEARDSISVVLNssqgtvrldnSVESLYLVSITGLLLALLVTSDWVGNTVLEFVFWVWVDFTISAGNSSHLVWgnlsqsqggrgedeskltsKRHFWFAKLQMSIRVKsenddydyerrkpkprrnrttfnsHQLNALEKVFErthypdafVREELAKKVCLSEARVQVSMMILFVRRPLALWVAEyknpqfqsenryfikpqqHEIINMKILFHRQTYVLSLAIFETFSAVE
CWGNNFWSVVLVGGWGRWGWAAWLVGHGSGEARDSISVVLNSSQGTVRLDNSVESLYLVSITGLLLALLVTSDWVGNTVLEFVFWVWVDFTISAGNSSHLVWGNLSqsqggrgedeskltskrhfwfaklqmsirvksenddydyerrkpkprrnrttfnshqlnALEKVFERTHYPDAFVREELAKKVCLSEARVQVSMMILFVRRPLALWVAEYKNPQFQSENRYFIKPQQHEIINMKILFHRQTYVLSLAIFETFSAVE
CWGNNFWSvvlvggwgrwgwaawlvgHGSGEARDSISVVLNSSQGTVRLDNSVESLYLVSITGLLLALLVTSDWVGNTVLEFVFWVWVDFTISAGNSSHLVWGNLSQSQGGRGEDESKLTSKRHFWFAKLQMSIRVKSENDDYDYErrkpkprrnrttFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVSMMILFVRRPLALWVAEYKNPQFQSENRYFIKPQQHEIINMKILFHRQTYVLSLAIFETFSAVE
*WGNNFWSVVLVGGWGRWGWAAWLVGHGSGEARDSISVVLNSSQGTVRLDNSVESLYLVSITGLLLALLVTSDWVGNTVLEFVFWVWVDFTISAGNSSHLVWGN******************RHFWFAKLQMSIR****************************LNALEKVFERTHYPDAFVREELAKKVCLSEARVQVSMMILFVRRPLALWVAEYKNPQFQSENRYFIKPQQHEIINMKILFHRQTYVLSLAIFETF****
**GNNFWSVVLVGGWGRWGWAAWLVG*****************************LYLVSITGLLLALLVTSDWVGNTVLEFVFWV***********************************************************************TFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVSMMILFVRRPL********************************LFHRQTYVLSLAIFETFS***
CWGNNFWSVVLVGGWGRWGWAAWLVGHGSGEARDSISVVLNSSQGTVRLDNSVESLYLVSITGLLLALLVTSDWVGNTVLEFVFWVWVDFTISAGNSSHLVWGNL**************TSKRHFWFAKLQMSIRVKSENDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVSMMILFVRRPLALWVAEYKNPQFQSENRYFIKPQQHEIINMKILFHRQTYVLSLAIFETFSAVE
CWGNNFWSVVLVGGWGRWGWAAWLVGHGSGEARDSISVVLNSSQGTVRLDNSVESLYLVSITGLLLALLVTSDWVGNTVLEFVFWV*********************************************************************RTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVSMMILFVRRPLALWVAEYKNPQFQSENRYFIKPQQHEIINMKILFHRQTYVLSLAIFETFSAV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CWGNNFWSVVLVGGWGRWGWAAWLVGHGSGEARDSISVVLNSSQGTVRLDNSVESLYLVSITGLLLALLVTSDWVGNTVLEFVFWVWVDFTISAGNSSHLVWGNLSQSQGGRGEDESKLTSKRHFWFAKLQMSIRVKSENDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVSMMILFVRRPLALWVAEYKNPQFQSENRYFIKPQQHEIINMKILFHRQTYVLSLAIFETFSAVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query262 2.2.26 [Sep-21-2011]
Q90963165 Paired mesoderm homeobox no N/A 0.160 0.254 0.857 4e-14
Q99811253 Paired mesoderm homeobox yes N/A 0.160 0.166 0.857 5e-14
Q06348247 Paired mesoderm homeobox yes N/A 0.160 0.170 0.857 5e-14
O35137399 Homeobox protein aristale no N/A 0.259 0.170 0.544 1e-13
Q4LAL6397 Homeobox protein aristale no N/A 0.259 0.171 0.544 1e-13
Q05437245 Paired mesoderm homeobox no N/A 0.160 0.171 0.809 2e-13
Q06453 408 Homeobox protein aristale no N/A 0.217 0.139 0.6 3e-13
P63014245 Paired mesoderm homeobox no N/A 0.160 0.171 0.809 3e-13
P63013245 Paired mesoderm homeobox no N/A 0.160 0.171 0.809 3e-13
P54821245 Paired mesoderm homeobox no N/A 0.160 0.171 0.809 3e-13
>sp|Q90963|PRRX2_CHICK Paired mesoderm homeobox protein 2 (Fragment) OS=Gallus gallus GN=PRRX2 PE=2 SV=1 Back     alignment and function desciption
 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/42 (85%), Positives = 39/42 (92%)

Query: 157 TTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQV 198
           TTFNS QL ALE+VFERTHYPDAFVREELA++V LSEARVQV
Sbjct: 21  TTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQV 62
May play a role in development of the heart.
Gallus gallus (taxid: 9031)
>sp|Q99811|PRRX2_HUMAN Paired mesoderm homeobox protein 2 OS=Homo sapiens GN=PRRX2 PE=2 SV=2 Back     alignment and function description
>sp|Q06348|PRRX2_MOUSE Paired mesoderm homeobox protein 2 OS=Mus musculus GN=Prrx2 PE=2 SV=2 Back     alignment and function description
>sp|O35137|ALX4_MOUSE Homeobox protein aristaless-like 4 OS=Mus musculus GN=Alx4 PE=1 SV=1 Back     alignment and function description
>sp|Q4LAL6|ALX4_BOVIN Homeobox protein aristaless-like 4 OS=Bos taurus GN=ALX4 PE=2 SV=1 Back     alignment and function description
>sp|Q05437|PRRX1_CHICK Paired mesoderm homeobox protein 1 OS=Gallus gallus GN=PRRX1 PE=1 SV=2 Back     alignment and function description
>sp|Q06453|AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster GN=al PE=1 SV=2 Back     alignment and function description
>sp|P63014|PRRX1_RAT Paired mesoderm homeobox protein 1 OS=Rattus norvegicus GN=Prrx1 PE=2 SV=1 Back     alignment and function description
>sp|P63013|PRRX1_MOUSE Paired mesoderm homeobox protein 1 OS=Mus musculus GN=Prrx1 PE=2 SV=1 Back     alignment and function description
>sp|P54821|PRRX1_HUMAN Paired mesoderm homeobox protein 1 OS=Homo sapiens GN=PRRX1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query262
328717151244 PREDICTED: paired mesoderm homeobox prot 0.244 0.262 0.720 2e-18
242020400270 Ultrabithorax, putative [Pediculus human 0.232 0.225 0.761 4e-16
32145962174 hypothetical protein DAPPUDRAFT_36992 [D 0.183 0.648 0.875 9e-16
195380555288 GJ20984 [Drosophila virilis] gi|19414383 0.183 0.166 0.895 1e-15
195057533285 GH23067 [Drosophila grimshawi] gi|193899 0.183 0.168 0.895 1e-15
195489018286 GE11607 [Drosophila yakuba] gi|194178660 0.183 0.167 0.895 2e-15
198456647269 GA22090 [Drosophila pseudoobscura pseudo 0.183 0.178 0.895 2e-15
195429318288 GK19597 [Drosophila willistoni] gi|19415 0.183 0.166 0.895 2e-15
194884904281 GG20068 [Drosophila erecta] gi|190659536 0.183 0.170 0.895 2e-15
195149884269 GL11298 [Drosophila persimilis] gi|19410 0.183 0.178 0.895 2e-15
>gi|328717151|ref|XP_003246132.1| PREDICTED: paired mesoderm homeobox protein 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 99.0 bits (245), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (80%), Gaps = 4/68 (5%)

Query: 131 QMSIRVKSENDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVC 190
           Q + +  SE D     +RK KPRRNRTTF+S QL ALEKVFERTHYPDAFVREELA++VC
Sbjct: 29  QPAPQTNSETDS----QRKSKPRRNRTTFSSCQLRALEKVFERTHYPDAFVREELARRVC 84

Query: 191 LSEARVQV 198
           LSEARVQV
Sbjct: 85  LSEARVQV 92

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242020400|ref|XP_002430643.1| Ultrabithorax, putative [Pediculus humanus corporis] gi|212515815|gb|EEB17905.1| Ultrabithorax, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|321459621|gb|EFX70672.1| hypothetical protein DAPPUDRAFT_36992 [Daphnia pulex] Back     alignment and taxonomy information
>gi|195380555|ref|XP_002049036.1| GJ20984 [Drosophila virilis] gi|194143833|gb|EDW60229.1| GJ20984 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195057533|ref|XP_001995277.1| GH23067 [Drosophila grimshawi] gi|193899483|gb|EDV98349.1| GH23067 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195489018|ref|XP_002092559.1| GE11607 [Drosophila yakuba] gi|194178660|gb|EDW92271.1| GE11607 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|198456647|ref|XP_001360401.2| GA22090 [Drosophila pseudoobscura pseudoobscura] gi|198135692|gb|EAL24976.2| GA22090 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195429318|ref|XP_002062710.1| GK19597 [Drosophila willistoni] gi|194158795|gb|EDW73696.1| GK19597 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194884904|ref|XP_001976349.1| GG20068 [Drosophila erecta] gi|190659536|gb|EDV56749.1| GG20068 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195149884|ref|XP_002015885.1| GL11298 [Drosophila persimilis] gi|194109732|gb|EDW31775.1| GL11298 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query262
UNIPROTKB|F1NZI9165 PRRX2 "Paired mesoderm homeobo 0.152 0.242 0.85 9.1e-13
UNIPROTKB|Q90963165 PRRX2 "Paired mesoderm homeobo 0.152 0.242 0.85 9.1e-13
UNIPROTKB|E1BF87166 PRRX2 "Uncharacterized protein 0.152 0.240 0.85 9.1e-13
UNIPROTKB|F1PD53234 PRRX2 "Uncharacterized protein 0.152 0.170 0.85 9.1e-13
UNIPROTKB|J9P7P0234 PRRX2 "Uncharacterized protein 0.152 0.170 0.85 9.1e-13
UNIPROTKB|H0YIZ3166 PRRX2 "Paired mesoderm homeobo 0.152 0.240 0.85 9.1e-13
UNIPROTKB|F1RQG1211 PRRX2 "Uncharacterized protein 0.152 0.189 0.85 9.1e-13
MGI|MGI:98218247 Prrx2 "paired related homeobox 0.152 0.161 0.85 9.3e-13
RGD|1311471248 Prrx2 "paired related homeobox 0.152 0.161 0.85 9.8e-13
UNIPROTKB|Q99811253 PRRX2 "Paired mesoderm homeobo 0.152 0.158 0.85 1.3e-12
UNIPROTKB|F1NZI9 PRRX2 "Paired mesoderm homeobox protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 169 (64.5 bits), Expect = 9.1e-13, P = 9.1e-13
 Identities = 34/40 (85%), Positives = 37/40 (92%)

Query:   159 FNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQV 198
             FNS QL ALE+VFERTHYPDAFVREELA++V LSEARVQV
Sbjct:    23 FNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQV 62
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0002053 "positive regulation of mesenchymal cell proliferation" evidence=IEA
GO:0030326 "embryonic limb morphogenesis" evidence=IEA
GO:0042472 "inner ear morphogenesis" evidence=IEA
GO:0042474 "middle ear morphogenesis" evidence=IEA
GO:0045880 "positive regulation of smoothened signaling pathway" evidence=IEA
GO:0048701 "embryonic cranial skeleton morphogenesis" evidence=IEA
GO:0048844 "artery morphogenesis" evidence=IEA
GO:0051216 "cartilage development" evidence=IEA
UNIPROTKB|Q90963 PRRX2 "Paired mesoderm homeobox protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF87 PRRX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PD53 PRRX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7P0 PRRX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H0YIZ3 PRRX2 "Paired mesoderm homeobox protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQG1 PRRX2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:98218 Prrx2 "paired related homeobox 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311471 Prrx2 "paired related homeobox 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q99811 PRRX2 "Paired mesoderm homeobox protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-16
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-12
smart0038957 smart00389, HOX, Homeodomain 1e-12
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 2e-05
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 71.4 bits (176), Expect = 2e-16
 Identities = 27/46 (58%), Positives = 32/46 (69%)

Query: 153 RRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQV 198
           RR RTTF   QL  LEK FE+  YP A  REELAKK+ L+E +V+V
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKV 46

Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 262
KOG0842|consensus307 99.79
KOG0489|consensus261 99.77
KOG0484|consensus125 99.77
KOG0487|consensus308 99.77
KOG0488|consensus309 99.75
KOG0843|consensus197 99.74
KOG0850|consensus245 99.74
KOG0848|consensus317 99.73
KOG0485|consensus268 99.72
KOG0492|consensus246 99.71
KOG2251|consensus228 99.64
KOG0494|consensus332 99.64
KOG0844|consensus 408 99.61
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.61
KOG4577|consensus 383 99.6
KOG0493|consensus342 99.59
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.56
KOG0491|consensus194 99.54
KOG0486|consensus 351 99.49
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.48
KOG0483|consensus198 99.47
COG5576156 Homeodomain-containing transcription factor [Trans 99.46
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.44
KOG3802|consensus398 99.4
KOG0847|consensus288 99.31
KOG0490|consensus235 99.31
KOG1168|consensus385 99.21
KOG0849|consensus354 99.14
KOG0775|consensus304 98.37
KOG0490|consensus235 98.2
KOG0774|consensus334 98.11
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.96
KOG2252|consensus558 97.95
KOG1146|consensus 1406 97.19
KOG0773|consensus342 95.08
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 94.88
KOG3623|consensus 1007 94.14
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 90.34
>KOG0842|consensus Back     alignment and domain information 
Probab=99.79  E-value=2e-19  Score=165.89  Aligned_cols=76  Identities=22%  Similarity=0.245  Sum_probs=65.5

Q ss_pred             ccCCCCCCCCCCcCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCCCcceeccccccccchhhhHHHHhcCCCC
Q psy9181         146 ERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVSMMILFVRRPLALWVAEYKNPQF  221 (262)
Q Consensus       146 ~~~~~k~RR~Rt~fT~~Ql~~LE~~F~~~~yps~~~R~~LA~~lgLserqVqVWFQNRRaK~kr~Kwrr~~k~~~~  221 (262)
                      ....+++||.|..||..|+.+||+.|..++|++..||++||..|.||++||||||||||.|.||+...+.......
T Consensus       147 ~t~~~~kRKrRVLFSqAQV~ELERRFrqQRYLSAPERE~LA~~LrLT~TQVKIWFQNrRYK~KR~~~dk~~~~~~~  222 (307)
T KOG0842|consen  147 QTGKRKKRKRRVLFSQAQVYELERRFRQQRYLSAPEREHLASSLRLTPTQVKIWFQNRRYKTKRQQKDKALEALLL  222 (307)
T ss_pred             ccccccccccccccchhHHHHHHHHHHhhhccccHhHHHHHHhcCCCchheeeeeecchhhhhhhhhhhhhhcccC
Confidence            3446678888999999999999999999999999999999999999999999999999999766665555444333

>KOG0489|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 2e-09
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 2e-09
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 3e-09
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 4e-09
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 7e-09
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 1e-08
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 1e-07
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 2e-06
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 2e-05
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 2e-05
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 2e-04
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure 
Iteration: 1

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/40 (67%), Positives = 30/40 (75%)
Query: 159 FNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQV 198
           F S QL  LEK F RTHYPD F REELA K+ L+EAR+QV
Sbjct: 6   FTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQV 45
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-27
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-25
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 7e-25
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 2e-24
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 3e-24
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 6e-24
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 3e-23
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-22
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-22
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-21
3a02_A60 Homeobox protein aristaless; homeodomain, developm 1e-21
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-18
1uhs_A72 HOP, homeodomain only protein; structural genomics 3e-17
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-16
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-15
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 2e-15
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 3e-15
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 4e-15
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 7e-15
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-14
2xsd_C164 POU domain, class 3, transcription factor 1; trans 7e-13
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 8e-13
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-12
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-11
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 2e-11
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-11
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-10
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-09
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-09
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 6e-09
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-08
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 2e-08
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-08
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-08
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 6e-08
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 7e-08
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 7e-08
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 8e-08
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 2e-07
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-07
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 2e-07
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-07
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 2e-07
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 2e-06
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 3e-06
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 6e-06
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 8e-06
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-05
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 2e-05
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 7e-05
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 7e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 9e-05
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 1e-04
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 2e-04
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 4e-04
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
 Score =  100 bits (251), Expect = 1e-27
 Identities = 31/62 (50%), Positives = 43/62 (69%)

Query: 137 KSENDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARV 196
            S+ +       K K RR+RTTF++ QL+ LE+ FERT YPD + REELA++  L+EAR+
Sbjct: 3   ISDCESEPGIALKRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARI 62

Query: 197 QV 198
           QV
Sbjct: 63  QV 64
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query262
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.81
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.81
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.8
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.8
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.8
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.79
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.79
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.78
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.78
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.78
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.77
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.77
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.77
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.77
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.77
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.77
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.77
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.77
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.76
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.76
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.76
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.76
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.76
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.75
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.75
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.75
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.75
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.75
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.75
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.75
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.75
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.74
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.74
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.74
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.73
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.73
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.73
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.73
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.72
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.72
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.72
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.72
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.71
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.71
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.71
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.71
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.71
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.71
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.7
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.7
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.69
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.69
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.69
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.69
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.68
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.68
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.68
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.67
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.67
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.67
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.67
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.67
2e19_A64 Transcription factor 8; homeobox domain, structura 99.66
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.65
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.65
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.65
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.65
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.63
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.62
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.62
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.61
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.52
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.51
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.44
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.34
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.32
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.31
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.67
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 91.94
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.81  E-value=5.9e-21  Score=143.02  Aligned_cols=62  Identities=32%  Similarity=0.370  Sum_probs=57.3

Q ss_pred             ccCCCCCCCCCCcCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCCCcceeccccccccc
Q psy9181         146 ERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVSMMILFVRR  207 (262)
Q Consensus       146 ~~~~~k~RR~Rt~fT~~Ql~~LE~~F~~~~yps~~~R~~LA~~lgLserqVqVWFQNRRaK~  207 (262)
                      +....+.||.||.||.+|+.+||..|+.++||+..+|++||..|+|+++||+|||||||+|.
T Consensus        11 ~~~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~k~   72 (80)
T 2dmt_A           11 GTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKW   72 (80)
T ss_dssp             CCCCCCCCCSCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCHHHeeeccHHHHHHh
Confidence            34466788999999999999999999999999999999999999999999999999999654
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 262
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 7e-15
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-14
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 5e-13
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 5e-13
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 6e-13
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 2e-12
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-12
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 5e-12
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-11
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 1e-11
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-11
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-11
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 2e-11
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-11
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 3e-11
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 8e-11
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-10
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-10
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-10
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-10
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 5e-10
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 7e-10
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 2e-09
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 4e-09
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 6e-09
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 9e-09
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 1e-08
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-08
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 3e-08
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 7e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-05
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 6e-04
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 66.0 bits (161), Expect = 7e-15
 Identities = 16/59 (27%), Positives = 26/59 (44%)

Query: 140 NDDYDYERRKPKPRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQV 198
           N+           R+ R  +  HQ   LEK F    Y     R E+A+ + L+E +V++
Sbjct: 1   NNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKI 59
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query262
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.84
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.82
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.82
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.82
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.82
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.81
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.81
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.8
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.8
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.79
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.79
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.77
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.77
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.76
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.76
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.76
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.76
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.74
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.74
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.74
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.73
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.71
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.71
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.7
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.63
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.61
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.61
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.59
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.53
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.52
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.49
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.84  E-value=2.7e-22  Score=140.75  Aligned_cols=57  Identities=19%  Similarity=0.316  Sum_probs=54.1

Q ss_pred             CCCCCCcCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCCCcceeccccccccch
Q psy9181         152 PRRNRTTFNSHQLNALEKVFERTHYPDAFVREELAKKVCLSEARVQVSMMILFVRRP  208 (262)
Q Consensus       152 ~RR~Rt~fT~~Ql~~LE~~F~~~~yps~~~R~~LA~~lgLserqVqVWFQNRRaK~k  208 (262)
                      .||+||.||.+|+.+||..|..++||+..+|++||..|||+++||+|||||||+|.|
T Consensus         1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~k   57 (58)
T d2craa1           1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEK   57 (58)
T ss_dssp             CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTT
T ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhcc
Confidence            367899999999999999999999999999999999999999999999999998864
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure