Psyllid ID: psy9329

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MKLVLDFVPNHTSNEHPWFIKSVDKIHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAWEWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMKVRALKYDNA
cEEEEEEcccccccccHHHHHHHccccccccEEEccccccccccccccccccccccccccEEEcccccEEEccccccccccccccHHHHHHHHHHccccccc
cEEEEEEcccEccccccccccHcccccccccEEEEEcccccccccccccccEcccccEcEEEccccccEEEccccccccEEccccHHHHHHHHHHHHHHccc
MKLVLDFvpnhtsnehpwfiksvdkihpytdyyiwkdakivngkrqppnnwlscfggsawewndkrQQYYYHAFAiqqpdlnyRFQAVVDEMKVRALKYDNA
MKLVLDFVpnhtsnehpwfiksvdKIHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAWEWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMKVRALKYDNA
MKLVLDFVPNHTSNEHPWFIKSVDKIHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAWEWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMKVRALKYDNA
***VLDFVPNHTSNEHPWFIKSVDKIHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAWEWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMKVRAL*****
MKLVLDFVPNHTSNEHPWFIKSVDKIHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAWEWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMKVRALKYDN*
MKLVLDFVPNHTSNEHPWFIKSVDKIHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAWEWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMKVRALKYDNA
MKLVLDFVPNHTSNEHPWFIKSVDKIHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAWEWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMKVRALKYDNA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLVLDFVPNHTSNEHPWFIKSVDKIHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAWEWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMKVRALKYDNA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query102 2.2.26 [Sep-21-2011]
Q17058 567 Alpha-glucosidase OS=Apis no N/A 0.911 0.164 0.591 3e-29
P07190 577 Probable maltase H OS=Dro no N/A 0.911 0.161 0.642 2e-28
P07192 574 Maltase A3 OS=Drosophila no N/A 0.911 0.162 0.569 1e-27
O16099 594 Maltase 2 OS=Drosophila v N/A N/A 0.901 0.154 0.580 2e-26
Q64319 683 Neutral and basic amino a yes N/A 0.911 0.136 0.516 1e-25
P13080 579 Probable maltase OS=Aedes N/A N/A 0.960 0.169 0.53 1e-24
P07191 567 Probable maltase D OS=Dro no N/A 0.960 0.172 0.485 8e-24
Q07837 685 Neutral and basic amino a yes N/A 0.911 0.135 0.516 9e-24
O16098 632 Maltase 1 OS=Drosophila v N/A N/A 0.901 0.145 0.537 1e-23
O05242 554 Probable oligo-1,6-glucos yes N/A 0.882 0.162 0.544 8e-21
>sp|Q17058|MAL1_APIME Alpha-glucosidase OS=Apis mellifera PE=1 SV=1 Back     alignment and function desciption
 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 69/93 (74%)

Query: 1   MKLVLDFVPNHTSNEHPWFIKSVDKIHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAW 60
           +K++LDFVPNHTS++H WF  S+  I PY +YYIW   KIVNGKR PP NW+  FGGSAW
Sbjct: 114 LKIILDFVPNHTSDQHEWFQLSLKNIEPYNNYYIWHPGKIVNGKRVPPTNWVGVFGGSAW 173

Query: 61  EWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMK 93
            W ++RQ YY H FA +QPDLNY    V+D+M+
Sbjct: 174 SWREERQAYYLHQFAPEQPDLNYYNPVVLDDMQ 206
Converts sucrose in nectar to glucose and fructose.
Apis mellifera (taxid: 7460)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 2EC: 0
>sp|P07190|MAL2_DROME Probable maltase H OS=Drosophila melanogaster GN=LvpH PE=2 SV=2 Back     alignment and function description
>sp|P07192|MAL3_DROME Maltase A3 OS=Drosophila melanogaster GN=Mal-A3 PE=2 SV=2 Back     alignment and function description
>sp|O16099|MAL2_DROVI Maltase 2 OS=Drosophila virilis GN=Mal-B2 PE=3 SV=2 Back     alignment and function description
>sp|Q64319|SLC31_RAT Neutral and basic amino acid transport protein rBAT OS=Rattus norvegicus GN=Slc3a1 PE=1 SV=1 Back     alignment and function description
>sp|P13080|MALT_AEDAE Probable maltase OS=Aedes aegypti GN=MAL1 PE=2 SV=1 Back     alignment and function description
>sp|P07191|MAL1_DROME Probable maltase D OS=Drosophila melanogaster GN=LvpD PE=2 SV=2 Back     alignment and function description
>sp|Q07837|SLC31_HUMAN Neutral and basic amino acid transport protein rBAT OS=Homo sapiens GN=SLC3A1 PE=1 SV=2 Back     alignment and function description
>sp|O16098|MAL1_DROVI Maltase 1 OS=Drosophila virilis GN=Mal-B1 PE=3 SV=2 Back     alignment and function description
>sp|O05242|O16G3_BACSU Probable oligo-1,6-glucosidase 3 OS=Bacillus subtilis (strain 168) GN=yugT PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
404327489 579 alpha glucosidase II [Apis cerana indica 0.911 0.160 0.709 2e-34
224808528 579 alpha-glucosidase isozyme II [Apis ceran 0.911 0.160 0.709 3e-34
380015004 572 PREDICTED: maltase 2-like [Apis florea] 0.911 0.162 0.688 7e-34
383856267 567 PREDICTED: probable maltase H-like [Mega 0.911 0.164 0.666 1e-33
340717760 572 PREDICTED: probable maltase H-like [Bomb 0.901 0.160 0.652 2e-33
94400901 580 alpha-glucosidase precursor [Apis mellif 0.911 0.160 0.677 2e-33
340727803 526 PREDICTED: probable maltase H-like, part 0.911 0.176 0.655 4e-33
350422557 572 PREDICTED: probable maltase H-like [Bomb 0.911 0.162 0.677 5e-33
340730076 526 PREDICTED: probable maltase H-like, part 0.911 0.176 0.655 6e-33
350423823 574 PREDICTED: maltase 2-like [Bombus impati 0.911 0.162 0.666 1e-32
>gi|404327489|gb|AFR59339.1| alpha glucosidase II [Apis cerana indica] Back     alignment and taxonomy information
 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 66/93 (70%), Positives = 77/93 (82%)

Query: 1   MKLVLDFVPNHTSNEHPWFIKSVDKIHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAW 60
           +K++LDFVPNH+S+EHPWF KSV +I PY +YY+W+DA+IVNG RQPPNNWLS F GSAW
Sbjct: 113 LKVILDFVPNHSSHEHPWFKKSVQRIKPYDEYYVWRDARIVNGTRQPPNNWLSVFWGSAW 172

Query: 61  EWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMK 93
           EWND RQQYY H FA  QPDLNYR  A+  EMK
Sbjct: 173 EWNDVRQQYYLHQFAAGQPDLNYRSAALDQEMK 205

Source: Apis cerana indica

Species: Apis cerana

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|224808528|gb|ACN63343.1| alpha-glucosidase isozyme II [Apis cerana japonica] Back     alignment and taxonomy information
>gi|380015004|ref|XP_003691502.1| PREDICTED: maltase 2-like [Apis florea] Back     alignment and taxonomy information
>gi|383856267|ref|XP_003703631.1| PREDICTED: probable maltase H-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340717760|ref|XP_003397344.1| PREDICTED: probable maltase H-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|94400901|ref|NP_001035349.1| alpha-glucosidase precursor [Apis mellifera] gi|89885577|dbj|BAE86927.1| alpha-glucosidase [Apis mellifera] Back     alignment and taxonomy information
>gi|340727803|ref|XP_003402225.1| PREDICTED: probable maltase H-like, partial [Bombus terrestris] Back     alignment and taxonomy information
>gi|350422557|ref|XP_003493203.1| PREDICTED: probable maltase H-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340730076|ref|XP_003403314.1| PREDICTED: probable maltase H-like, partial [Bombus terrestris] Back     alignment and taxonomy information
>gi|350423823|ref|XP_003493603.1| PREDICTED: maltase 2-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
FB|FBgn0033297 588 Mal-A8 "Maltase A8" [Drosophil 0.960 0.166 0.623 2.6e-32
FB|FBgn0033296 599 Mal-A7 "Maltase A7" [Drosophil 0.960 0.163 0.584 2.9e-31
FB|FBgn0050360 601 Mal-A6 "Maltase A6" [Drosophil 0.960 0.163 0.603 1.7e-30
FB|FBgn0032381 584 Mal-B1 "Maltase B1" [Drosophil 0.901 0.157 0.612 3.2e-29
FB|FBgn0002570 577 Mal-A1 "Maltase A1" [Drosophil 0.911 0.161 0.642 5.1e-29
FB|FBgn0002571 574 Mal-A3 "Maltase A3" [Drosophil 0.911 0.162 0.569 2.9e-27
RGD|3709 683 Slc3a1 "solute carrier family 0.911 0.136 0.516 2.1e-25
FB|FBgn0032382 583 Mal-B2 "Maltase B2" [Drosophil 0.901 0.157 0.559 3.7e-25
UNIPROTKB|Q4J6B8391 SLC3A1 "Neutral and basic amin 0.911 0.237 0.516 9.7e-25
FB|FBgn0002569 567 Mal-A2 "Maltase A2" [Drosophil 0.960 0.172 0.485 1.5e-24
FB|FBgn0033297 Mal-A8 "Maltase A8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 358 (131.1 bits), Expect = 2.6e-32, P = 2.6e-32
 Identities = 63/101 (62%), Positives = 76/101 (75%)

Query:     1 MKLVLDFVPNHTSNEHPWFIKSVDKIHPYTDYYIWKDAKI--VNGKRQPPNNWLSCFGGS 58
             +K+VLDFVPNH+SNE  WF+KSV +   Y DYY+W D K+    GKR+PP NWL  F GS
Sbjct:   121 LKIVLDFVPNHSSNESEWFLKSVKREKGYEDYYVWHDGKVNSTTGKREPPTNWLQYFRGS 180

Query:    59 AWEWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMKVRALKY 99
             AWEWN+ RQQYY H FA+QQPDLNYR   VV++MK R L+Y
Sbjct:   181 AWEWNEVRQQYYLHQFAVQQPDLNYRNPLVVEQMK-RVLRY 220
GO:0004558 "alpha-glucosidase activity" evidence=ISS
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
FB|FBgn0033296 Mal-A7 "Maltase A7" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0050360 Mal-A6 "Maltase A6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032381 Mal-B1 "Maltase B1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0002570 Mal-A1 "Maltase A1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0002571 Mal-A3 "Maltase A3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|3709 Slc3a1 "solute carrier family 3, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0032382 Mal-B2 "Maltase B2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q4J6B8 SLC3A1 "Neutral and basic amino acid transport protein rBAT" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0002569 Mal-A2 "Maltase A2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q07837SLC31_HUMANNo assigned EC number0.51610.91170.1357yesN/A
Q64319SLC31_RATNo assigned EC number0.51610.91170.1361yesN/A
O05242O16G3_BACSU3, ., 2, ., 1, ., 1, 00.54450.88230.1624yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
cd11328 470 cd11328, AmyAc_maltase, Alpha amylase catalytic do 9e-55
cd11359 456 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom 4e-43
cd11333 428 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca 4e-43
cd11331 450 cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly 3e-39
cd11330 472 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d 1e-35
cd11329 477 cd11329, AmyAc_maltase-like, Alpha amylase catalyt 1e-33
PRK10933 551 PRK10933, PRK10933, trehalose-6-phosphate hydrolas 3e-31
TIGR02403 543 TIGR02403, trehalose_treC, alpha,alpha-phosphotreh 1e-26
pfam00128 314 pfam00128, Alpha-amylase, Alpha amylase, catalytic 1e-25
cd11332 481 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti 1e-23
cd11316 403 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic 3e-23
cd11334 447 cd11334, AmyAc_TreS, Alpha amylase catalytic domai 3e-22
COG0366 505 COG0366, AmyA, Glycosidases [Carbohydrate transpor 2e-19
TIGR02456 539 TIGR02456, treS_nterm, trehalose synthase 5e-19
cd11348 429 cd11348, AmyAc_2, Alpha amylase catalytic domain f 5e-12
cd11313 336 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase cataly 5e-09
cd11324 536 cd11324, AmyAc_Amylosucrase, Alpha amylase catalyt 4e-08
cd11338 389 cd11338, AmyAc_CMD, Alpha amylase catalytic domain 9e-06
PRK10785 598 PRK10785, PRK10785, maltodextrin glucosidase; Prov 4e-05
cd11347 391 cd11347, AmyAc_1, Alpha amylase catalytic domain f 6e-05
cd11343 445 cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha a 4e-04
cd11356 458 cd11356, AmyAc_Sucrose_phosphorylase-like_1, Alpha 8e-04
cd11340 407 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catal 0.004
>gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins Back     alignment and domain information 
 Score =  175 bits (447), Expect = 9e-55
 Identities = 62/94 (65%), Positives = 74/94 (78%), Gaps = 1/94 (1%)

Query: 1   MKLVLDFVPNHTSNEHPWFIKSVDKIHPYTDYYIWKDAKIV-NGKRQPPNNWLSCFGGSA 59
           +K++LDFVPNH+S+EH WF KSV +  PY DYY+W D K   NG R PPNNWLS FGGSA
Sbjct: 92  LKVILDFVPNHSSDEHEWFQKSVKRDEPYKDYYVWHDGKNNDNGTRVPPNNWLSVFGGSA 151

Query: 60  WEWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEMK 93
           W WN++RQQYY H FA++QPDLNYR   VV+EMK
Sbjct: 152 WTWNEERQQYYLHQFAVKQPDLNYRNPKVVEEMK 185

Maltase (EC 3.2.1.20) hydrolyzes the terminal, non-reducing (1->4)-linked alpha-D-glucose residues in maltose, releasing alpha-D-glucose. In most cases, maltase is equivalent to alpha-glucosidase, but the term "maltase" emphasizes the disaccharide nature of the substrate from which glucose is cleaved, and the term "alpha-glucosidase" emphasizes the bond, whether the substrate is a disaccharide or polysaccharide. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 470
>gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins Back     alignment and domain information
>gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins Back     alignment and domain information
>gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins Back     alignment and domain information
>gnl|CDD|200468 cd11329, AmyAc_maltase-like, Alpha amylase catalytic domain family found in maltase Back     alignment and domain information
>gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase Back     alignment and domain information
>gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain Back     alignment and domain information
>gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins Back     alignment and domain information
>gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase Back     alignment and domain information
>gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase Back     alignment and domain information
>gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200452 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200463 cd11324, AmyAc_Amylosucrase, Alpha amylase catalytic domain found in Amylosucrase Back     alignment and domain information
>gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins Back     alignment and domain information
>gnl|CDD|236759 PRK10785, PRK10785, maltodextrin glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|200485 cd11347, AmyAc_1, Alpha amylase catalytic domain found in an uncharacterized protein family Back     alignment and domain information
>gnl|CDD|200481 cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha amylase catalytic domain found in sucrose phosphorylase (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) Back     alignment and domain information
>gnl|CDD|200493 cd11356, AmyAc_Sucrose_phosphorylase-like_1, Alpha amylase catalytic domain found in sucrose phosphorylase-like proteins (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) Back     alignment and domain information
>gnl|CDD|200479 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 102
PRK13840 495 sucrose phosphorylase; Provisional 99.96
TIGR03852 470 sucrose_gtfA sucrose phosphorylase. In the forward 99.95
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 99.94
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 99.94
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 99.88
COG0366 505 AmyA Glycosidases [Carbohydrate transport and meta 99.87
TIGR02455 688 TreS_stutzeri trehalose synthase, Pseudomonas stut 99.85
KOG0471|consensus 545 99.84
PF00128 316 Alpha-amylase: Alpha amylase, catalytic domain; In 99.82
PRK10785 598 maltodextrin glucosidase; Provisional 99.73
PRK09441 479 cytoplasmic alpha-amylase; Reviewed 99.36
PRK09505 683 malS alpha-amylase; Reviewed 99.32
PLN00196 428 alpha-amylase; Provisional 99.27
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 99.02
PRK03705 658 glycogen debranching enzyme; Provisional 99.01
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 98.98
PLN02784 894 alpha-amylase 98.91
PRK12313 633 glycogen branching enzyme; Provisional 98.87
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 98.84
PLN02361 401 alpha-amylase 98.81
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 98.72
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 98.7
PRK05402 726 glycogen branching enzyme; Provisional 98.67
TIGR02104 605 pulA_typeI pullulanase, type I. Pullulan is an unu 98.66
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 98.61
PLN02877 970 alpha-amylase/limit dextrinase 98.6
PLN02960 897 alpha-amylase 98.58
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 98.57
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 98.53
PRK14511 879 maltooligosyl trehalose synthase; Provisional 98.5
PRK14706 639 glycogen branching enzyme; Provisional 98.48
PRK12568 730 glycogen branching enzyme; Provisional 98.46
PLN02447 758 1,4-alpha-glucan-branching enzyme 98.42
PRK14705 1224 glycogen branching enzyme; Provisional 98.32
COG1523 697 PulA Type II secretory pathway, pullulanase PulA a 98.21
PLN03244 872 alpha-amylase; Provisional 98.12
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 97.44
COG3280 889 TreY Maltooligosyl trehalose synthase [Carbohydrat 97.38
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 97.22
smart00642166 Aamy Alpha-amylase domain. 96.86
KOG0470|consensus 757 96.32
PF14701 423 hDGE_amylase: glucanotransferase domain of human g 95.97
cd06593 308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 87.67
KOG2212|consensus 504 84.54
PF14872 811 GHL5: Hypothetical glycoside hydrolase 5 83.79
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information 
Probab=99.96  E-value=3.7e-29  Score=189.32  Aligned_cols=100  Identities=19%  Similarity=0.315  Sum_probs=82.1

Q ss_pred             CEEEEeecccccCCCCHHHHHhhhC--CCCCCceEEeeCCcccCCCcCCCCCccccCC---CC---cceecCCCCcEEEE
Q psy9329           1 MKLVLDFVPNHTSNEHPWFIKSVDK--IHPYTDYYIWKDAKIVNGKRQPPNNWLSCFG---GS---AWEWNDKRQQYYYH   72 (102)
Q Consensus         1 ikvilD~v~NHtS~~h~wF~~a~~~--~~~~~d~f~~~~~~~~~~~~~~p~~~~~~~~---~~---~~~~~~~~~~~y~~   72 (102)
                      ||||||+|+||||++|||||+++++  +++|+|||+|.+.....+  .++.++.+++.   ++   .|++.++..++||+
T Consensus        78 iklmlDlV~NHtS~~h~WFqd~l~~~~~s~Y~D~fi~~d~~~~~~--~~~~~~~~if~~~~g~~~~~~~~~~~~~~~~w~  155 (495)
T PRK13840         78 HDIMADLIVNHMSAESPQFQDVLAKGEASEYWPMFLTKDKVFPDG--ATEEDLAGIYRPRPGLPFTTYTLADGKTRLVWT  155 (495)
T ss_pred             CeEEEEECCCcCCCCcHHHHHHHHhCCCCCccCeEEECCCCCcCC--CCCcccccccCCCCCCcccceEecCCCceEEec
Confidence            7999999999999999999999864  899999999987422111  24455655553   33   45567777899999


Q ss_pred             eeCCCCcccCCCCHHHHHHHHHHHHHHHcC
Q psy9329          73 AFAIQQPDLNYRFQAVVDEMKVRALKYDNA  102 (102)
Q Consensus        73 ~f~~~~pdLN~~np~v~~~~~~v~~~w~~~  102 (102)
                      +|++.|||||++||+|+++|.+|+++|+++
T Consensus       156 tF~~~QpDLN~~NP~V~~~i~~il~fwl~~  185 (495)
T PRK13840        156 TFTPQQIDIDVHSAAGWEYLMSILDRFAAS  185 (495)
T ss_pred             cCCcccceeCCCCHHHHHHHHHHHHHHHHC
Confidence            999999999999999999999999999974

>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>KOG0471|consensus Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>KOG0470|consensus Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>KOG2212|consensus Back     alignment and domain information
>PF14872 GHL5: Hypothetical glycoside hydrolase 5 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
1m53_A 570 Crystal Structure Of Isomaltulose Synthase (Pali) F 1e-21
2ze0_A 555 Alpha-glucosidase Gsj Length = 555 1e-20
3gbd_A 558 Crystal Structure Of The Isomaltulose Synthase Smua 4e-19
1uok_A 558 Crystal Structure Of B. Cereus Oligo-1,6-Glucosidas 5e-18
4gin_A 584 Crystal Structure Of The Mutb R284c Mutant From Cry 8e-17
2pwf_A 556 Crystal Structure Of The Mutb D200a Mutant In Compl 8e-17
1zja_A 557 Crystal Structure Of The Trehalulose Synthase Mutb 8e-17
2pwg_A 556 Crystal Structure Of The Trehalulose Synthase Mutb 8e-17
2pwe_A 556 Crystal Structure Of The Mutb E254q Mutant In Compl 8e-17
4h2c_A 557 Trehalulose Synthase Mutb R284c Mutant Length = 557 9e-17
3axh_A 589 Crystal Structure Of Isomaltase In Complex With Iso 3e-16
3a47_A 589 Crystal Structure Of Isomaltase From Saccharomyces 3e-16
4gi6_A 557 Crystal Structure Of The Mutb F164l Mutant In Compl 3e-16
2zid_A 543 Crystal Structure Of Dextran Glucosidase E236q Comp 4e-16
2zic_A 543 Crystal Structure Of Streptococcus Mutans Dextran G 4e-16
4aie_A 549 Structure Of Glucan-1,6-Alpha-Glucosidase From Lact 5e-16
1wza_A 488 Crystal Structure Of Alpha-Amylase From H.Orenii Le 2e-06
1lwh_A 441 Crystal Structure Of T. Maritima 4-Alpha-Glucanotra 6e-05
2wpg_A 637 Sucrose Hydrolase Length = 637 2e-04
>pdb|1M53|A Chain A, Crystal Structure Of Isomaltulose Synthase (Pali) From Klebsiella Sp. Lx3 Length = 570 Back     alignment and structure 
Iteration: 1

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 60/83 (72%), Gaps = 5/83 (6%)
Query: 1   MKLVLDFVPNHTSNEHPWFIKS-VDKIHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSA 59
           M+L++D V NHTS++HPWFI+S  DK +PY DYY W+D K      QPPNN+ S FGGSA
Sbjct: 107 MRLMIDVVINHTSDQHPWFIQSKSDKNNPYRDYYFWRDGK----DNQPPNNYPSFFGGSA 162
Query: 60  WEWNDKRQQYYYHAFAIQQPDLN 82
           W+ + K  QYY H FA QQPDLN
Sbjct: 163 WQKDAKSGQYYLHYFARQQPDLN 185
>pdb|2ZE0|A Chain A, Alpha-glucosidase Gsj Length = 555 Back     alignment and structure
>pdb|3GBD|A Chain A, Crystal Structure Of The Isomaltulose Synthase Smua From Protaminobacter Rubrum Length = 558 Back     alignment and structure
>pdb|1UOK|A Chain A, Crystal Structure Of B. Cereus Oligo-1,6-Glucosidase Length = 558 Back     alignment and structure
>pdb|4GIN|A Chain A, Crystal Structure Of The Mutb R284c Mutant From Crystals Soaked With The Inhibitor Deoxynojirimycin Length = 584 Back     alignment and structure
>pdb|2PWF|A Chain A, Crystal Structure Of The Mutb D200a Mutant In Complex With Glucose Length = 556 Back     alignment and structure
>pdb|1ZJA|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 (Triclinic Form) Length = 557 Back     alignment and structure
>pdb|2PWG|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 Complexed To The Inhibitor Castanospermine Length = 556 Back     alignment and structure
>pdb|2PWE|A Chain A, Crystal Structure Of The Mutb E254q Mutant In Complex With The Substrate Sucrose Length = 556 Back     alignment and structure
>pdb|4H2C|A Chain A, Trehalulose Synthase Mutb R284c Mutant Length = 557 Back     alignment and structure
>pdb|3AXH|A Chain A, Crystal Structure Of Isomaltase In Complex With Isomaltose Length = 589 Back     alignment and structure
>pdb|3A47|A Chain A, Crystal Structure Of Isomaltase From Saccharomyces Cerevisiae Length = 589 Back     alignment and structure
>pdb|4GI6|A Chain A, Crystal Structure Of The Mutb F164l Mutant In Complex With Glucose Length = 557 Back     alignment and structure
>pdb|2ZID|A Chain A, Crystal Structure Of Dextran Glucosidase E236q Complex With Isomaltotriose Length = 543 Back     alignment and structure
>pdb|2ZIC|A Chain A, Crystal Structure Of Streptococcus Mutans Dextran Glucosidase Length = 543 Back     alignment and structure
>pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 Back     alignment and structure
>pdb|1WZA|A Chain A, Crystal Structure Of Alpha-Amylase From H.Orenii Length = 488 Back     alignment and structure
>pdb|1LWH|A Chain A, Crystal Structure Of T. Maritima 4-Alpha-Glucanotransferase Length = 441 Back     alignment and structure
>pdb|2WPG|A Chain A, Sucrose Hydrolase Length = 637 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 3e-42
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 5e-42
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 6e-42
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 7e-42
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 3e-41
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 5e-40
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 7e-40
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 1e-39
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 4e-29
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 1e-23
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 6e-27
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 1e-25
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 3e-24
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 8e-24
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 2e-20
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 3e-16
1r7a_A 504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 4e-16
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 2e-15
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 8e-14
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 1e-11
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 1e-11
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 1e-11
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 2e-11
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 5e-11
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 1e-10
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 4e-10
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 4e-10
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 6e-10
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 5e-09
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 2e-08
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 8e-08
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 2e-07
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 2e-07
1ht6_A 405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 3e-07
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 6e-07
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 8e-07
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 2e-06
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 2e-06
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 3e-06
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 3e-06
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 4e-06
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 2e-04
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 7e-04
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 Back     alignment and structure
 Score =  144 bits (365), Expect = 3e-42
 Identities = 40/95 (42%), Positives = 56/95 (58%), Gaps = 3/95 (3%)

Query: 1   MKLVLDFVPNHTSNEHPWFIKSV-DKIHPYTDYYIWKDAKIVN--GKRQPPNNWLSCFGG 57
           MK + D V NH S+EH WF +S   K +P  D++ W+  K  +  GK  PPNNW S FGG
Sbjct: 102 MKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGG 161

Query: 58  SAWEWNDKRQQYYYHAFAIQQPDLNYRFQAVVDEM 92
           SAW +++K Q++Y   F   QPDLN+  +     +
Sbjct: 162 SAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAI 196
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Length = 488 Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Length = 441 Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Length = 704 Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Length = 720 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Length = 637 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Length = 435 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 99.94
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 99.94
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 99.94
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 99.94
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 99.93
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 99.93
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 99.92
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 99.9
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 99.89
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 99.88
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 99.88
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 99.87
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 99.86
1r7a_A 504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 99.85
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 99.83
4aef_A 645 Neopullulanase (alpha-amylase II); hydrolase, ther 99.8
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 99.79
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 99.77
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 99.75
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 99.74
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 99.74
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 99.72
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 99.61
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 99.57
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 99.56
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 99.54
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 99.52
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 99.52
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 99.52
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 99.51
1ht6_A 405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 99.5
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 99.5
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 99.5
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 99.48
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 99.47
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 99.45
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 99.45
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 99.41
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 99.4
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 99.39
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 99.39
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 99.32
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 99.28
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 99.28
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 99.25
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 99.25
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 99.24
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 99.23
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 99.21
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 99.12
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 99.1
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 99.09
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 99.07
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.02
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 99.0
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 98.92
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 98.87
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 98.86
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 98.78
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 98.77
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 98.69
3klk_A 1039 Glucansucrase; native form, open conformation, mul 98.67
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 98.67
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 98.52
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 98.51
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 98.14
3aie_A 844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 97.79
3klk_A 1039 Glucansucrase; native form, open conformation, mul 96.76
2yfo_A 720 Alpha-galactosidase-sucrose kinase agask; hydrolas 90.22
3mi6_A 745 Alpha-galactosidase; NESG, structural genomics, PS 89.75
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
Probab=99.94  E-value=2.6e-27  Score=180.23  Aligned_cols=97  Identities=44%  Similarity=0.809  Sum_probs=89.1

Q ss_pred             CEEEEeecccccCCCCHHHHHhhhC-CCCCCceEEeeCCcccCCCcCCCCCccccCCCCcceecCCCCcEEEEeeCCCCc
Q psy9329           1 MKLVLDFVPNHTSNEHPWFIKSVDK-IHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAWEWNDKRQQYYYHAFAIQQP   79 (102)
Q Consensus         1 ikvilD~v~NHtS~~h~wF~~a~~~-~~~~~d~f~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~y~~~f~~~~p   79 (102)
                      ||||||+|+||||.+|+||++++++ +++|+|||+|.++..  |  .+|++|.+.+++++|.+++.+++||++.|.+.||
T Consensus        94 i~VilD~V~NHts~~~~wf~~~~~~~~~~y~d~y~~~~~~~--g--~~p~~~~~~f~~~~w~~~~~~~~~y~~~f~~~~p  169 (557)
T 1zja_A           94 MRLMVDVVINHSSDQHEWFKSSRASKDNPYRDYYFWRDGKD--G--HEPNNYPSFFGGSAWEKDPVTGQYYLHYFGRQQP  169 (557)
T ss_dssp             CEEEEEECCSBCCTTSHHHHHHTTCTTCTTGGGBCEECCBT--T--BCSSCCBCTTSSBSEEEETTTTEEEECSSCTTSC
T ss_pred             CEEEEEEeccccccchhHHHHhhcCCCCCCccceEecCCcC--C--CCCccccccCCCccccccCCcCcEEEecccccCC
Confidence            8999999999999999999999875 889999999987642  3  3678899999999999998899999999999999


Q ss_pred             ccCCCCHHHHHHHHHHHHHHHc
Q psy9329          80 DLNYRFQAVVDEMKVRALKYDN  101 (102)
Q Consensus        80 dLN~~np~v~~~~~~v~~~w~~  101 (102)
                      |||++||+||++|++++++|++
T Consensus       170 dLN~~np~Vr~~l~~~~~~Wl~  191 (557)
T 1zja_A          170 DLNWDTPKLREELYAMLRFWLD  191 (557)
T ss_dssp             BBCTTCHHHHHHHHHHHHHHHT
T ss_pred             ccCCCCHHHHHHHHHHHHHHHH
Confidence            9999999999999999999996
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 102
d1iv8a2 653 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase 3e-21
d1g5aa2 554 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc 4e-12
d1gjwa2 572 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga 4e-10
d1m53a2 478 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle 2e-09
d1hx0a2 403 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s 8e-08
d1uoka2 479 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus 2e-06
d1r7aa2 434 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac 9e-06
d2d3na2 394 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu 2e-05
d1jaea2 378 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea 6e-05
d1mxga2 361 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo 6e-05
d1ht6a2 347 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor 4e-04
d1g94a2 354 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoa 0.001
d1ud2a2 390 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu 0.002
d2guya2 381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 0.004
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Maltooligosyl trehalose synthase
species: Archaeon Sulfolobus acidocaldarius [TaxId: 2285]

 Score = 84.6 bits (209), Expect = 3e-21
 Identities = 14/88 (15%), Positives = 30/88 (34%), Gaps = 4/88 (4%)

Query: 1   MKLVLDFVPNHTSNEHPWFIKS-VDKIHPYTDYYIWKDAKIVNGKRQ---PPNNWLSCFG 56
           + ++ D VPNH +     +    V K+   + YY + D    + K +      +  +   
Sbjct: 80  LGIIQDIVPNHMAVNSLNWRLMDVLKMGKKSKYYTYFDFFPEDDKIRLPILGEDLDTVIS 139

Query: 57  GSAWEWNDKRQQYYYHAFAIQQPDLNYR 84
               +      +Y+   F  + P     
Sbjct: 140 KGLLKIVKDGDEYFLEYFKWKLPLTEVG 167
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 572 Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Length = 354 Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
d1m53a2 478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 99.85
d1uoka2 479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 99.84
d1g5aa2 554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 99.81
d1lwha2 391 4-alpha-glucanotransferase {Thermotoga maritima [T 99.79
d1wzaa2 409 Bacterial alpha-amylase {Halothermothrix orenii [T 99.73
d1r7aa2 434 Sucrose phosphorylase {Bifidobacterium adolescenti 99.71
d1h3ga3 422 Cyclomaltodextrinase, central domain {Flavobacteri 99.7
d1wzla3 382 Maltogenic amylase, central domain {Thermoactinomy 99.69
d1j0ha3 382 Neopullulanase, central domain {Bacillus stearothe 99.67
d1ea9c3 382 Maltogenic amylase, central domain {Bacillus sp., 99.67
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 99.59
d3bmva4 406 Cyclodextrin glycosyltransferase {Thermoanaerobact 99.57
d1ua7a2 344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 99.55
d1ht6a2 347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 99.54
d1qhoa4 407 Cyclodextrin glycosyltransferase {Bacillus stearot 99.5
d2guya2 381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 99.47
d1jaea2 378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 99.43
d2bhua3 420 Glycosyltrehalose trehalohydrolase, central domain 99.43
d1gcya2 357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 99.41
d2d3na2 394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 99.34
d1e43a2 393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 99.32
d2aaaa2 381 Fungal alpha-amylases {Aspergillus niger, acid amy 99.31
d1hx0a2 403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 99.3
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 99.3
d1hvxa2 393 Bacterial alpha-amylase {Bacillus stearothermophil 99.3
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 99.28
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 99.24
d1eh9a3 400 Glycosyltrehalose trehalohydrolase, central domain 99.19
d1ji1a3 432 Maltogenic amylase, central domain {Thermoactinomy 99.19
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 99.07
d1m7xa3 396 1,4-alpha-glucan branching enzyme, central domain 98.96
d1ud2a2 390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 98.93
d1mxga2 361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 98.89
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 94.01
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Isomaltulose synthase PalI
species: Klebsiella sp., lx3 [TaxId: 576]

Probab=99.85  E-value=1.5e-21  Score=142.04  Aligned_cols=97  Identities=49%  Similarity=0.898  Sum_probs=87.0

Q ss_pred             CEEEEeecccccCCCCHHHHHhhhC-CCCCCceEEeeCCcccCCCcCCCCCccccCCCCcceecCCCCcEEEEeeCCCCc
Q psy9329           1 MKLVLDFVPNHTSNEHPWFIKSVDK-IHPYTDYYIWKDAKIVNGKRQPPNNWLSCFGGSAWEWNDKRQQYYYHAFAIQQP   79 (102)
Q Consensus         1 ikvilD~v~NHtS~~h~wF~~a~~~-~~~~~d~f~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~y~~~f~~~~p   79 (102)
                      ||||||+|+||||.+||||+.+.++ ..+|+++|.|.++...    .+|.++.+.+++..+..+...+++|++.|...+|
T Consensus        93 i~VilD~V~NH~~~~~~~f~~~~~~~~~~~~~~~~~~d~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  168 (478)
T d1m53a2          93 MRLMIDVVINHTSDQHPWFIQSKSDKNNPYRDYYFWRDGKDN----QPPNNYPSFFGGSAWQKDAKSGQYYLHYFARQQP  168 (478)
T ss_dssp             CEEEEEECCSBCCTTSHHHHHHHHCTTCTTGGGBCEECCSSS----SCSSCCBCTTSSBSEEECTTTCCEEECSSCTTCC
T ss_pred             CEEEeccccccccccCchhhhcccCCCCCccccccccCCCcC----CCCccccccCCCCccccccccCcccccCcCCCCC
Confidence            8999999999999999999999886 8899999999987642    4667777777777787888889999999999999


Q ss_pred             ccCCCCHHHHHHHHHHHHHHHc
Q psy9329          80 DLNYRFQAVVDEMKVRALKYDN  101 (102)
Q Consensus        80 dLN~~np~v~~~~~~v~~~w~~  101 (102)
                      |||++||+|+++|++++++|++
T Consensus       169 dln~~~~~V~~~i~~~~~~w~e  190 (478)
T d1m53a2         169 DLNWDNPKVREDLYAMLRFWLD  190 (478)
T ss_dssp             BBCTTSHHHHHHHHHHHHHHHT
T ss_pred             cccchhHHHHHHHHHHHHHHHh
Confidence            9999999999999999999986
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure